Basic Information | |
---|---|
Family ID | F070255 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 123 |
Average Sequence Length | 41 residues |
Representative Sequence | VETIDEVLLLALEDSCPTEAATDEGPPLWTTEQPSQGIQTS |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 95.93 % |
Associated GOLD sequencing projects | 94 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.374 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (8.130 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.407 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.911 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.94% β-sheet: 0.00% Coil/Unstructured: 84.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF01926 | MMR_HSR1 | 26.83 |
PF07498 | Rho_N | 3.25 |
PF08323 | Glyco_transf_5 | 1.63 |
PF00206 | Lyase_1 | 0.81 |
PF00071 | Ras | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG0297 | Glycogen synthase | Carbohydrate transport and metabolism [G] | 1.63 |
COG0438 | Glycosyltransferase involved in cell wall bisynthesis | Cell wall/membrane/envelope biogenesis [M] | 1.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.37 % |
Unclassified | root | N/A | 1.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c1853417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1007659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1212 | Open in IMG/M |
3300000787|JGI11643J11755_10702191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300000953|JGI11615J12901_11638649 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300000956|JGI10216J12902_106841044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 876 | Open in IMG/M |
3300003203|JGI25406J46586_10248063 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300004157|Ga0062590_102898604 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005294|Ga0065705_10030959 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300005328|Ga0070676_11468473 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005330|Ga0070690_100791937 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
3300005331|Ga0070670_100466323 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300005334|Ga0068869_101215543 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300005340|Ga0070689_100262499 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
3300005343|Ga0070687_100274982 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300005353|Ga0070669_101149870 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300005356|Ga0070674_101339165 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300005471|Ga0070698_101389625 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
3300005577|Ga0068857_100530165 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300005578|Ga0068854_100836593 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300005618|Ga0068864_101000340 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300005841|Ga0068863_100037146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4638 | Open in IMG/M |
3300005842|Ga0068858_100186070 | All Organisms → cellular organisms → Bacteria | 1961 | Open in IMG/M |
3300005844|Ga0068862_102368585 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005875|Ga0075293_1007317 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300006237|Ga0097621_100021446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4997 | Open in IMG/M |
3300006358|Ga0068871_102108389 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300006806|Ga0079220_10115719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1419 | Open in IMG/M |
