| Basic Information | |
|---|---|
| Family ID | F070276 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 47 residues |
| Representative Sequence | DLRKFVYWAVTAGQKFGPPLFFVPLPKSVNGFNYREIKKIQAGS |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.37 % |
| % of genes from short scaffolds (< 2000 bps) | 94.31 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.098 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.512 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.707 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.276 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.67% β-sheet: 0.00% Coil/Unstructured: 58.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 29.27 |
| PF00300 | His_Phos_1 | 1.63 |
| PF13522 | GATase_6 | 0.81 |
| PF16363 | GDP_Man_Dehyd | 0.81 |
| PF04075 | F420H2_quin_red | 0.81 |
| PF13230 | GATase_4 | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.91 % |
| Unclassified | root | N/A | 43.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000881|JGI10215J12807_1072749 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300000881|JGI10215J12807_1137416 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300000955|JGI1027J12803_101216833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1441 | Open in IMG/M |
| 3300000956|JGI10216J12902_112253421 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300002244|JGI24742J22300_10113552 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300003993|Ga0055468_10202730 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300004156|Ga0062589_100517424 | Not Available | 1011 | Open in IMG/M |
| 3300004157|Ga0062590_100838497 | Not Available | 851 | Open in IMG/M |
| 3300004157|Ga0062590_102992908 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300004479|Ga0062595_101879180 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005332|Ga0066388_101474791 | Not Available | 1188 | Open in IMG/M |
| 3300005334|Ga0068869_100861150 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300005334|Ga0068869_101700231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300005345|Ga0070692_10116505 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
| 3300005367|Ga0070667_101914739 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300005445|Ga0070708_100428292 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300005457|Ga0070662_101555642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 570 | Open in IMG/M |
| 3300005539|Ga0068853_101915928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300005543|Ga0070672_100976521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300005548|Ga0070665_101998070 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005718|Ga0068866_10981577 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006196|Ga0075422_10553033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300006576|Ga0074047_10024843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2839 | Open in IMG/M |
| 3300006847|Ga0075431_101807085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300006853|Ga0075420_101628350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300006880|Ga0075429_101655124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300006917|Ga0075472_10454232 | Not Available | 636 | Open in IMG/M |
| 3300006969|Ga0075419_11326905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300009093|Ga0105240_11707304 | Not Available | 657 | Open in IMG/M |
| 3300009100|Ga0075418_13060996 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300009147|Ga0114129_10045099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6199 | Open in IMG/M |
