| Basic Information | |
|---|---|
| Family ID | F070281 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MFQHTVMNYVETSAPAELTLVEWRASRLAATPRRRRLRFTPPRVRLAFA |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 42.62 % |
| % of genes near scaffold ends (potentially truncated) | 30.08 % |
| % of genes from short scaffolds (< 2000 bps) | 91.06 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.114 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.138 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.829 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.463 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13275 | S4_2 | 41.46 |
| PF00166 | Cpn10 | 30.89 |
| PF13561 | adh_short_C2 | 13.01 |
| PF13417 | GST_N_3 | 3.25 |
| PF11617 | Cu-binding_MopE | 2.44 |
| PF00106 | adh_short | 1.63 |
| PF00294 | PfkB | 0.81 |
| PF09084 | NMT1 | 0.81 |
| PF13410 | GST_C_2 | 0.81 |
| PF01019 | G_glu_transpept | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 30.89 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.81 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.11 % |
| Unclassified | root | N/A | 17.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_118611479 | Not Available | 577 | Open in IMG/M |
| 3300004081|Ga0063454_101360058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300004114|Ga0062593_102724994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 563 | Open in IMG/M |
| 3300004156|Ga0062589_101913019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 599 | Open in IMG/M |
| 3300004480|Ga0062592_101115625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 731 | Open in IMG/M |
| 3300004643|Ga0062591_101676434 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005327|Ga0070658_11226526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 652 | Open in IMG/M |
| 3300005337|Ga0070682_100588366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 877 | Open in IMG/M |
| 3300005456|Ga0070678_100274674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1423 | Open in IMG/M |
| 3300005548|Ga0070665_102013366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300005564|Ga0070664_101520509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 633 | Open in IMG/M |
| 3300005618|Ga0068864_102389999 | Not Available | 535 | Open in IMG/M |
| 3300006196|Ga0075422_10304016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300006755|Ga0079222_10241956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
| 3300006844|Ga0075428_102029996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300006844|Ga0075428_102174096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300006853|Ga0075420_100495719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1055 | Open in IMG/M |
| 3300006876|Ga0079217_10111701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1251 | Open in IMG/M |
| 3300006876|Ga0079217_10356037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
| 3300006876|Ga0079217_10512955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 750 | Open in IMG/M |
| 3300006876|Ga0079217_11165711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300006880|Ga0075429_100559977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1002 | Open in IMG/M |
| 3300006904|Ga0075424_102117914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 593 | Open in IMG/M |
