Basic Information | |
---|---|
Family ID | F070244 |
Family Type | Metagenome |
Number of Sequences | 123 |
Average Sequence Length | 43 residues |
Representative Sequence | MTRKRHIVIVDDEPNIGRSLRLILEGEGYRVSVCDSVA |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 68.29 % |
% of genes near scaffold ends (potentially truncated) | 98.37 % |
% of genes from short scaffolds (< 2000 bps) | 95.93 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (13.821 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.707 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.593 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 15.15% Coil/Unstructured: 68.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF02518 | HATPase_c | 93.50 |
PF00072 | Response_reg | 1.63 |
PF01103 | Omp85 | 1.63 |
PF01594 | AI-2E_transport | 0.81 |
PF00975 | Thioesterase | 0.81 |
PF00158 | Sigma54_activat | 0.81 |
PF00528 | BPD_transp_1 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000363|ICChiseqgaiiFebDRAFT_10731839 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300000890|JGI11643J12802_11851093 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
3300000891|JGI10214J12806_10021956 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300001686|C688J18823_10459413 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300002128|JGI24036J26619_10096847 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
3300004114|Ga0062593_101550493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 716 | Open in IMG/M |
3300004156|Ga0062589_100223782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1383 | Open in IMG/M |
3300004156|Ga0062589_100563375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 978 | Open in IMG/M |
3300004463|Ga0063356_104086140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300005295|Ga0065707_11143273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 506 | Open in IMG/M |
3300005332|Ga0066388_102321481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 971 | Open in IMG/M |
3300005332|Ga0066388_106467436 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 591 | Open in IMG/M |
3300005340|Ga0070689_101385175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 635 | Open in IMG/M |
3300005344|Ga0070661_100037969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 3505 | Open in IMG/M |
3300005347|Ga0070668_101463757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 624 | Open in IMG/M |
3300005354|Ga0070675_102030593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 530 | Open in IMG/M |
3300005440|Ga0070705_101330630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 596 | Open in IMG/M |
3300005459|Ga0068867_100283248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1360 | Open in IMG/M |
3300005459|Ga0068867_101663207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 598 | Open in IMG/M |
3300005466|Ga0070685_11325474 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300005577|Ga0068857_102525147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 504 | Open in IMG/M |
3300005617|Ga0068859_101127898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 863 | Open in IMG/M |
3300005618|Ga0068864_102212922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 556 | Open in IMG/M |
3300005764|Ga0066903_103799407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 811 | Open in IMG/M |
3300005764|Ga0066903_105997024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 637 | Open in IMG/M |
3300005844|Ga0068862_101269439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 737 | Open in IMG/M |
3300006237|Ga0097621_100238316 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
3300006846|Ga0075430_101686395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 520 | Open in IMG/M |
3300006846|Ga0075430_101735082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 512 | Open in IMG/M |
3300006847|Ga0075431_100211960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1978 | Open in IMG/M |
3300006876|Ga0079217_10432914 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
3300006881|Ga0068865_100446959 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
3300006894|Ga0079215_10801778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 657 | Open in IMG/M |