| 3300009162|Ga0075423_12056007 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300009553|Ga0105249_12331318 | Not Available | 608 | Open in IMG/M |
| 3300010396|Ga0134126_11323693 | Not Available | 797 | Open in IMG/M |
| 3300010397|Ga0134124_12449588 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300011119|Ga0105246_11981000 | Not Available | 561 | Open in IMG/M |
| 3300011119|Ga0105246_12257204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
| 3300012232|Ga0137435_1177072 | Not Available | 656 | Open in IMG/M |
| 3300012357|Ga0137384_10812635 | Not Available | 756 | Open in IMG/M |
| 3300012515|Ga0157338_1018463 | Not Available | 791 | Open in IMG/M |
| 3300012884|Ga0157300_1003596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1616 | Open in IMG/M |
| 3300012884|Ga0157300_1106288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300012891|Ga0157305_10152325 | Not Available | 624 | Open in IMG/M |
| 3300012899|Ga0157299_10114857 | Not Available | 716 | Open in IMG/M |
| 3300012899|Ga0157299_10174931 | Not Available | 627 | Open in IMG/M |
| 3300012905|Ga0157296_10137825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300012905|Ga0157296_10369104 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300012907|Ga0157283_10224129 | Not Available | 608 | Open in IMG/M |
| 3300012907|Ga0157283_10377204 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300012907|Ga0157283_10386142 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300012910|Ga0157308_10049200 | Not Available | 1089 | Open in IMG/M |
| 3300012910|Ga0157308_10470807 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012911|Ga0157301_10006447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2202 | Open in IMG/M |
| 3300012915|Ga0157302_10374070 | Not Available | 579 | Open in IMG/M |
| 3300012958|Ga0164299_10395456 | Not Available | 886 | Open in IMG/M |
| 3300012961|Ga0164302_10744177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
| 3300013100|Ga0157373_10491010 | Not Available | 886 | Open in IMG/M |
| 3300013105|Ga0157369_10595094 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300013297|Ga0157378_10118420 | All Organisms → cellular organisms → Bacteria | 2438 | Open in IMG/M |
| 3300013308|Ga0157375_10857396 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300014270|Ga0075325_1115365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300015200|Ga0173480_10647859 | Not Available | 655 | Open in IMG/M |
| 3300015200|Ga0173480_10652970 | Not Available | 653 | Open in IMG/M |
| 3300015371|Ga0132258_11383277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1778 | Open in IMG/M |
| 3300015373|Ga0132257_102803886 | Not Available | 635 | Open in IMG/M |
| 3300015373|Ga0132257_104360871 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300015374|Ga0132255_102141603 | Not Available | 852 | Open in IMG/M |
| 3300015374|Ga0132255_104248062 | Not Available | 608 | Open in IMG/M |
| 3300015374|Ga0132255_104803056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300018060|Ga0187765_11044113 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300018082|Ga0184639_10426177 | Not Available | 682 | Open in IMG/M |
| 3300018469|Ga0190270_10156025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1863 | Open in IMG/M |
| 3300018469|Ga0190270_12534204 | Not Available | 575 | Open in IMG/M |
| 3300019356|Ga0173481_10033323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1670 | Open in IMG/M |
| 3300021082|Ga0210380_10407039 | Not Available | 623 | Open in IMG/M |
| 3300021510|Ga0222621_1101574 | Not Available | 610 | Open in IMG/M |