3300006845|Ga0075421_102457841 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300006847|Ga0075431_101042177 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300006876|Ga0079217_10505714 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
3300007076|Ga0075435_101547605 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300009012|Ga0066710_101120323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1217 | Open in IMG/M |
3300009098|Ga0105245_10569097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
3300009174|Ga0105241_11491633 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300009174|Ga0105241_12136888 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300009177|Ga0105248_11200839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 858 | Open in IMG/M |
3300009545|Ga0105237_10240332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1812 | Open in IMG/M |
3300009789|Ga0126307_11482453 | Not Available | 550 | Open in IMG/M |
3300010044|Ga0126310_10852445 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300010047|Ga0126382_11845295 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300010146|Ga0126320_1123690 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300010166|Ga0126306_11871953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300010166|Ga0126306_11876442 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300010360|Ga0126372_10674725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300010362|Ga0126377_12513290 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300010375|Ga0105239_10808758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
3300010396|Ga0134126_11570189 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300010397|Ga0134124_10533809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1140 | Open in IMG/M |
3300010397|Ga0134124_10694095 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
3300010397|Ga0134124_11287241 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300010399|Ga0134127_12654562 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300010403|Ga0134123_10467146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
3300011119|Ga0105246_10746799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
3300011333|Ga0127502_11252038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
3300012200|Ga0137382_10588592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300012203|Ga0137399_10232894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1506 | Open in IMG/M |
3300012203|Ga0137399_11061813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300012353|Ga0137367_10512626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
3300012359|Ga0137385_10111807 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2415 | Open in IMG/M |
3300012359|Ga0137385_10857502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
3300012362|Ga0137361_10938862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
3300012510|Ga0157316_1083398 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300012684|Ga0136614_10132491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1889 | Open in IMG/M |
3300012902|Ga0157291_10337209 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300012930|Ga0137407_11200448 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300012948|Ga0126375_10278485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1149 | Open in IMG/M |
3300012958|Ga0164299_10442529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300012961|Ga0164302_10631957 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300012989|Ga0164305_10325946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