3300006969|Ga0075419_10490408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 852 | Open in IMG/M |
3300007004|Ga0079218_11814136 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300007004|Ga0079218_12436062 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300009053|Ga0105095_10234467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
3300009078|Ga0105106_10200033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1458 | Open in IMG/M |
3300009094|Ga0111539_10662668 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1215 | Open in IMG/M |
3300009094|Ga0111539_11260391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
3300009147|Ga0114129_11670700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
3300009527|Ga0114942_1372386 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300010036|Ga0126305_10697143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
3300010397|Ga0134124_11713315 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300010399|Ga0134127_13010027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300011445|Ga0137427_10346241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
3300012212|Ga0150985_100006721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300012892|Ga0157294_10019578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
3300012908|Ga0157286_10262267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300012944|Ga0137410_10078006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2416 | Open in IMG/M |
3300013297|Ga0157378_11413626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
3300014969|Ga0157376_11768883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300015077|Ga0173483_10489988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
3300015200|Ga0173480_10066637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1663 | Open in IMG/M |
3300015200|Ga0173480_10763906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300015200|Ga0173480_11093599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300015371|Ga0132258_10943191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2180 | Open in IMG/M |
3300015372|Ga0132256_102587363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
3300015373|Ga0132257_100451050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
3300015373|Ga0132257_103304579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300015374|Ga0132255_101316565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
3300015374|Ga0132255_102989713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
3300018063|Ga0184637_10363368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
3300018081|Ga0184625_10178306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
3300018422|Ga0190265_12786722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300018469|Ga0190270_12838068 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
3300018476|Ga0190274_10040756 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3273 | Open in IMG/M |
3300018476|Ga0190274_12948191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
3300019361|Ga0173482_10344253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
3300019377|Ga0190264_11626306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300022904|Ga0247769_1181407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300023260|Ga0247798_1050843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
3300025901|Ga0207688_10996299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300025903|Ga0207680_10415008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 953 | Open in IMG/M |
3300025908|Ga0207643_10108605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1632 | Open in IMG/M |
3300025920|Ga0207649_10324959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300025923|Ga0207681_10986002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300025925|Ga0207650_10732893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
3300025926|Ga0207659_10235066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1480 | Open in IMG/M |
3300025930|Ga0207701_11281954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
3300025932|Ga0207690_10273915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
3300025936|Ga0207670_10313174 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