| 3300022756|Ga0222622_10550466 | Not Available | 829 | Open in IMG/M |
| 3300022880|Ga0247792_1092702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300022883|Ga0247786_1030272 | Not Available | 1052 | Open in IMG/M |
| 3300022910|Ga0247768_1122409 | Not Available | 796 | Open in IMG/M |
| 3300022915|Ga0247790_10140380 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300023057|Ga0247797_1048481 | Not Available | 607 | Open in IMG/M |
| 3300023077|Ga0247802_1066119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300023266|Ga0247789_1013906 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300023274|Ga0247763_1190718 | Not Available | 579 | Open in IMG/M |
| 3300025567|Ga0210076_1026228 | Not Available | 1246 | Open in IMG/M |
| 3300025919|Ga0207657_11211284 | Not Available | 573 | Open in IMG/M |
| 3300025921|Ga0207652_11617743 | Not Available | 552 | Open in IMG/M |
| 3300025924|Ga0207694_10600168 | Not Available | 926 | Open in IMG/M |
| 3300025926|Ga0207659_10216687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1537 | Open in IMG/M |
| 3300025926|Ga0207659_11837505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300025931|Ga0207644_10330505 | Not Available | 1234 | Open in IMG/M |
| 3300025935|Ga0207709_10040999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2776 | Open in IMG/M |
| 3300025938|Ga0207704_11321785 | Not Available | 617 | Open in IMG/M |
| 3300025941|Ga0207711_11167461 | Not Available | 711 | Open in IMG/M |
| 3300025944|Ga0207661_12133955 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300025960|Ga0207651_10373004 | Not Available | 1207 | Open in IMG/M |
| 3300026324|Ga0209470_1142798 | Not Available | 1054 | Open in IMG/M |
| 3300027475|Ga0207607_100250 | Not Available | 911 | Open in IMG/M |
| 3300027840|Ga0209683_10053989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1764 | Open in IMG/M |
| 3300027894|Ga0209068_10498668 | Not Available | 702 | Open in IMG/M |
| 3300027909|Ga0209382_11527104 | Not Available | 664 | Open in IMG/M |
| 3300028379|Ga0268266_10945735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 834 | Open in IMG/M |
| 3300028379|Ga0268266_11170527 | Not Available | 744 | Open in IMG/M |
| 3300028380|Ga0268265_12064222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300028592|Ga0247822_10981560 | Not Available | 697 | Open in IMG/M |
| 3300028608|Ga0247819_10912206 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 551 | Open in IMG/M |
| 3300028717|Ga0307298_10244760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300028814|Ga0307302_10326463 | Not Available | 756 | Open in IMG/M |
| 3300028884|Ga0307308_10318568 | Not Available | 745 | Open in IMG/M |
| 3300030000|Ga0311337_10911201 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300030114|Ga0311333_10984370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 714 | Open in IMG/M |
| 3300031232|Ga0302323_100064590 | All Organisms → cellular organisms → Bacteria | 3415 | Open in IMG/M |
| 3300031726|Ga0302321_103446678 | Not Available | 514 | Open in IMG/M |
| 3300031740|Ga0307468_100397626 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300031901|Ga0307406_10770970 | Not Available | 809 | Open in IMG/M |
| 3300032000|Ga0310903_10583439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300032003|Ga0310897_10672362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 517 | Open in IMG/M |
| 3300032012|Ga0310902_10678666 | Not Available | 692 | Open in IMG/M |