3300013307|Ga0157372_11705090 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300014487|Ga0182000_10192498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
3300015245|Ga0137409_11076225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
3300015372|Ga0132256_100846617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
3300015372|Ga0132256_102342161 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300018422|Ga0190265_10697431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
3300018469|Ga0190270_12450873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300019767|Ga0190267_11364352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
3300020003|Ga0193739_1146058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
3300021445|Ga0182009_10145204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
3300024288|Ga0179589_10257337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
3300025904|Ga0207647_10400529 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300025911|Ga0207654_10134671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1568 | Open in IMG/M |
3300025911|Ga0207654_11303170 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300025927|Ga0207687_11033502 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300025932|Ga0207690_10805088 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300025934|Ga0207686_10901972 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300025936|Ga0207670_10666156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
3300025936|Ga0207670_10983096 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300025936|Ga0207670_11881826 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300025939|Ga0207665_10192790 | Not Available | 1481 | Open in IMG/M |
3300025942|Ga0207689_10049647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3461 | Open in IMG/M |
3300025942|Ga0207689_10058312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3175 | Open in IMG/M |
3300025942|Ga0207689_11281911 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300025942|Ga0207689_11558943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300025945|Ga0207679_10955192 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300025945|Ga0207679_11048470 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
3300025949|Ga0207667_12010100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300025981|Ga0207640_10827506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300026023|Ga0207677_12085504 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300026035|Ga0207703_10840829 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300026089|Ga0207648_11790878 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300026116|Ga0207674_12223741 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300026142|Ga0207698_11944668 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300027765|Ga0209073_10144865 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
3300027886|Ga0209486_11266051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300028587|Ga0247828_11153570 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300030511|Ga0268241_10041848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
3300030511|Ga0268241_10079057 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300030511|Ga0268241_10156331 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300031562|Ga0310886_10468724 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300031720|Ga0307469_11574116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
3300031731|Ga0307405_11496168 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300031740|Ga0307468_100408276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