3300025936|Ga0207670_11283758 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300025938|Ga0207704_11980352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300025945|Ga0207679_10804792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
3300025972|Ga0207668_11264086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
3300026023|Ga0207677_12110938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300026067|Ga0207678_10091973 | All Organisms → cellular organisms → Bacteria | 2593 | Open in IMG/M |
3300026078|Ga0207702_12411439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300026089|Ga0207648_11555952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300027636|Ga0214469_1057898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1193 | Open in IMG/M |
3300027907|Ga0207428_10138801 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1857 | Open in IMG/M |
3300027909|Ga0209382_10528176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1295 | Open in IMG/M |
3300028379|Ga0268266_11669677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300028380|Ga0268265_10885858 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
3300028592|Ga0247822_10327502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
3300031184|Ga0307499_10189515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300031198|Ga0307500_10134200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300031226|Ga0307497_10236899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
3300031538|Ga0310888_10929139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300031562|Ga0310886_10705739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
3300031572|Ga0318515_10476665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
3300031740|Ga0307468_101041999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
3300031748|Ga0318492_10432199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300031892|Ga0310893_10453454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
3300031908|Ga0310900_10313963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1158 | Open in IMG/M |
3300031913|Ga0310891_10375272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300031944|Ga0310884_10269058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
3300032003|Ga0310897_10112426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
3300032012|Ga0310902_10389333 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
3300032013|Ga0310906_10571704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
3300032017|Ga0310899_10470793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300032075|Ga0310890_10970148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300032122|Ga0310895_10175922 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 945 | Open in IMG/M |
3300032144|Ga0315910_11191732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
3300032157|Ga0315912_10325486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1213 | Open in IMG/M |
3300032179|Ga0310889_10148637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1047 | Open in IMG/M |
3300032179|Ga0310889_10494923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300032211|Ga0310896_10546966 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
3300032211|Ga0310896_10890732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
3300033486|Ga0316624_10563875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
3300034115|Ga0364945_0080435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
3300034150|Ga0364933_066282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 13.82% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.32% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.06% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.06% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.25% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.25% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.44% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.63% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.63% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.63% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.63% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.81% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.81% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300022904 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L166-409R-6 | Environmental | Open in IMG/M |