| 3300032013|Ga0310906_11217444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300032017|Ga0310899_10128638 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300032174|Ga0307470_11832817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300033004|Ga0335084_10730296 | Not Available | 1008 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.88% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.88% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.06% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.44% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.63% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300022910 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300023077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6 | Environmental | Open in IMG/M |
| 3300023266 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4 | Environmental | Open in IMG/M |
| 3300023274 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L141-409B-4 | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300027475 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06.2A5a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10215J12807_10727491 | 3300000881 | Soil | AVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS* |
| JGI10215J12807_11374162 | 3300000881 | Soil | KAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT* |
| JGI1027J12803_1012168333 | 3300000955 | Soil | FVYWAVTQGQRFGPPLFFVPLPTAVKGFDYREIKKIQAGS* |
| JGI10216J12902_1122534214 | 3300000956 | Soil | KFIYWAVTQGQKLGPPLYFVPLPKTVQAFAFREIKRIQAGS* |
| JGI24742J22300_101135522 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | IVPTNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT* |
| Ga0055468_102027301 | 3300003993 | Natural And Restored Wetlands | SKAADLRKFVYWAVTQGQKFGPPLWFVPLPKTVQAFAYREIKKIQGGT* |
| Ga0062589_1005174242 | 3300004156 | Soil | KLVYWAVTQGQQFGPPLLFQPLPVTVQAFAYREIKKIQGV* |
| Ga0062590_1008384971 | 3300004157 | Soil | KLVYWAVTQGQKFGPPLLFEPLPVTVQAFAYREIKKIQGV* |
| Ga0062590_1029929082 | 3300004157 | Soil | KAADLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS* |
| Ga0062595_1018791802 | 3300004479 | Soil | QTLRQFVYWAVTAGQKFGPPLFFVPLPNAVKGFNYREIKKIQAGS* |
| Ga0066388_1014747912 | 3300005332 | Tropical Forest Soil | GDKAQTLRQFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS* |
| Ga0068869_1008611502 | 3300005334 | Miscanthus Rhizosphere | NSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT* |
| Ga0068869_1017002312 | 3300005334 | Miscanthus Rhizosphere | LRKFVYWAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQGST* |
| Ga0070692_101165051 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA* |
| Ga0070667_1019147391 | 3300005367 | Switchgrass Rhizosphere | LRRFVYWSVTAGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS* |
| Ga0070708_1004282922 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | IVPTNSGSKAADLRKFVYWAVTQGQKFGPPLFFVPLPNAVKGFNYREIKKIQSGS* |
| Ga0070662_1015556422 | 3300005457 | Corn Rhizosphere | ELRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA* |
| Ga0068853_1019159281 | 3300005539 | Corn Rhizosphere | DVRKLVYWAVTQGQKFGPPLLFQPLPVTVQAFAYREIKKIQGV* |
| Ga0070672_1009765211 | 3300005543 | Miscanthus Rhizosphere | LRKFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS* |
| Ga0070665_1019980702 | 3300005548 | Switchgrass Rhizosphere | PTNSGSKAADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGR* |
| Ga0068866_109815772 | 3300005718 | Miscanthus Rhizosphere | SKAADLRKFIFWAVTQGQKFGPPLLFQPLPKTVQAFAYREIKKIQSSS* |
| Ga0075422_105530331 | 3300006196 | Populus Rhizosphere | FIYWAVTQGQKFGPPLLFQPLPKTVQAFAYREIKKIQGGT* |
| Ga0074047_100248435 | 3300006576 | Soil | DKAQTLRQFVYWAVTAGQKYGPPLLFVPLPKAVNGFIYRELKKVQS* |