3300031858|Ga0310892_10584326 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
3300031858|Ga0310892_10807348 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300032002|Ga0307416_100361004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1475 | Open in IMG/M |
3300032002|Ga0307416_101833854 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300032205|Ga0307472_102210012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
3300033412|Ga0310810_10370310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1496 | Open in IMG/M |
3300033412|Ga0310810_10902602 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300034376|Ga0334923_130151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300034391|Ga0334917_068873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300034666|Ga0314788_090803 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.13% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.13% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.69% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.88% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.06% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.25% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.25% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.25% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.44% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.44% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.44% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.44% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.63% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
Hypolithic Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust | 1.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.63% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.63% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.81% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010146 | Soil microbial communities from California, USA to study soil gas exchange rates - JR-CA-SND metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034376 | Biocrust microbial communities from Mojave Desert, California, United States - 19HNC | Environmental | Open in IMG/M |
3300034391 | Biocrust microbial communities from Mojave Desert, California, United States - 13HMC | Environmental | Open in IMG/M |
3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_18534172 | 3300000033 | Soil | VLALALEXVCPTXAATPHEAKTPPLWTTEQPSHGIPTS* |
KanNP_Total_noBrdU_T14TCDRAFT_10076591 | 3300000596 | Soil | TIDDVLALALEDSCPTDDAPEGRPPLWNTEQPSQGIQTS* |
JGI11643J11755_107021911 | 3300000787 | Soil | VLALALEDVCPTDAATPHEAKTPPLWTTEQPSHGIPTS* |
JGI11615J12901_116386491 | 3300000953 | Soil | VLLIALEDSCPTQAATDEAPPLWTTEQPSQGIQTS* |
JGI10216J12902_1068410443 | 3300000956 | Soil | RIDEVLSLALEDQVPTAAATDEAPPLWTTEQPSQGIQTR* |
JGI25406J46586_102480632 | 3300003203 | Tabebuia Heterophylla Rhizosphere | ETIDEVLSLSLEEACPTEAAAGEGPPLWTTEQPSQGIQTS* |
Ga0062590_1028986042 | 3300004157 | Soil | NIDEVLSLALEDSCPTQAAADEGPPIWNTEQPSQGIQTS* |
Ga0065705_100309593 | 3300005294 | Switchgrass Rhizosphere | LVETIDEVLLIALEDSCPTQAATDEGPPLWTTEQPSQGIQTS* |
Ga0070676_114684732 | 3300005328 | Miscanthus Rhizosphere | ALSVHLVETIDEVLALALEDTPTETATTEAPPLWTTEQPSQGIPTS* |
Ga0070690_1007919372 | 3300005330 | Switchgrass Rhizosphere | HLVETIDEVLSLALEDSCPTEAAADEGPPIWNTEQPSQGIQTS* |
Ga0070670_1004663231 | 3300005331 | Switchgrass Rhizosphere | ALCVHFVETIDEVLLLALEDSCPTQAAADEGPPLWTTEQPSQGIQTS* |
Ga0068869_1012155431 | 3300005334 | Miscanthus Rhizosphere | EVLSIHLVETIDEVLSLALEDSCPTEAAADEGPPIWNTEQPSQGIQTS* |