| 3300006918|Ga0079216_10128492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1282 | Open in IMG/M |
| 3300006918|Ga0079216_11875895 | Not Available | 517 | Open in IMG/M |
| 3300007004|Ga0079218_11013492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 834 | Open in IMG/M |
| 3300007004|Ga0079218_13263499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 549 | Open in IMG/M |
| 3300007790|Ga0105679_10052139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1559 | Open in IMG/M |
| 3300009100|Ga0075418_10734154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1065 | Open in IMG/M |
| 3300009100|Ga0075418_11745064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 677 | Open in IMG/M |
| 3300009147|Ga0114129_11364128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 876 | Open in IMG/M |
| 3300009156|Ga0111538_12499046 | Not Available | 648 | Open in IMG/M |
| 3300009553|Ga0105249_10598985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1156 | Open in IMG/M |
| 3300009789|Ga0126307_10036267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 3814 | Open in IMG/M |
| 3300009789|Ga0126307_10039659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3654 | Open in IMG/M |
| 3300009789|Ga0126307_10075021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2665 | Open in IMG/M |
| 3300009789|Ga0126307_10077833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2616 | Open in IMG/M |
| 3300009789|Ga0126307_10324643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1239 | Open in IMG/M |
| 3300009789|Ga0126307_10417109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1083 | Open in IMG/M |
| 3300009789|Ga0126307_10455702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1032 | Open in IMG/M |
| 3300009840|Ga0126313_10006709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 6977 | Open in IMG/M |
| 3300009840|Ga0126313_10485970 | Not Available | 987 | Open in IMG/M |
| 3300009840|Ga0126313_11016378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 679 | Open in IMG/M |
| 3300010036|Ga0126305_10408382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 896 | Open in IMG/M |
| 3300010038|Ga0126315_10005578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5618 | Open in IMG/M |
| 3300010038|Ga0126315_10912729 | Not Available | 584 | Open in IMG/M |
| 3300010039|Ga0126309_10016751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 3134 | Open in IMG/M |
| 3300010039|Ga0126309_10587558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 699 | Open in IMG/M |
| 3300010039|Ga0126309_10847580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 601 | Open in IMG/M |
| 3300010040|Ga0126308_10096802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1803 | Open in IMG/M |
| 3300010042|Ga0126314_10015593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 4479 | Open in IMG/M |
| 3300010042|Ga0126314_10251599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1253 | Open in IMG/M |
| 3300010045|Ga0126311_10125105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1800 | Open in IMG/M |
| 3300010166|Ga0126306_10825894 | Not Available | 749 | Open in IMG/M |
| 3300012184|Ga0136610_1064825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1309 | Open in IMG/M |
| 3300012469|Ga0150984_101983456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 615 | Open in IMG/M |