3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiFebDRAFT_107318391 | 3300000363 | Soil | MTRKRHIVIVDDEPNIGRSLRLILEGEGYRVSVCDSVA |
JGI11643J12802_118510932 | 3300000890 | Soil | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSTTAF |
JGI10214J12806_100219561 | 3300000891 | Soil | MTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICDSVSRFNALRGLGPVDLYLL |
C688J18823_104594132 | 3300001686 | Soil | MSRLRHILIVDDEPNIGSSLRLILEGAGHRVTVCESA |
JGI24036J26619_100968472 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRKRHIVIVDDEPNIGLSLRLILEGEGYRVSICESAA |
Ga0062593_1015504932 | 3300004114 | Soil | MTRQIVIVDDEPNIGPSLELILKREGYAVSVCKSVKEFEKQFS |
Ga0062589_1002237821 | 3300004156 | Soil | VSRMRHIVVVDDEPNIGRSLRLILEGEGYRVTVCESAARFHVERRKGRVD |
Ga0062589_1005633751 | 3300004156 | Soil | MSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESAARFTAQHGMGPVDL |
Ga0063356_1040861401 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTRKPHVVIVDDEPNIGLSLRLILEGGGYTVSICESVARFQ |
Ga0065707_111432731 | 3300005295 | Switchgrass Rhizosphere | MTRKHHIVIVDDEPNIGRSLRLILEGEGHRVTVFDSAAAFTTGRNRA |
Ga0066388_1023214811 | 3300005332 | Tropical Forest Soil | MTRRPRIVIVDDEANIGASLRLILEGEGYGVTVCGSIAEFQAQ |
Ga0066388_1064674361 | 3300005332 | Tropical Forest Soil | MIRKPRIVVVDDEPNIGASLRLILEGEGCSVTVCESIAEFQAQRSP |
Ga0070689_1013851751 | 3300005340 | Switchgrass Rhizosphere | VTRMRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSAAQFHVERRRVRA |
Ga0070661_1000379694 | 3300005344 | Corn Rhizosphere | MTRKRHIVIVDDEPNIGLSLRLILEGEGYRVSICESAAGFNAQRAMG |
Ga0070668_1014637572 | 3300005347 | Switchgrass Rhizosphere | MKRKHRIVIVDDEPNIGSSLRLILEGEGYGVTVCGSVAEFQPHRA |
Ga0070675_1020305932 | 3300005354 | Miscanthus Rhizosphere | MTSRKRHIVILDDEPNIGLSLRLILEREGYRVTVCESVASFQAER |
Ga0070705_1013306302 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESAARFTAQHGMGPVD |
Ga0068867_1002832481 | 3300005459 | Miscanthus Rhizosphere | VTRRHHVMILDDEPNIGSSLRLILEGEGFRVTVCDSAAEFQAE |
Ga0068867_1016632071 | 3300005459 | Miscanthus Rhizosphere | VTRMRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSAAQFHLERRRVRA |
Ga0070685_113254741 | 3300005466 | Switchgrass Rhizosphere | MILDDEPNIGSSLRLILEGEGFRVTVCDSAAEFQAERGRARADLY |
Ga0068857_1025251472 | 3300005577 | Corn Rhizosphere | MTRQIVIVDDEPNIGPSLELILKREGYAVSVCKSVKEFEKQFSSGRATAY |
Ga0068859_1011278982 | 3300005617 | Switchgrass Rhizosphere | VTRMRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSAAQFHVERRRV |
Ga0068864_1022129221 | 3300005618 | Switchgrass Rhizosphere | VTRVRHVMVVDDEPNIGRSLRLILEGAGYRVTVCDSVA |
Ga0066903_1037994071 | 3300005764 | Tropical Forest Soil | MYRKRHIVVVDDEANIGLSLRLILEGEGYRVTICDSAGAFARQRAAGGADLYL |
Ga0066903_1059970242 | 3300005764 | Tropical Forest Soil | LTGARHVVVVDDEPNIGRSLRLILEGEGYRVTVCESAAKLQAERRRTR |
Ga0068862_1012694392 | 3300005844 | Switchgrass Rhizosphere | MIRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSLAA |
Ga0097621_1002383162 | 3300006237 | Miscanthus Rhizosphere | MTRKRHIVIVDDEPNIGLSLRLILEGEGYRVSICES |
Ga0075430_1016863952 | 3300006846 | Populus Rhizosphere | MTRKPHVVVVDDEPNIGLSLRLILEGEGYTVSICDSVARFQARRAT |
Ga0075430_1017350822 | 3300006846 | Populus Rhizosphere | MRKQRITVVDDEPNIGLSLRLILEGEGYGVTICGSVADFQAQRSPG |
Ga0075431_1002119603 | 3300006847 | Populus Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSIAAF |
Ga0079217_104329141 | 3300006876 | Agricultural Soil | MPRAQHILVVDDEANIGLSLRLILEGEGYRVTLCTSI |
Ga0068865_1004469591 | 3300006881 | Miscanthus Rhizosphere | VTRLRHVVVVDDEPNIGRSLRLILEGAGYRVTVCESA |
Ga0079215_108017782 | 3300006894 | Agricultural Soil | MTRKHRITIVDDEPNIGKSLRLILEGEGHAVTICGSVAEFQAQRSPGRAD |
Ga0075419_104904081 | 3300006969 | Populus Rhizosphere | MKRKHRIVIVDDEPNIGSSLRLILEGEGYGVTICSSVAEFQPHRAPGRADL |
Ga0079218_118141362 | 3300007004 | Agricultural Soil | VTPRTRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESAA* |
Ga0079218_124360622 | 3300007004 | Agricultural Soil | MTRRHHIVVLDDEPNIGLSLRLILEGAGYRATVCDSAAGFR |
Ga0105095_102344671 | 3300009053 | Freshwater Sediment | MTRTPHITVVDDEPNIGRSLRLILEGEGYRVTTCDS |
Ga0105106_102000331 | 3300009078 | Freshwater Sediment | MTRTPHITVVDDEPNIGRSLRLILEGEGYRVTTCDSAQSFE |
Ga0111539_106626681 | 3300009094 | Populus Rhizosphere | VGIVTRRRHIMILDDEPNIGLSLRMILEGEGYRVTIC |