Ga0070689_1002624991 | 3300005340 | Switchgrass Rhizosphere | TIDEVLAIALEDACPTDAATAEAPPLWTTEQPTQGIQTS* |
Ga0070687_1002749823 | 3300005343 | Switchgrass Rhizosphere | DEVLALALEDVCPTDPAAADESKAPPLWTPEPPSQGIQTS* |
Ga0070669_1011498702 | 3300005353 | Switchgrass Rhizosphere | EVRDALNINLVENIDEVLAFALEDSVPTAATDEAPPLWNTEQPSQGIPTS* |
Ga0070674_1013391651 | 3300005356 | Miscanthus Rhizosphere | HLVETIDEVLALALEDTPTETATTEAPPLWTTEQPSQGIPTS* |
Ga0070698_1013896252 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | NLVETIDEVLALALEDVAPTEAATDEGPPLWTTEQPSQGIQTS* |
Ga0068857_1005301651 | 3300005577 | Corn Rhizosphere | VLSIHLVETIDEVLSLALEDSCPTQAAADEGPPIWNTEQPSQGIQTS* |
Ga0068854_1008365932 | 3300005578 | Corn Rhizosphere | VLSLALEEACPTDAAAGEGPPLWTTEQPSQGIQTS* |
Ga0068864_1010003402 | 3300005618 | Switchgrass Rhizosphere | LALALEESCPTDAATAEAPPIWTTEQPSQGIQTS* |
Ga0068863_1000371461 | 3300005841 | Switchgrass Rhizosphere | NLVETIDEVLAFALEDACPTDAATAEAPPLWTTEQPAQGIQTS* |
Ga0068858_1001860701 | 3300005842 | Switchgrass Rhizosphere | VQLVETIDEVLLIALEDSCPTQAATDEGPPLWTTEQPSQGIQTS* |
Ga0068862_1023685851 | 3300005844 | Switchgrass Rhizosphere | TIDEVLSLALEDACPTEAADEAPPLWTTEQPSQGIQTS* |
Ga0075293_10073173 | 3300005875 | Rice Paddy Soil | QLVETIDQVLSFALEDSCPTEAATDEGPPLWTTEQPSQGIQTS* |
Ga0097621_1000214461 | 3300006237 | Miscanthus Rhizosphere | LVETIDEVLAFALEDACPTDAATAEAPPLWTTEQPAQGIQTS* |
Ga0068871_1021083892 | 3300006358 | Miscanthus Rhizosphere | LVETIDEVLSLALEDSVPTPATDEAPPLWTTEQPSQGIQTS* |
Ga0079220_101157191 | 3300006806 | Agricultural Soil | EVLSIALEDSCPTQAATDEAPPLWTTEQPSQGIQTS* |
Ga0075421_1024578411 | 3300006845 | Populus Rhizosphere | VETIDEVLSLALEDTCPTEAATDEGPPLWTTEQPSQGIQTS* |
Ga0075431_1010421771 | 3300006847 | Populus Rhizosphere | LNVNLVETIDEVLSFALEDSVPTAAATDEAPPLWNTEQPSQGIQTS* |
Ga0079217_105057141 | 3300006876 | Agricultural Soil | DEVLSLALEEACPTDAAATEAPPLWTTEQPSQGIQTS* |
Ga0075435_1015476051 | 3300007076 | Populus Rhizosphere | DEVLAIALEDSCPTDAAATTEAPPLWTTEPPSQGIQTS* |
Ga0066710_1011203233 | 3300009012 | Grasslands Soil | ETIDEVLALALEEPGPTDSEAPDQSKTPPLWTTEQPAQSIPTS |
Ga0105245_105690971 | 3300009098 | Miscanthus Rhizosphere | LSIHLVETIDEVLSLALEDSCPTQAAADEGPPIWNTEQPSQGIQTS* |
Ga0105241_114916331 | 3300009174 | Corn Rhizosphere | LVETIDEVLSLALEDSCPTQAATDEGPPLWTTEQPSQGIQTS* |
Ga0105241_121368882 | 3300009174 | Corn Rhizosphere | LLIALEDSVPTQAATDEAPPLWTTEQPSQGIQTS* |
Ga0105248_112008393 | 3300009177 | Switchgrass Rhizosphere | VLALALEDACPTEEAPDERPPLWNTEQPSQGIPTS* |
Ga0105237_102403321 | 3300009545 | Corn Rhizosphere | ALCIHFVESIDEVLSIALEDSCPTEAATDEAPPLWTTEQPSQGIQTS* |
Ga0126307_114824532 | 3300009789 | Serpentine Soil | VLSLALEDACPTDAGAVDGAKAPPLWSTDQPSQGVQTIAE* |
Ga0126310_108524451 | 3300010044 | Serpentine Soil | TIDEVLLLALEDACPTEAAAEGPPLWTTEQPSQGIQTS* |
Ga0126382_118452952 | 3300010047 | Tropical Forest Soil | DEVLSLALEDSCPTEAATDEGPPLWTTEQPSQGIQTS* |
Ga0126320_11236902 | 3300010146 | Soil | QFVETIDEVLSLALEDSCPTEAAADEGPPLWTTEQPSQGIQTS* |
Ga0126306_118719532 | 3300010166 | Serpentine Soil | EVLALALEDACPTEAGAVDAKTPPLWTTEPPTQGVQTIAE* |
Ga0126306_118764421 | 3300010166 | Serpentine Soil | LPDEVRDALCVHFVDTIDEVLSLALEDSCPTQAATDEGPPLWTTEQPSQGIQTS* |
Ga0126372_106747251 | 3300010360 | Tropical Forest Soil | ETIDEVLSLALEDSCPTQAATDEGPPLWNTEQPSQGIQTS* |
Ga0126377_125132902 | 3300010362 | Tropical Forest Soil | ETIDEVLSLALEDSCPTQAATDETPPLWNTEQPSQGIQTS* |
Ga0105239_108087583 | 3300010375 | Corn Rhizosphere | VLSLALEDSCPTQAATDEGPPLWNTEQPSQGIQTS* |
Ga0134126_115701893 | 3300010396 | Terrestrial Soil | VLLLALEDSCPTEAAADEGPPLWTTEQPSQGIQTS* |
Ga0134124_105338093 | 3300010397 | Terrestrial Soil | VDTIDEVLSLALEDACPTEAADEAPPLWTTEQPSQGIQTS* |