| 3300012985|Ga0164308_10878622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 788 | Open in IMG/M |
| 3300014488|Ga0182001_10167842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 769 | Open in IMG/M |
| 3300015077|Ga0173483_10268579 | Not Available | 820 | Open in IMG/M |
| 3300017787|Ga0183260_10263162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1185 | Open in IMG/M |
| 3300018422|Ga0190265_10576553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1243 | Open in IMG/M |
| 3300018422|Ga0190265_10682231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
| 3300018422|Ga0190265_11027496 | Not Available | 946 | Open in IMG/M |
| 3300018429|Ga0190272_10741143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 893 | Open in IMG/M |
| 3300018429|Ga0190272_11881415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 628 | Open in IMG/M |
| 3300018429|Ga0190272_12885909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300018432|Ga0190275_10199771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1890 | Open in IMG/M |
| 3300018432|Ga0190275_10920963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
| 3300018432|Ga0190275_13568663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 504 | Open in IMG/M |
| 3300018466|Ga0190268_10275154 | Not Available | 989 | Open in IMG/M |
| 3300018466|Ga0190268_11080651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter soli | 650 | Open in IMG/M |
| 3300018469|Ga0190270_10125134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2032 | Open in IMG/M |
| 3300018469|Ga0190270_10202935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1678 | Open in IMG/M |
| 3300018469|Ga0190270_10557203 | Not Available | 1107 | Open in IMG/M |
| 3300018469|Ga0190270_11530844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 717 | Open in IMG/M |
| 3300018469|Ga0190270_11576412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 708 | Open in IMG/M |
| 3300019377|Ga0190264_10076914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1469 | Open in IMG/M |
| 3300019767|Ga0190267_11445434 | Not Available | 525 | Open in IMG/M |
| 3300020181|Ga0196958_10008267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2890 | Open in IMG/M |
| 3300020181|Ga0196958_10036245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1478 | Open in IMG/M |
| 3300022756|Ga0222622_11251252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 546 | Open in IMG/M |
| 3300024430|Ga0196962_10131030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 789 | Open in IMG/M |
| 3300025792|Ga0210143_1033547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 898 | Open in IMG/M |
| 3300025899|Ga0207642_10372738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 847 | Open in IMG/M |
| 3300025901|Ga0207688_10079809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 1867 | Open in IMG/M |
| 3300025901|Ga0207688_10583174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 704 | Open in IMG/M |
| 3300025908|Ga0207643_10515758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 765 | Open in IMG/M |
| 3300025920|Ga0207649_10773202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 748 | Open in IMG/M |
| 3300025921|Ga0207652_11175954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 668 | Open in IMG/M |
| 3300025923|Ga0207681_10259990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1359 | Open in IMG/M |