Ga0111539_112603911 | 3300009094 | Populus Rhizosphere | MTRKPHIVIVDDEANIGRSLRLILEGEGYRVSVYDTVATFVADRHRA |
Ga0114129_116707001 | 3300009147 | Populus Rhizosphere | MKRKHRIVIVDDEPNIGSSLRLILEGEGYGVTVCSSIA |
Ga0114942_13723861 | 3300009527 | Groundwater | MVRKRHITVVDDEANIGLSLRLILEGAGYAVTVCD |
Ga0126305_106971431 | 3300010036 | Serpentine Soil | MIRRPHIVIVDDEPNIGRSLRLILEGDGCRVSVFESTSAFLAERSRAV |
Ga0134124_117133151 | 3300010397 | Terrestrial Soil | MTRGRHVIVVDDEPNIGRSLRLILEGEGYRVTICDSAARF |
Ga0134127_130100271 | 3300010399 | Terrestrial Soil | MSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICES |
Ga0137427_103462411 | 3300011445 | Soil | MKRKHRIVVVDDEPNIGSSLRLILEGEGYGVTVCGSVAE |
Ga0150985_1000067211 | 3300012212 | Avena Fatua Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGHRVSVFDSASAFAAERK |
Ga0157294_100195782 | 3300012892 | Soil | MRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESAAQFHAERR |
Ga0157286_102622672 | 3300012908 | Soil | MTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICDSVSRF |
Ga0137410_100780061 | 3300012944 | Vadose Zone Soil | MTRKPHIVIVDDEANIGRSLRLILEGEGYRVSVFDSVG |
Ga0157378_114136261 | 3300013297 | Miscanthus Rhizosphere | MKRKHRIVIVDDEPNIGSSLRLILEGEGYRVSVFDSVAAFTADRNRAAADVY |
Ga0157376_117688831 | 3300014969 | Miscanthus Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFESATAFA |
Ga0173483_104899882 | 3300015077 | Soil | MTRKRHIVIVDDEPNIGRSLRLILEGEGYRVSVFESIAAS |
Ga0173480_100666373 | 3300015200 | Soil | MSRVRHILIVDDEPNIGSSLRLILEGAGYRATVCDSAARLNALKEV |
Ga0173480_107639061 | 3300015200 | Soil | MTRKPHIIILDDEPNIGLSLRLILEGEGYGVTICDSVERFHAQRGRSR |
Ga0173480_110935991 | 3300015200 | Soil | MTRKHRILVIDDEPNIGLSLRLILEGEGYGVVVADS |
Ga0132258_109431913 | 3300015371 | Arabidopsis Rhizosphere | MMRWRHVIVVDDEPNIGRSLRLILEGEGYRVTICDRAARFQFERQRGRADL |
Ga0132256_1025873631 | 3300015372 | Arabidopsis Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSAMAFAKERSR |
Ga0132257_1004510501 | 3300015373 | Arabidopsis Rhizosphere | MTRKRHIVVVDDEANIGRSLRLILEGEGYRVSVFETIAAFSADRN |
Ga0132257_1033045791 | 3300015373 | Arabidopsis Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSATAFANERSRAA |
Ga0132255_1013165652 | 3300015374 | Arabidopsis Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGHRVTVFDTAASFMAGRSR |
Ga0132255_1029897131 | 3300015374 | Arabidopsis Rhizosphere | VGIVTRRQQIMILDDEPNIGSSLRLILEGEGYRVTVCETAAQFQ |
Ga0184637_103633682 | 3300018063 | Groundwater Sediment | MTRKAHIIVVDDEPNIGLSLRLILEGEGYRVTICDSAARFQAQRAAGRADL |
Ga0184625_101783062 | 3300018081 | Groundwater Sediment | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSAR |
Ga0190265_127867221 | 3300018422 | Soil | MKHRHRIVVVDDEPNVGSSLRLILEGEGYAVTVCESVARFRAE |
Ga0190270_128380681 | 3300018469 | Soil | MTRRNRHIVILDDEPNIGLSLRLILEREGYRVTVCESVTAFHAERARG |
Ga0190274_100407561 | 3300018476 | Soil | VTRRHHIMILDDEPNIGSSLRLILEGEGYRVTVCD |
Ga0190274_129481911 | 3300018476 | Soil | LTRMRHIVVVNDNPNIGKSLRLFLEGEGYRVRVCESAAQFHAERRRGRADL |
Ga0173482_103442532 | 3300019361 | Soil | MILDDEPNIGSSLKLILEGEGFRVTVCESAAGFQA |
Ga0190264_116263062 | 3300019377 | Soil | MSRKPRITIVDDEPNIGLSLRLILEGEGYGVTLCRSFAEFQAERGAG |
Ga0247769_11814072 | 3300022904 | Plant Litter | MTRRYRITIVDDEPNIGLSLRLILEGEGYGVTICGSVAEFQAQRGPGRAD |
Ga0247798_10508432 | 3300023260 | Soil | MTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICESVARFNALRGLGP |
Ga0207688_109962992 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFD |
Ga0207680_104150081 | 3300025903 | Switchgrass Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFES |
Ga0207643_101086053 | 3300025908 | Miscanthus Rhizosphere | MSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESAARFTAQHGMGP |
Ga0207649_103249591 | 3300025920 | Corn Rhizosphere | MTRKRHIAIVDDEPNIGRSLRLILEGEGYRVSVFDS |
Ga0207681_109860022 | 3300025923 | Switchgrass Rhizosphere | MIRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDALAA |
Ga0207650_107328931 | 3300025925 | Switchgrass Rhizosphere | MSRVRHILIVDDEPNIGSSLRLILEGAGYRATVCDSAARLNALKE |
Ga0207659_102350661 | 3300025926 | Miscanthus Rhizosphere | MTRQIVIVDDEPNIGPSLELILKREGYAVSVCKSVKEFEKQFASGRATA |
Ga0207701_112819541 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MVHKRQIVVVDDEPNIGLSLRLILEGAGYAVTVCDSALQF |