Ga0134124_106940951 | 3300010397 | Terrestrial Soil | TVQFVETIDEVLSQALEEACPTEAAAGEGPPLWTTEQPSQGIQTS* |
Ga0134124_112872411 | 3300010397 | Terrestrial Soil | VLSIHLVETIDEVLSLALEDSCPTEAAADEGPPIWNTEQPSQGIQTS* |
Ga0134127_126545621 | 3300010399 | Terrestrial Soil | VETIDEVLLLALEDSCPTEAATDEGPPLWTTEQPSQGIQTS* |
Ga0134123_104671463 | 3300010403 | Terrestrial Soil | LVENIDEVLAFALEDSVPTAATDEAPPLWNTEQPSQGIPTS* |
Ga0105246_107467991 | 3300011119 | Miscanthus Rhizosphere | IDEVLSQALEEACPTEAAAGEGPPLWTTEQPSQGIQTS* |
Ga0127502_112520382 | 3300011333 | Soil | EEVRDSLNINLVESIDEVLSLALEDSVPTAAATDEAPPLWNTEQPSQGIQTR* |
Ga0137382_105885921 | 3300012200 | Vadose Zone Soil | VETIDEVLALALEDVCQTAEATTPDQPSAPPLWTTEPPSQGIPTS* |
Ga0137399_102328941 | 3300012203 | Vadose Zone Soil | TIDEVLALALEDVVPTTDATSTDEAKAPPLWSTEQPSQGIPTS* |
Ga0137399_110618132 | 3300012203 | Vadose Zone Soil | EVLALALEDACPTTPDAVTAEETKTPPLWSTEQPSQGIPTS* |
Ga0137367_105126262 | 3300012353 | Vadose Zone Soil | DEVLALALEDACPTDAVVPDESKTPPLWTTEPPSQGIQTS* |
Ga0137385_101118071 | 3300012359 | Vadose Zone Soil | ETIDEVLALALEEPGPTDSEAPDQSKTPPLWTTEQPAQSIPTS* |
Ga0137385_108575023 | 3300012359 | Vadose Zone Soil | LVETIDEVLALALEDVRPTTEATTADEPKTPPLWTTEQPSQGIPTS* |
Ga0137361_109388621 | 3300012362 | Vadose Zone Soil | LALEEVIPTDAAATDEAKTPPLWTTEQPSQGIQTS* |
Ga0157316_10833982 | 3300012510 | Arabidopsis Rhizosphere | EGIDEVLAIALEDSCPTDAATTTEAPPLWTTEPPSQGIQTS* |
Ga0136614_101324914 | 3300012684 | Polar Desert Sand | DEVLALALEDVCPTEPPADEAKAPPLWTTEPPAQGIQTS* |
Ga0157291_103372091 | 3300012902 | Soil | LVETIDEVLLLALEDSCPTQAAADEGPPLWTTEQPSQGIQTS* |
Ga0137407_112004481 | 3300012930 | Vadose Zone Soil | IDDVLALALEDACPTEAATNEGPPLWTTEQPTQGIQTS* |
Ga0126375_102784851 | 3300012948 | Tropical Forest Soil | VLALALEDACPTDAAATDEGPPLWTTEQPSQGIQTS* |
Ga0164299_104425293 | 3300012958 | Soil | DEVLSLALEEACPTEAAAGEGPPLWTTEQPSQGIQTS* |
Ga0164302_106319573 | 3300012961 | Soil | EVLSLALEEACPTEAAAGEGPPLWTTEQPSQGIQTS* |
Ga0164305_103259461 | 3300012989 | Soil | VNLVDTIDEVLSLALEEACPTEAAAGEGPPLWTTEQPSQGIQTS* |
Ga0157372_117050901 | 3300013307 | Corn Rhizosphere | EGRDALNVNFVETIAAVLSIALEDACPTQAADEPPPLWNTEQPSQGIQTS* |
Ga0182000_101924981 | 3300014487 | Soil | ACPTSAGAVTAEDTTTPPLWTTEPPTHGVQTIAE* |
Ga0137409_110762251 | 3300015245 | Vadose Zone Soil | VLALALEEPIQTDAAAPDEAKAPPLWTPELPSQGIQTS* |
Ga0132256_1008466171 | 3300015372 | Arabidopsis Rhizosphere | TIDEVLALALEEPCPTEATAEAPPLWTTEQPSQGIQTS* |
Ga0132256_1023421611 | 3300015372 | Arabidopsis Rhizosphere | TIDEVLALALEDECPTDAATAEAPPLWTTEQPAQGIQTS* |
Ga0190265_106974311 | 3300018422 | Soil | TIDEVLSLALEDSVPTAATDEAPPLWTTEQPSQGIQTS |
Ga0190270_124508731 | 3300018469 | Soil | DRLALALEDACPTDAATDDAKTPPLWTTEQPSQGIQTS |
Ga0190267_113643521 | 3300019767 | Soil | NFALEDACPTDAGAVDEAKTPPLWSTDQPSQGAQTIAE |
Ga0193739_11460582 | 3300020003 | Soil | VLALALEDACPTEVGADEAKAPPLWSTEQPSQGIPTS |
Ga0182009_101452043 | 3300021445 | Soil | TVNLVETIDEVLSLALEEACPTDAAAGEGPPLWTTEQPSQGIQTS |
Ga0179589_102573371 | 3300024288 | Vadose Zone Soil | ENIDEGLALALEDSCPTDGNVSDDAKAPPIWTTEPPTRSIQTIAE |
Ga0207647_104005291 | 3300025904 | Corn Rhizosphere | LVETIDEVLLLALEDTCPTQAATDEAPPLWTTEQPSQGIQTS |
Ga0207654_101346711 | 3300025911 | Corn Rhizosphere | IDEVLAFALEDACPTDAATAEAPPLWTTEQPAQGIQTS |
Ga0207654_113031701 | 3300025911 | Corn Rhizosphere | LVETIDEVLSLALEDSCPTQAATDEGPPLWTTEQPSQGIQTS |
Ga0207687_110335022 | 3300025927 | Miscanthus Rhizosphere | VETIDEVLLLALEDSCPTEAAADEGPPLWTTEQPSQGIQTS |
Ga0207690_108050882 | 3300025932 | Corn Rhizosphere | DSMTVQFVETIDEVLLLALEDSCPTEAAADEGPPLWTTEQPSQGIQTS |
Ga0207686_109019722 | 3300025934 | Miscanthus Rhizosphere | IDEVLSIALEDSCPTEAATDEAPPLWTTEQPSQGIQTS |