| 3300025923|Ga0207681_11459621 | Not Available | 574 | Open in IMG/M |
| 3300025933|Ga0207706_10364219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1256 | Open in IMG/M |
| 3300025938|Ga0207704_10631287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 880 | Open in IMG/M |
| 3300025981|Ga0207640_11115983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300026041|Ga0207639_11924239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 552 | Open in IMG/M |
| 3300026142|Ga0207698_10782410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 955 | Open in IMG/M |
| 3300026142|Ga0207698_11642381 | Not Available | 658 | Open in IMG/M |
| 3300027639|Ga0209387_1108986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 687 | Open in IMG/M |
| 3300027761|Ga0209462_10121595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300027886|Ga0209486_10355800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 877 | Open in IMG/M |
| 3300028587|Ga0247828_10644582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 652 | Open in IMG/M |
| 3300028589|Ga0247818_10954758 | Not Available | 605 | Open in IMG/M |
| 3300028590|Ga0247823_10946035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 646 | Open in IMG/M |
| 3300028597|Ga0247820_10844437 | Not Available | 646 | Open in IMG/M |
| 3300028810|Ga0307294_10408239 | Not Available | 512 | Open in IMG/M |
| 3300030336|Ga0247826_10915851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 692 | Open in IMG/M |
| 3300030336|Ga0247826_10988054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 668 | Open in IMG/M |
| 3300031164|Ga0307502_10123033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 561 | Open in IMG/M |
| 3300031229|Ga0299913_12094726 | Not Available | 511 | Open in IMG/M |
| 3300031824|Ga0307413_11449130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 605 | Open in IMG/M |
| 3300031854|Ga0310904_11417859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300031901|Ga0307406_10926412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 743 | Open in IMG/M |
| 3300031995|Ga0307409_100965025 | Not Available | 869 | Open in IMG/M |
| 3300031995|Ga0307409_102547575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 540 | Open in IMG/M |
| 3300032002|Ga0307416_103502110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 525 | Open in IMG/M |
| 3300032004|Ga0307414_11589048 | Not Available | 609 | Open in IMG/M |
| 3300032080|Ga0326721_10110587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1332 | Open in IMG/M |
| 3300032080|Ga0326721_10332786 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300032080|Ga0326721_10381664 | Not Available | 811 | Open in IMG/M |
| 3300032080|Ga0326721_10549301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 695 | Open in IMG/M |
| 3300032126|Ga0307415_101946917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 571 | Open in IMG/M |