| Ga0075431_1018070851 | 3300006847 | Populus Rhizosphere | PTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS* |
| Ga0075420_1016283502 | 3300006853 | Populus Rhizosphere | LRKFIFWAVTQGQRFGPPLLFQPLPKTVQAFAYREIKKIQGGT* |
| Ga0075429_1016551241 | 3300006880 | Populus Rhizosphere | VPTSSGDKSADLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS* |
| Ga0075472_104542321 | 3300006917 | Aqueous | KAAELRKLMYWFVTQGQKLGPPLIFDPMPKQVQAFAYREIKKIQS* |
| Ga0075419_113269051 | 3300006969 | Populus Rhizosphere | DLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS* |
| Ga0105240_117073041 | 3300009093 | Corn Rhizosphere | KAADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGQ* |
| Ga0075418_130609962 | 3300009100 | Populus Rhizosphere | PTSSGDKAADLRKFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS* |
| Ga0114129_100450997 | 3300009147 | Populus Rhizosphere | ADLRKFVYWAVTAGQKFGPSLFFVPLPKAVNGFNYREIKKIQAGS* |
| Ga0075423_120560072 | 3300009162 | Populus Rhizosphere | RKLVYWAVTQGQKFGPPLLFEPLPVTVQAFAYREIKKIQGV* |
| Ga0105249_123313182 | 3300009553 | Switchgrass Rhizosphere | AADLRKMVYWAVTRGQQFGPPLLFAKLPVTVQAFAFREIKKIQAT* |
| Ga0134126_113236931 | 3300010396 | Terrestrial Soil | KFVYWAVTQGQKFGPQLFFVPLPNQVKAYDYREIKKIQGGQ* |
| Ga0134124_124495882 | 3300010397 | Terrestrial Soil | KAAELRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA* |
| Ga0105246_119810002 | 3300011119 | Miscanthus Rhizosphere | VYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS* |
| Ga0105246_122572042 | 3300011119 | Miscanthus Rhizosphere | FIYWAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQASTK* |
| Ga0137435_11770721 | 3300012232 | Soil | RKFIYWAITSGQKFGPPLLFAPLPKSVLAFNYKQIKKIQAST* |
| Ga0137384_108126351 | 3300012357 | Vadose Zone Soil | VIVPTNSGDKAVDLRKWVYWAVTQGQKFGPPLFFVPLPASVKGFDYREIKKIQSGS* |
| Ga0157338_10184632 | 3300012515 | Arabidopsis Rhizosphere | VLPTNSAKAADLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAFAYRELAKVKAGT* |
| Ga0157300_10035963 | 3300012884 | Soil | KFVYWAVTAGQKFGPPLFFVPLPKAVNAFIYREIKKIQAGS* |
| Ga0157300_11062882 | 3300012884 | Soil | RKFVYWAVTAGQKFGPPLYFVPLPKSVNGFNYREIKMIQAGS* |
| Ga0157305_101523251 | 3300012891 | Soil | TNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKAVNAFIYREIKKIQAGS* |
| Ga0157299_101148571 | 3300012899 | Soil | KFVYWAVTAGQKFGPPLYFVPLPKSVNGFNYREIKMIQAGS* |
| Ga0157299_101749311 | 3300012899 | Soil | NSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKAVNAFIYREIKKIQAGS* |
| Ga0157296_101378251 | 3300012905 | Soil | STFTYVILPTNSAKAADLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAFAYRELAKVKAGT |
| Ga0157296_103691042 | 3300012905 | Soil | IVPTQSNKAADLRRFIYWAVTQGQKFGPPLLFQPLPKTVQAFAYREIRKIQGGT* |
| Ga0157283_102241291 | 3300012907 | Soil | RKFIYWAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQAST* |
| Ga0157283_103772041 | 3300012907 | Soil | PTNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT* |
| Ga0157283_103861421 | 3300012907 | Soil | FIYWAITSGQKFGPPLLFEPLPKSVLAFNYKQIKKIQAST* |
| Ga0157308_100492002 | 3300012910 | Soil | WAITAGQKFGPPLLFVPLPRGVLAFDYKQIKKIQTAQ* |
| Ga0157308_104708072 | 3300012910 | Soil | VPTSSGDKAADLRKFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS* |
| Ga0157301_100064471 | 3300012911 | Soil | RKFVYWAVTQGQKFGPPLFFVPLPTSVKAFAYRELAKVKAGT* |
| Ga0157302_103740701 | 3300012915 | Soil | KAADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA* |
| Ga0164299_103954563 | 3300012958 | Soil | RKLVYWAVTQGQKFGPPLLFQPLPVTVQAFAYREIKKIQGV* |
| Ga0164302_107441772 | 3300012961 | Soil | FTYVIVPTNSGDKAADLRKLIYWTVTSGQKFGPPLYFVPLPKAVNGFVYREIKKIQSGA* |