Ga0207690_102739151 | 3300025932 | Corn Rhizosphere | VTRKPHVVVVDDEPNIGASLRLILEGEGYRVTVCDTAA |
Ga0207670_103131743 | 3300025936 | Switchgrass Rhizosphere | MPPSRHIVVVDDEPNIGLSLRLILEGEGYRVSICDSVAQFHAQR |
Ga0207670_112837581 | 3300025936 | Switchgrass Rhizosphere | MSRVRHILIVDDEPNIGSSLRLILEGAGYRATVCDSAARLNALREV |
Ga0207704_119803522 | 3300025938 | Miscanthus Rhizosphere | MTRKRHIVVVDDESNIGLSLRLILEGEGYRVSTCESA |
Ga0207679_108047921 | 3300025945 | Corn Rhizosphere | MSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESA |
Ga0207668_112640862 | 3300025972 | Switchgrass Rhizosphere | MTRRYRITIVDDEPNIGLSLRLILEGEGYGVTICGSVTEFQA |
Ga0207677_121109382 | 3300026023 | Miscanthus Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFESATAFAKERSRAAAD |
Ga0207678_100919731 | 3300026067 | Corn Rhizosphere | MTRKRHIVIVDDEPNIGLSLRLILEGEGYRISICESAAGFN |
Ga0207702_124114391 | 3300026078 | Corn Rhizosphere | MTSPRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSSAQFHLE |
Ga0207648_115559521 | 3300026089 | Miscanthus Rhizosphere | VTRMRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSAAQFHLERRRVRADL |
Ga0214469_10578981 | 3300027636 | Soil | MTRKRHIVIVDDEPNIGRSLRLILEGEGYLVTVFDSA |
Ga0207428_101388014 | 3300027907 | Populus Rhizosphere | MTRKPHIVIVDDEANIGRSLRLILEGEGYRVSVYDTVATFVADRHRAAADVY |
Ga0209382_105281761 | 3300027909 | Populus Rhizosphere | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSA |
Ga0268266_116696771 | 3300028379 | Switchgrass Rhizosphere | MKRRRRIVVVDDEANIGLSLRLILEGEGYTVDICASV |
Ga0268265_108858582 | 3300028380 | Switchgrass Rhizosphere | MTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICESVA |
Ga0247822_103275021 | 3300028592 | Soil | MTRKRHIVIVDDEANIGRSLRLILEGESYRVSVFDSVQAFAARLR |
Ga0307499_101895151 | 3300031184 | Soil | MTRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESV |
Ga0307500_101342002 | 3300031198 | Soil | MTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICESV |
Ga0307497_102368991 | 3300031226 | Soil | MTRTRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSVGSFTAGAHGAIADV |
Ga0310888_109291391 | 3300031538 | Soil | MTRRRHIMILDDEPNIGLSLRLILEGEGYRVTICDSAARFQAERE |
Ga0310886_107057392 | 3300031562 | Soil | MKRKHRIVIVDDEPNIGSSLRLILEGEGYGVIVCGSVAEF |
Ga0318515_104766651 | 3300031572 | Soil | MTRRRHVVVVDDEPNIGRSLRMILEGEGFRVTICESGAAF |
Ga0307468_1010419991 | 3300031740 | Hardwood Forest Soil | MTRKPHIVIVDDEPNIGSSLRLILEGEGYGVIVCGSVAEFQPHRAPG |
Ga0318492_104321991 | 3300031748 | Soil | MTRRRHVVVVDDEPNIGRSLRMILEGEGFRVTICESG |
Ga0310893_104534542 | 3300031892 | Soil | VKRMRHVVVVDDEPNIGRSLRLILEGEGHRVTVCESVAQLH |
Ga0310900_103139631 | 3300031908 | Soil | VTRMRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESA |
Ga0310891_103752721 | 3300031913 | Soil | MTRKPHIIILDDEPNIGLSLRLILEGEGYGVTICDSVERF |
Ga0310884_102690581 | 3300031944 | Soil | MTRKPHIVIVDDEPNIGRSLRLILEGEGYRVSVFDST |
Ga0310897_101124262 | 3300032003 | Soil | VTRTRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESA |
Ga0310902_103893332 | 3300032012 | Soil | VTRRQHIVILDDEPNIGSSLRLILEGEGFRVTVCDSVAEFQAERGGPRAD |
Ga0310906_105717042 | 3300032013 | Soil | MTRKRHIVVVDDEANIGLSLRLILEGEGYRVSICESAARFGAQ |
Ga0310899_104707931 | 3300032017 | Soil | MTRSRHIVIVDDEPNIGLSLRLILEGEGYRVSTCESAAKFHAQRAMGR |
Ga0310890_109701482 | 3300032075 | Soil | VTRTRHIVIVDDEPNIGRSLRLILEGERHRVTVCESVAKFHVERRRSR |
Ga0310895_101759221 | 3300032122 | Soil | VTRTRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESAARFHLVKRQARAD |
Ga0315910_111917322 | 3300032144 | Soil | VTRARHIVVVDDEPNIGRSLRLILEGEGYRVTVCDSVAQ |
Ga0315912_103254861 | 3300032157 | Soil | MTRKHRIFIVDDEPNIGASLRLILEGEGYGVVVADS |
Ga0310889_101486371 | 3300032179 | Soil | VTRTRHIVIVDDEPNIGRSLRLILEGEGHRVTVCESAAKFQAER |
Ga0310889_104949232 | 3300032179 | Soil | MTRSRHIVIVDDEPNIGLSLRLILEGEGYRVSTCESAAKFHAQRAMGRVD |
Ga0310896_105469662 | 3300032211 | Soil | MRARHVVVVDDEPNIGRSLRLTLEGEGYRVTVCESAAKFHL |
Ga0310896_108907321 | 3300032211 | Soil | MTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICDSVSRFNALRGLGP |
Ga0316624_105638751 | 3300033486 | Soil | MAGKRIIVVDDEKNIGVSLRLILEGVGYSVQVCRNAAEFRIE |
Ga0364945_0080435_1_105 | 3300034115 | Sediment | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFE |
Ga0364933_066282_2_136 | 3300034150 | Sediment | MTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFESATAFAKERS |
⦗Top⦘ |