| 3300033550|Ga0247829_11357783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.14% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 17.07% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 8.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 3.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.44% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300012184 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020181 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_10 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024430 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_20 | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027761 | Agave microbial communities from Guanajuato, Mexico - As.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031164 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1186114792 | 3300002568 | Soil | MFQHTMNYIETSAPVELTLVEWKQSRMAVPRRRRIRFTPPRVRLAF* |
| Ga0063454_1013600582 | 3300004081 | Soil | MFQHTVMNYIETSAPAELTLVEWKQSRMAPPRRRRIRFTPPRVRLAF* |
| Ga0062593_1027249943 | 3300004114 | Soil | MNYVETSAPAELTLVEWRATRTAATPRRRRIRFTPPRVRVAFA* |
| Ga0062589_1019130192 | 3300004156 | Soil | MFQHTVMNYVETSAPAELTLVEWKASRPAPSPRRRLRFAPRVSLKFA* |
| Ga0062592_1011156252 | 3300004480 | Soil | MFQHTVMNYVETSAPAELTLVEWKASRPAPTPRRRLRFAPRVSLKFA* |
| Ga0062591_1016764341 | 3300004643 | Soil | MLQHTMNYVETSAPAELTLVEWKASRPAPTPRRRLRFAPRVSLKFA* |
| Ga0070658_112265263 | 3300005327 | Corn Rhizosphere | MFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA* |
| Ga0070682_1005883661 | 3300005337 | Corn Rhizosphere | PMFQHTVMNYVETSAPAELTLVEWKASRPAPSPRRRLRFAPRVSLKFA* |
| Ga0070678_1002746741 | 3300005456 | Miscanthus Rhizosphere | PMFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA* |
| Ga0070665_1020133662 | 3300005548 | Switchgrass Rhizosphere | MLQHVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA* |
| Ga0070664_1015205091 | 3300005564 | Corn Rhizosphere | TVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA* |
| Ga0068864_1023899992 | 3300005618 | Switchgrass Rhizosphere | MLQHTVMNYVECSAPAGVTLVEWQRTRMDATPRRRRIRFTPPRVRFAF* |
| Ga0075422_103040163 | 3300006196 | Populus Rhizosphere | GTGEREPRSRDASPMLQHTMNYVETSAPAELTLVEWRASRLAATPRRRRLRDLLAPRVSYRFA* |
| Ga0079222_102419563 | 3300006755 | Agricultural Soil | MFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFAPRPALKFA* |
| Ga0075428_1020299962 | 3300006844 | Populus Rhizosphere | MLQHTMNYVETSAPAELTLVEWRASRLAATPRRRRLRDLLAPRVSYRFA* |
| Ga0075428_1021740961 | 3300006844 | Populus Rhizosphere | RETCPMFQHTVMNYVESSAPADLTLVEWQRTRMDATPRRRRIRFTPPRVRFAF* |
| Ga0075420_1004957192 | 3300006853 | Populus Rhizosphere | MFQHTIMNYVETSAPAELTLVEWRASRQVATPRRRRIRFTPPRVRVAFA* |
| Ga0079217_101117012 | 3300006876 | Agricultural Soil | MFQHTIMNYVETSAPAELTLVEWRASRQVATPRRRRIRFTPPRLRVAFA* |
| Ga0079217_103560372 | 3300006876 | Agricultural Soil | MFQHTVMNYVETSAPAELTLVEWKASRLAASPRRRRFRLTPPRVRLAFA* |
| Ga0079217_105129553 | 3300006876 | Agricultural Soil | PMFQHTIMNYVETSAPAELTLVEWRASRQAATPRRRRIRFTPPRVRVAFA* |
| Ga0079217_111657111 | 3300006876 | Agricultural Soil | VSMLQHTMNYVETSAAPELTLVEWRAIRLAASPRRRRFRLTPPRVRLAF* |
| Ga0075429_1005599772 | 3300006880 | Populus Rhizosphere | MLQHTMNYVETSAPAELTLVEWRASRLVATPRRRRLRDLLAPRVSYRFA* |
| Ga0075424_1021179141 | 3300006904 | Populus Rhizosphere | GERGPRSRDAVPMFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA* |
| Ga0079216_101284923 | 3300006918 | Agricultural Soil | MFQHTVMNYVETSAPAELTLVEWRATRTAATPRRRRIRFTPPRIRVAFA* |
| Ga0079216_118758951 | 3300006918 | Agricultural Soil | MPENTVMNYVESSAPAGLTLVEWRRTRMAATPRRRRFRLAPPR |
| Ga0079218_110134924 | 3300007004 | Agricultural Soil | MNYVETSAPAELTLVEWRASRAAATPRRRRIRFTPPRIRVAFA* |
| Ga0079218_132634993 | 3300007004 | Agricultural Soil | MLQHTMNYVETSAAPELTLVEWRAIRLAASPRRRRFRLAPPRVRLAF* |