Ga0207670_106661563 | 3300025936 | Switchgrass Rhizosphere | ETIDEVLLLALEDSCPTQAAADEGPPLWTTEQPSQGIQTS |
Ga0207670_109830962 | 3300025936 | Switchgrass Rhizosphere | TIDEVLAIALEDACPTDAATAEAPPLWTTEQPTQGIQTS |
Ga0207670_118818261 | 3300025936 | Switchgrass Rhizosphere | IDEVLLIALEDSCPTQAATDEAPPLWTTEQPSQGIQTS |
Ga0207665_101927902 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TIDDVLTLALEDACPTEAATNEGPPLWTTEQPSQGIQTS |
Ga0207689_100496471 | 3300025942 | Miscanthus Rhizosphere | DEVLSLALEDSCPTEAAADEGPPIWNTEQPSQGIQTS |
Ga0207689_100583121 | 3300025942 | Miscanthus Rhizosphere | SIDEVLAIALEDSCPTDAAATTEAPPLWTTEPPSQGIQTS |
Ga0207689_112819112 | 3300025942 | Miscanthus Rhizosphere | SIDDVLALALEDACPTEEAPDERPPLWNTEQPSQGIPTS |
Ga0207689_115589431 | 3300025942 | Miscanthus Rhizosphere | VLALALEDACPTDAGADEPKTPPLWSTEQPSQGIQTS |
Ga0207679_109551921 | 3300025945 | Corn Rhizosphere | ETIDEVLSLALEDSCPTQAAADEGPPIWNTEQPSQGIQTS |
Ga0207679_110484702 | 3300025945 | Corn Rhizosphere | EVLSLALEDACPTQAADETPPLWTTEQPSQGIQTS |
Ga0207667_120101002 | 3300025949 | Corn Rhizosphere | IDEVLALALEDACPTDAGADEPKTPPLWSTEQPSQGIQTS |
Ga0207640_108275062 | 3300025981 | Corn Rhizosphere | TIDDVLALALEDACPTDAAATADGAPPLWTTEPPSQGIQTS |
Ga0207677_120855042 | 3300026023 | Miscanthus Rhizosphere | VETIDEVLLIALEDSCPTQAATDEAPPLWTTEQPSQGIQTS |
Ga0207703_108408293 | 3300026035 | Switchgrass Rhizosphere | VETIDEVLLIALEDSVPTQAATDEAPPLWTTEQPSQGIQTS |
Ga0207648_117908781 | 3300026089 | Miscanthus Rhizosphere | LVETIDEVLLLALEDSCPAEAATDEGPPLWTTEQPSQGIQTS |
Ga0207674_122237412 | 3300026116 | Corn Rhizosphere | EVLSIHLVENIDEVLSLALEDSCPTQAADEGPPIWNTEQPSQGIQTS |
Ga0207698_119446681 | 3300026142 | Corn Rhizosphere | INFVETIDEVLLIALEDACPTQAADETPPLWNTEQPSQGIQTS |
Ga0209073_101448651 | 3300027765 | Agricultural Soil | HFVETIDEVLSIALEDSCPTQAATDEAPPLWTTEQPSQGIQTS |
Ga0209486_112660512 | 3300027886 | Agricultural Soil | IDEVLALALEEACPTEAAEAPPIWTTEQPSQGIQTS |
Ga0247828_111535701 | 3300028587 | Soil | TIDDVLALALEDACPTEEAPDERPPLWNTEQPSQGIQTS |
Ga0268241_100418483 | 3300030511 | Soil | ETIDEVLSLALEEACPTEAAAGEGPPLWTTEQPSQGIQTS |
Ga0268241_100790571 | 3300030511 | Soil | EVLLLALEDSCPTQAAADEGPPLWTTEQPSQGIQTS |
Ga0268241_101563312 | 3300030511 | Soil | TIDEVLSLSLEEACPTEAAAGEGPPLWTTEQPSQGIQTS |
Ga0310886_104687242 | 3300031562 | Soil | VLALALEDSCPTQAATDEGPPLWSTEQPSQGIQTS |
Ga0307469_115741161 | 3300031720 | Hardwood Forest Soil | NLVETIDEVLAFALEDACPTDAATAEAPPIWTTEQPAQGIQTS |
Ga0307405_114961681 | 3300031731 | Rhizosphere | LPEEVREMLTIHLVDTIDEVLSLALEDSCPTEAAADEGPPIWNTEQPSQGIQTS |
Ga0307468_1004082761 | 3300031740 | Hardwood Forest Soil | LALALEDVCPTDAATEEAKTPPLWTPEPPSQGIQTS |
Ga0310892_105843261 | 3300031858 | Soil | EVLAFALEDSVPTAATDEAPPLWNTEQPSQGIPTS |
Ga0310892_108073481 | 3300031858 | Soil | EGIDEVLAIALEDSCPTDAAATTEAPPLWTTEPPSQGIQTS |
Ga0307416_1003610041 | 3300032002 | Rhizosphere | DEVLSLALEDSCPTQAATDEGPPLWTTEQPSQGIQTS |
Ga0307416_1018338541 | 3300032002 | Rhizosphere | TIDEVLLLALEDTCPTQAATDEGPPLWTTEQPSQGIQTS |
Ga0307472_1022100122 | 3300032205 | Hardwood Forest Soil | FVETIDEVLALALEDVPATDAGVEEAKTPPLWSTEQPSQGIPTS |
Ga0310810_103703101 | 3300033412 | Soil | EVLSIHLVETIDEVLSLALEDSCPTQAAADEGPPIWNTEQPSQGIQTS |
Ga0310810_109026021 | 3300033412 | Soil | VETIDEVLLLALEDSCPTEAADETPPLWTTEQPSQGIQTS |
Ga0334923_130151_408_518 | 3300034376 | Hypolithic Biocrust | ALEDACPTDAGVPEDSKTPPLWTTEPPTHGVQTIAE |
Ga0334917_068873_2_145 | 3300034391 | Hypolithic Biocrust | ENIDEVLTLALEDACPTGAGEGTAEETSTPPLWTTEPPTQGVQTIAE |
Ga0314788_090803_1_111 | 3300034666 | Soil | EVLLLALEDACPAQAPADEGPPLWTTEQPSQGIQTS |
⦗Top⦘ |