| Ga0157373_104910102 | 3300013100 | Corn Rhizosphere | ADLRKFVYWAVTQGQKFGPPLFFVPLPDQVKAYDYREIKKIQGGR* |
| Ga0157369_105950941 | 3300013105 | Corn Rhizosphere | TFTYVILPTSSAKAADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA* |
| Ga0157378_101184201 | 3300013297 | Miscanthus Rhizosphere | DLRKFVYWAVTAGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS* |
| Ga0157375_108573961 | 3300013308 | Miscanthus Rhizosphere | VIVPTNSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGT* |
| Ga0075325_11153652 | 3300014270 | Natural And Restored Wetlands | TFTYVILPTSSAKAADLRKFVYWAVTQGQKFGPPLFFVPLPNTVKAFAYREIAKVKAAT* |
| Ga0173480_106478591 | 3300015200 | Soil | YWAVTGGQKYCPPLFFVPLPSSVQGFAYREIKKIQAGT* |
| Ga0173480_106529701 | 3300015200 | Soil | RKFVYWAVTQGQKFGPPLFFVPLPDQVKAYEYREIKKIQGGR* |
| Ga0132258_113832771 | 3300015371 | Arabidopsis Rhizosphere | PITTFTYVILPTSTAKAADLRKFVYWAVTQGQMFGPPLFFVPLPTSVKAYAYRELAKVKVAA* |
| Ga0132257_1028038862 | 3300015373 | Arabidopsis Rhizosphere | PTNSSKAVPVRKLVYWAVTQGQKFGPPLLFEPLPVTVQAFAYREIKKIQGV* |
| Ga0132257_1043608712 | 3300015373 | Arabidopsis Rhizosphere | PTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKAVNGYIYREIKKIQSGS* |
| Ga0132255_1021416032 | 3300015374 | Arabidopsis Rhizosphere | VTSGQKYGPPLLFQPLPQKVQAFDYKQIKKIKSQT* |
| Ga0132255_1042480622 | 3300015374 | Arabidopsis Rhizosphere | VIVPSNTKSAGDVRKLVYWAVTQGQKFGPPLLFQPLTVTVQAFAYREIKKIQAV* |
| Ga0132255_1048030562 | 3300015374 | Arabidopsis Rhizosphere | SSGDKAQTLRQFVYWAVTAGQKYGPPLFFVPLPKAVNGFNYREIKKIQTGS* |
| Ga0187765_110441131 | 3300018060 | Tropical Peatland | PISTFTYVIVPTSMGDKAPTMRQFVYWAVTQGQKFGPPLFFVPLSTSVKAFAYREIAKIK |
| Ga0184639_104261771 | 3300018082 | Groundwater Sediment | DKAADLRKFVYWAVTAGQKFGPPLYFVPLPSSVNGFVYREIKKIQAGS |
| Ga0190270_101560253 | 3300018469 | Soil | AVTSGQKFGPPLLFQPLPDTVKAFAYREIKKIQGAS |
| Ga0190270_125342042 | 3300018469 | Soil | TGSSKAADLRKLVYWAVTRGQKFGPPLLFQPLPTPVQAFAFRELKKIQAT |
| Ga0173481_100333231 | 3300019356 | Soil | RKFVYWAVTAGQKFGPPLYFVPLPKAVNGFNYREIKKIQAGS |
| Ga0210380_104070391 | 3300021082 | Groundwater Sediment | RKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIQAGN |
| Ga0222621_11015741 | 3300021510 | Groundwater Sediment | SGDKAADLRKFVYWAVTAGQKFGPPLYFVPLPAAVNGFIYREIKKIQAGS |
| Ga0222622_105504661 | 3300022756 | Groundwater Sediment | FIYWAVTAGQKFGPPLYFVPLPAAVNGFIYREIKKIQAGS |
| Ga0247792_10927021 | 3300022880 | Soil | TYVILPTSSAKAADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA |
| Ga0247786_10302721 | 3300022883 | Soil | AADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGR |
| Ga0247768_11224091 | 3300022910 | Plant Litter | KFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA |
| Ga0247790_101403802 | 3300022915 | Soil | ADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA |
| Ga0247797_10484812 | 3300023057 | Soil | NSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIKKIRAGT |
| Ga0247802_10661191 | 3300023077 | Soil | NSGSKAADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGR |
| Ga0247789_10139063 | 3300023266 | Soil | RKFVYWAVTQGQKFGPPLFFVPLPDQVKAYDYREIKKIQGGR |
| Ga0247763_11907182 | 3300023274 | Plant Litter | LPTNSAKAADLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAFAYRELAKVKAGT |
| Ga0210076_10262282 | 3300025567 | Natural And Restored Wetlands | VIVPTSSGSKAADLRKFVYWAITQGQRFGPPLFFVPLPNQVKAYDYREIKKIQGGQ |
| Ga0207657_112112842 | 3300025919 | Corn Rhizosphere | AVTQGQKFGPPLLFEPLPVTVQAFAYREIKKIQGV |
| Ga0207652_116177432 | 3300025921 | Corn Rhizosphere | VTSGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS |
| Ga0207694_106001682 | 3300025924 | Corn Rhizosphere | ADLRKFVYWAVTQGQKFGPPLFFVPLPDQVKAYEYREIKKIQGGR |