| Ga0105679_100521392 | 3300007790 | Soil | MFQHTVMNYVETSAAPELTLVEWRASRLAAMPRRRRFRLAPPRVRLAF* |
| Ga0075418_107341543 | 3300009100 | Populus Rhizosphere | MFQHTVMNYVETSAPAELTLVEWKASRLAATPRRRRLRFAPRVALKFA* |
| Ga0075418_117450643 | 3300009100 | Populus Rhizosphere | MLQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA* |
| Ga0114129_113641282 | 3300009147 | Populus Rhizosphere | MFQHTVMNYVETSAPAELTLVEWRASRQVATPRRRRIRFTPPRVRVAFA* |
| Ga0111538_124990461 | 3300009156 | Populus Rhizosphere | MLQHTMNYVETSAPAELTLVEWRASRLAATPRRRRLRFAPRVALKFA* |
| Ga0105249_105989854 | 3300009553 | Switchgrass Rhizosphere | MFQHTVMNYVETSAPAELTLVEWRATRMAATPRRRRFRFTPPRVRLAFA* |
| Ga0126307_100362672 | 3300009789 | Serpentine Soil | MFQHTMNYIETSAPAELTLAEWKQSRMAAPRRRRIRFTPPRVRLAF* |
| Ga0126307_100396592 | 3300009789 | Serpentine Soil | MFQHTMNYVESSAPAELTLVEWRRTRMDATPRRRRIRLTPPRVRLAF* |
| Ga0126307_100750213 | 3300009789 | Serpentine Soil | MPDHTVMNYVESSAPAELTLVEWRATRTAATPRRRRFRLAPPRVRLAF* |
| Ga0126307_100778332 | 3300009789 | Serpentine Soil | MPDHVMNYIETEASAGLTLVEWRRTRMDARPRRRRIRFTPPRVRLAF* |
| Ga0126307_103246433 | 3300009789 | Serpentine Soil | MFQHTVMNYVETSAPAELTLVEWRANRLAATPRRRRLRFAPPRVRLAFA* |
| Ga0126307_104171092 | 3300009789 | Serpentine Soil | MPDHVMNYLESEAPAGLTLVEWRRTRMAATPRRRRFRLAPPRVRLAF* |
| Ga0126307_104557023 | 3300009789 | Serpentine Soil | MPDHTVMNYVETTAPAELTLVEWRRTRMATPRRRRIRFAPPRVRFAI* |
| Ga0126313_100067097 | 3300009840 | Serpentine Soil | MFQHTVMNYVETSAPAELTLVEWRATRVDATPRRRRIRFTPPRVRLAF* |
| Ga0126313_104859701 | 3300009840 | Serpentine Soil | MPDHTVMNYVETTAPAELTLVEWRRTRMAAPRRRRIRFAPPRVRFAI* |
| Ga0126313_110163781 | 3300009840 | Serpentine Soil | MFQHTVMNYVETSAPAELTLVEWRANRLAATPRRRRIRFTPPRVRLAF* |
| Ga0126305_104083823 | 3300010036 | Serpentine Soil | MFQHTMNYIETSAPAELTLVEWKQSRMATPRRRRIRFTPPRVRFAI* |
| Ga0126315_100055784 | 3300010038 | Serpentine Soil | MFQHTVMNYVETSAPAELTLVEWRATRVAATPRRRRIRFAPPRVRLAF* |
| Ga0126315_109127292 | 3300010038 | Serpentine Soil | MPDHTVMNYVETTAPAELTLVEWRRTRMAVPRRRRIRLAPPRVRLAF* |
| Ga0126309_100167516 | 3300010039 | Serpentine Soil | MPDHTVMNYVETTAPAELTLVEWRRTRMAVPRRRRIRLAPPRVRFAF* |
| Ga0126309_105875581 | 3300010039 | Serpentine Soil | MFQHTVMNYVETSAPAELTLVEWRASRLAATPRRRRLRFTPPRVRLAFA* |
| Ga0126309_108475803 | 3300010039 | Serpentine Soil | MLQHTMNYVESSAPAELTLVEWRRTRMDATPRRRRIRLTPPRVRLAF* |
| Ga0126308_100968023 | 3300010040 | Serpentine Soil | MFQHTVMNYVESSAPAELTLVEWRATRVDATPRRRRIRFTPPRVRLAF* |
| Ga0126314_100155934 | 3300010042 | Serpentine Soil | MFQHTVMNYVETSAPAELTLVEWRANRVAATARRRRIRFTPPRVRLAF* |
| Ga0126314_102515992 | 3300010042 | Serpentine Soil | MPDHTVMNYVESTAPAELTLVEWRRTRMAVPRRRRIRLAPPRVRLAF* |
| Ga0126311_101251052 | 3300010045 | Serpentine Soil | MPDHTVMNYVESSAPAELTLVEWRATRTAATPRRRR |
| Ga0126306_108258942 | 3300010166 | Serpentine Soil | MPDHTVMNYVESTAPAELTLVEWRRTRMAAPRRRRIRFAPPRVRFAI* |
| Ga0136610_10648252 | 3300012184 | Polar Desert Sand | MPEQHVVNYIETDELADLTLVEWRRTRMAATPRRRRIRFTPPRIRPAFAF* |
| Ga0150984_1019834561 | 3300012469 | Avena Fatua Rhizosphere | MNYIETSAPVELTLVEWKQSRMAVPRRRRIRFTPPRVRLAF* |
| Ga0164308_108786223 | 3300012985 | Soil | MLQHTVMNYVECSAPAGVTLVEWQRTRMDAPPRRRRIRFTPPRVRFAF* |
| Ga0182001_101678421 | 3300014488 | Soil | MFQHTVMNYVETSAPAELTLVEWRANRMAATPRRRRIRFTPPRVRLAF* |
| Ga0173483_102685791 | 3300015077 | Soil | EREPSRRDAYPMFQHTIMNYVETSAPADQTLVEWRASRQVATPRRRRIRFTPPRVRVAFA |
| Ga0183260_102631622 | 3300017787 | Polar Desert Sand | MPEQHVINYIETDELADLTLVEWRRTRMAATPRRRRIRFTPPCIRPAFAF |
| Ga0190265_105765535 | 3300018422 | Soil | MPDHTMNYIETEAPAGLTLVEWRRNRMDARPRRRRIRFTPPRVRLAF |
| Ga0190265_106822312 | 3300018422 | Soil | MFQHTVMNYVETSAPAELTLVEWRASRLAAIPRRRRLRFAPRVALKFA |
| Ga0190265_110274961 | 3300018422 | Soil | MPDHTMNYIETEAPAGLTLVEWRRTRMDATPRRRRIRFMPPRVRFAF |
| Ga0190272_107411432 | 3300018429 | Soil | MPENTVMNYVESSAPAELTLVEWRRTRMAAIPRRRRFRLSPPRVRLAF |
| Ga0190272_118814153 | 3300018429 | Soil | CPMFQHTVMNYVECSAPAEQTLVEWRRTRMDATPRRRRIRFTPPRVRFAF |
| Ga0190272_128859092 | 3300018429 | Soil | MPDHTMNYIETEATVGLTLVEWRRTRMDARPRRRRIRFMPPRVRLAF |
| Ga0190275_101997713 | 3300018432 | Soil | MFQHTVMNYVETSAPAELTLVEWRATRTAATPRRRRIRFTPPRIRVAFA |
| Ga0190275_109209631 | 3300018432 | Soil | MPDHTMNYIECEAPAGLTLVEWRRNRMDARPRRRRIRFTPP |
| Ga0190275_135686631 | 3300018432 | Soil | APSRDASPMFQHTVMNYVETSAPAELTLVEWRASRLAAIPRRRRLRFAPPRVRLAFA |
| Ga0190268_102751542 | 3300018466 | Soil | MPENTVMNYVESSAPAELTLVEWRRTRMDATPRRRRLRFTPPRVRVAFA |
| Ga0190268_110806512 | 3300018466 | Soil | MFQHTVMNYVETSAPAELTLVEWRASRAAATPRRRRIRFTPRVPYRPFAFA |
| Ga0190270_101251342 | 3300018469 | Soil | MFQHTVMNYVETSAPAELTLVEWRATRAAATPRRRRIRFTPPRVRVAFA |
| Ga0190270_102029351 | 3300018469 | Soil | MLQHTVMNYVESSAPAELTLVEWRRTRMDATPRRRRIRFTPPRVRFAF |
| Ga0190270_105572032 | 3300018469 | Soil | MFQHTVMNYVETSAPAELTLVEWRATRTAATPRRRRIRFTPPRIRV |
| Ga0190270_115308442 | 3300018469 | Soil | MFQHTVMNYVETSAPAELTLVEWKASRPVATPRRRLRFAPRVALKFA |
| Ga0190270_115764121 | 3300018469 | Soil | MFQHTVMNYVESSAPAELTLVEWRRTRMAATPRRRRIRFTPPRVRLAF |
| Ga0190264_100769142 | 3300019377 | Soil | MLQHTMNYVETSAPAELTLVEWRASRQVATPRRRRIRFTPPRVRVAFA |
| Ga0190267_114454342 | 3300019767 | Soil | MPENTVMNYVESSAPAELTLVEWRRTRMDATPRRRRIRFTPPRVRLAF |
| Ga0196958_100082672 | 3300020181 | Soil | MLQHTMNYVETSAAPELTLVEWRAIRLAASPRRRRFRLAPPRVRLAF |
| Ga0196958_100362453 | 3300020181 | Soil | MPENTVMNYVEADAPAGMTLIEWRRARLAAATPRRRRIRFTPPRIRPAFAF |
| Ga0222622_112512521 | 3300022756 | Groundwater Sediment | MFQHTMNYVESSAPAELTLVEWRRTRMDATPRRRRIRFTPPRVRLAF |
| Ga0196962_101310303 | 3300024430 | Soil | MFQHTVMNYVESSAPAGLTLAEWRATRAAATPRRRRIRFTPPRVRVAFA |
| Ga0210143_10335471 | 3300025792 | Natural And Restored Wetlands | ASPMFQHTVMNYVETSAPAELTLVEWKASRLATTPRRRRLRFAPPRVRLAFA |
| Ga0207642_103727383 | 3300025899 | Miscanthus Rhizosphere | MFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA |
| Ga0207688_100798095 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MLQHVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA |
| Ga0207688_105831742 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MFQHTVMNYVETSAPAELTLVEWKASRPAPSPRRRLRFAPRVSLKFA |
| Ga0207643_105157581 | 3300025908 | Miscanthus Rhizosphere | DASPMFQHTVMNYVETSAPAELTLVEWKASRPAPSPRRRLRFAPRVSLKFA |
| Ga0207649_107732021 | 3300025920 | Corn Rhizosphere | MFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFAPRPALKFA |
| Ga0207652_111759541 | 3300025921 | Corn Rhizosphere | VMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA |
| Ga0207681_102599904 | 3300025923 | Switchgrass Rhizosphere | ALPMFQHTVMNYVETSAPAELTLVEWKASRPAPSPRRRLRFAPRVSLKFA |
| Ga0207681_114596212 | 3300025923 | Switchgrass Rhizosphere | MFQHTVMNYVETSAPAELTLVEWKASRPAPSPRRRLRFAP |