| Ga0207659_102166873 | 3300025926 | Miscanthus Rhizosphere | AELRKFVYWAVTQGQKFGPPLFFVPLPTPVKAYAYRELAKVKAT |
| Ga0207659_118375051 | 3300025926 | Miscanthus Rhizosphere | VTAGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS |
| Ga0207644_103305053 | 3300025931 | Switchgrass Rhizosphere | KFVYWAVTSGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS |
| Ga0207709_100409994 | 3300025935 | Miscanthus Rhizosphere | NAAKAAELRKFVYWAVTQGQKFGPPLFFVPLPTPVKAYAYRELAKVKAT |
| Ga0207704_113217851 | 3300025938 | Miscanthus Rhizosphere | YWAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQGST |
| Ga0207711_111674611 | 3300025941 | Switchgrass Rhizosphere | VILPTSSAKAGDLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA |
| Ga0207661_121339552 | 3300025944 | Corn Rhizosphere | PTDSGSQAADLRKFVYWAVTQGQKFGPPLFFVPLPDQVKAYEYREIKKIQGGR |
| Ga0207651_103730042 | 3300025960 | Switchgrass Rhizosphere | KAADLRKFVYWAVTAGQKFGPPLYFVPLPKSVNGFNYREIKKIQAGS |
| Ga0209470_11427982 | 3300026324 | Soil | DLRKVVYWAVTSGQQYGPKLLFQPLPTKVQAFDYKQIKKIQSST |
| Ga0207607_1002501 | 3300027475 | Soil | ILPTSSAKAADLRKFVYWAVTQGQKFAPPLFFVPLPTSVKAYAYRELAKVKVAA |
| Ga0209683_100539893 | 3300027840 | Wetland Sediment | KAAELRKFIYWAVTQGQKFGPALLFQPLPQPVQAFAFREIKKIQAST |
| Ga0209068_104986682 | 3300027894 | Watersheds | FIYWAVTEGQRYGPPLLFQPVPLVVQAFAYRQIAKILAPTA |
| Ga0209382_115271041 | 3300027909 | Populus Rhizosphere | KFVYWAVTQGQKFGPPLLFQPLPKTVQAFAFREIKKIQVS |
| Ga0268266_109457351 | 3300028379 | Switchgrass Rhizosphere | VIVPTNYGSKAADLRKFVYWAVTQGQKFGPPLFFVPLPNQVKAYDYREIKKIQGGR |
| Ga0268266_111705271 | 3300028379 | Switchgrass Rhizosphere | VPTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKSVNGFNYREIKKIQAGS |
| Ga0268265_120642222 | 3300028380 | Switchgrass Rhizosphere | ISTFTYVIVPTDSGSQAADLRKFVYWAVTQGQKFGPPLFFVPMPASVNGFVYREIKKIRAGT |
| Ga0247822_109815601 | 3300028592 | Soil | WAVTSGQKFGPPLLFQPLPDTVKAFAYREIKKIQGAS |
| Ga0247819_109122062 | 3300028608 | Soil | MVYWAVTRGQQFGPPLLFAKLPVPVQAFAFREIKKIQAT |
| Ga0307298_102447602 | 3300028717 | Soil | AADLRKFIYWAVTAGQKFGPPLYFVPLPKAVNGFVYREIKKIQAGT |
| Ga0307302_103264631 | 3300028814 | Soil | SSGDKAADLRKFIYWAVTAGQKFGPPLHFVPLPAAVNGFIYREIKKIQAGS |
| Ga0307308_103185682 | 3300028884 | Soil | VPTSSGDKAQTLRQFIYWAVTSGQKFGPLLFFVPLPKAVNAFIYREIKKIQSGT |
| Ga0311337_109112011 | 3300030000 | Fen | SAKAKLLRTFVYWSVTEGQKFGPPLLFQPVPRVVQAFAYQQIAKIQVATP |
| Ga0311333_109843702 | 3300030114 | Fen | LRKLIYWAVTSGQKLGPKLLFQPLPKQVQAFDYKQIKQIQG |
| Ga0302323_1000645908 | 3300031232 | Fen | YWAVTEGQKFGPPLLFQPVPRVVQAFAYQQIAKIQVATP |
| Ga0302321_1034466781 | 3300031726 | Fen | RKLIYWAVTSGQKLGPKLLFQPLPKQVQAFDYKQIKQIQG |
| Ga0307468_1003976261 | 3300031740 | Hardwood Forest Soil | DLRKFVYWAVTAGQKFGPPLFFVPLPKSVNGFNYREIKKIQAGS |
| Ga0307406_107709702 | 3300031901 | Rhizosphere | YVILPTSTAKAADLRKFVYWAVTQGQKFGPPLFFVPLPTSVKAYAYRELAKVKVAA |
| Ga0310903_105834392 | 3300032000 | Soil | VVAVSSYVIVPTNSGDKAAGLRKFVYWAVTAGQKFGPPLFFVPMPASVNGFVYREIRKIQAGT |
| Ga0310897_106723622 | 3300032003 | Soil | PTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPMPKAVNGFIYREIKKIQAGS |
| Ga0310902_106786661 | 3300032012 | Soil | WAITSGQKFGPPLLFAPLPKSVLAFDYKQIKKIQGST |
| Ga0310906_112174442 | 3300032013 | Soil | IVPTKANKAADLRRFVYWAVTRGQQYGPPLLFQPLPTTVKAFAYREIKKIQVT |
| Ga0310899_101286382 | 3300032017 | Soil | VIVPTSSGDKAADLRKFVYWAVTAGQKFGPPLFFVPLPKAVNAFIYREIKKIQAGS |
| Ga0307470_118328172 | 3300032174 | Hardwood Forest Soil | VYWAVTAGQKFGPPLFFVPLPKAVNGYIYREIKKIQSGS |
| Ga0335084_107302961 | 3300033004 | Soil | DMRKLIYWAVTQGQKSGPPLFFVPLPKSVQAFAYREIKKIQAGT |
| ⦗Top⦘ |