| Ga0207706_103642193 | 3300025933 | Corn Rhizosphere | MFQHTVMNYVETAAPAELTLVEWKASRPAPSPRRRLRFAPRVSLKFA |
| Ga0207704_106312871 | 3300025938 | Miscanthus Rhizosphere | PMFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA |
| Ga0207640_104924151 | 3300025981 | Corn Rhizosphere | SGERGPRSREAVPMFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA |
| Ga0207640_111159832 | 3300025981 | Corn Rhizosphere | MFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRF |
| Ga0207639_119242393 | 3300026041 | Corn Rhizosphere | APAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA |
| Ga0207698_107824104 | 3300026142 | Corn Rhizosphere | AVPMFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFTPPRVRLAFA |
| Ga0207698_116423811 | 3300026142 | Corn Rhizosphere | MFQHTVMNYVETSAPAEQTLVEWRASRLAATPRRRRFRFAPRPAL |
| Ga0209387_11089861 | 3300027639 | Agricultural Soil | NYVETSAPAELTLVEWRASRQVATPRRRRIRFTPPRVRVAFA |
| Ga0209462_101215952 | 3300027761 | Agave | MFQHTVMNYVETSAPAELTLVEWRASRMAATPRRRRFRLAPQRVRLALA |
| Ga0209486_103558001 | 3300027886 | Agricultural Soil | MNYVETSAPAELTLVEWRASRAAATPRRRRIRFTPPRIRVAFA |
| Ga0247828_106445823 | 3300028587 | Soil | MFQHTVMNYVESSAPADLTLVEWQRTRMDATPRRRRIRFTPPRVRFAF |
| Ga0247818_109547582 | 3300028589 | Soil | MFQHTVMNYVETSAPAELTLVEWKASRPAPTPRRRLRFAPRVSLKFA |
| Ga0247823_109460351 | 3300028590 | Soil | RETCPMFQHTVMNYVESSAPADLTLVEWQRTRMDATPRRRRIRFTPPRVRFAF |
| Ga0247820_108444372 | 3300028597 | Soil | MFQHTVMNYVESSAPADLTLVEWQRTRMDATPRRRRNRFTPPRVRFAF |
| Ga0307294_104082392 | 3300028810 | Soil | MFQHTMNYVESSAPAELTLVEWRRTRMDATPRRRRIRFTPPRVR |
| Ga0247826_109158511 | 3300030336 | Soil | VQRRSRDASPMFQHTVMNYVETSAPAELTLVEWKASRPAPSPRRRLRFAPRVSLKFA |
| Ga0247826_109880541 | 3300030336 | Soil | MFQHTVMNYVETSAPAELTLVEWRASRMAATPRRRRFRFAPQRARLAFA |
| Ga0307502_101230333 | 3300031164 | Soil | REALPMLQHTVMNYVESSAPADLTLVEWRRTRMDATPRRRRIRFTPPRVRLAF |
| Ga0299913_120947262 | 3300031229 | Soil | MFQHTVMNYVETSAPAELTLVEWRASRLAAIPRRRRLRFAPRVSLKFA |
| Ga0307413_114491303 | 3300031824 | Rhizosphere | MFQHTVMNYVESSAPAELTLVEWRATRVDATPRRRRIRFTPPRVRLAF |
| Ga0310904_114178591 | 3300031854 | Soil | MFQHTVMNYVETSAPAELTLVEWKASRPAPSPRRRLRFATRVSLKFA |
| Ga0307406_109264122 | 3300031901 | Rhizosphere | MFQHTIMNYVETSAPGELTLVEWRASRQVATPRRRRIRFTPPRVRVAFA |
| Ga0307409_1009650254 | 3300031995 | Rhizosphere | MFQHTMNYVESSAPAELTLVEWRRTRMDATPRRRRIRLTPPRVRLAF |
| Ga0307409_1025475753 | 3300031995 | Rhizosphere | MPMFQHTVMNYVETSAPAELTLVEWKASRLAATPRRRRLRFAPPRVRLAFA |
| Ga0307416_1035021101 | 3300032002 | Rhizosphere | GSRDAVPMFQHTVMNYVESSAPAELTLVEWRATRVDATPRRRRIRFTPPRVRLAF |
| Ga0307414_115890481 | 3300032004 | Rhizosphere | MFQHTIMNYVETSAPAELTLVEWRASRQVATPRRRRIRFTPRVPYRR |
| Ga0326721_101105874 | 3300032080 | Soil | MPDHTVMNYVETTAPAELTLVEWRRTRMAAPRRRRIRFAPPRVRFAI |
| Ga0326721_103327864 | 3300032080 | Soil | EAPSRDASPMFQHTVMNYVETSAPAELTLVEWRATRTAATPRRRRIRFTPPRIRVAFA |
| Ga0326721_103816644 | 3300032080 | Soil | RDASPMFQHTVMNYVETSAPAELTLVEWRANRLAATPRRRRLRFAPRVALKFA |
| Ga0326721_105493013 | 3300032080 | Soil | MPDHVMNYIETEATAGLTLVEWRRNRMDARPRRRRIRFAPPRVRFAF |
| Ga0307415_1019469172 | 3300032126 | Rhizosphere | MFQHTVMNYVETSAPAELTLVEWRANRLAATPRRRRIRFTPPRVRLAF |
| Ga0247829_113577833 | 3300033550 | Soil | MFQHTVMNYVESSAPADLTLVEWQRTRMDATPRRRRIRFTPPRVRFAI |
| ⦗Top⦘ |