NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F070244

Metagenome Family F070244

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070244
Family Type Metagenome
Number of Sequences 123
Average Sequence Length 43 residues
Representative Sequence MTRKRHIVIVDDEPNIGRSLRLILEGEGYRVSVCDSVA
Number of Associated Samples 108
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 68.29 %
% of genes near scaffold ends (potentially truncated) 98.37 %
% of genes from short scaffolds (< 2000 bps) 95.93 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(13.821 % of family members)
Environment Ontology (ENVO) Unclassified
(31.707 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.593 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.67%    β-sheet: 15.15%    Coil/Unstructured: 68.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF02518HATPase_c 93.50
PF00072Response_reg 1.63
PF01103Omp85 1.63
PF01594AI-2E_transport 0.81
PF00975Thioesterase 0.81
PF00158Sigma54_activat 0.81
PF00528BPD_transp_1 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_10731839All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300000890|JGI11643J12802_11851093All Organisms → cellular organisms → Bacteria1221Open in IMG/M
3300000891|JGI10214J12806_10021956All Organisms → cellular organisms → Bacteria707Open in IMG/M
3300001686|C688J18823_10459413All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300002128|JGI24036J26619_10096847All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300004114|Ga0062593_101550493All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus716Open in IMG/M
3300004156|Ga0062589_100223782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1383Open in IMG/M
3300004156|Ga0062589_100563375All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus978Open in IMG/M
3300004463|Ga0063356_104086140All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300005295|Ga0065707_11143273All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus506Open in IMG/M
3300005332|Ga0066388_102321481All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus971Open in IMG/M
3300005332|Ga0066388_106467436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus591Open in IMG/M
3300005340|Ga0070689_101385175All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus635Open in IMG/M
3300005344|Ga0070661_100037969All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus3505Open in IMG/M
3300005347|Ga0070668_101463757All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus624Open in IMG/M
3300005354|Ga0070675_102030593All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus530Open in IMG/M
3300005440|Ga0070705_101330630All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus596Open in IMG/M
3300005459|Ga0068867_100283248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1360Open in IMG/M
3300005459|Ga0068867_101663207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus598Open in IMG/M
3300005466|Ga0070685_11325474All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005577|Ga0068857_102525147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus504Open in IMG/M
3300005617|Ga0068859_101127898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus863Open in IMG/M
3300005618|Ga0068864_102212922All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus556Open in IMG/M
3300005764|Ga0066903_103799407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus811Open in IMG/M
3300005764|Ga0066903_105997024All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus637Open in IMG/M
3300005844|Ga0068862_101269439All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus737Open in IMG/M
3300006237|Ga0097621_100238316All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300006846|Ga0075430_101686395All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus520Open in IMG/M
3300006846|Ga0075430_101735082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus512Open in IMG/M
3300006847|Ga0075431_100211960All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1978Open in IMG/M
3300006876|Ga0079217_10432914All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300006881|Ga0068865_100446959All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300006894|Ga0079215_10801778All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus657Open in IMG/M
3300006969|Ga0075419_10490408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus852Open in IMG/M
3300007004|Ga0079218_11814136All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300007004|Ga0079218_12436062All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300009053|Ga0105095_10234467All Organisms → cellular organisms → Bacteria → Acidobacteria1006Open in IMG/M
3300009078|Ga0105106_10200033All Organisms → cellular organisms → Bacteria → Acidobacteria1458Open in IMG/M
3300009094|Ga0111539_10662668All Organisms → cellular organisms → Bacteria → Acidobacteria1215Open in IMG/M
3300009094|Ga0111539_11260391All Organisms → cellular organisms → Bacteria → Acidobacteria858Open in IMG/M
3300009147|Ga0114129_11670700All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300009527|Ga0114942_1372386All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300010036|Ga0126305_10697143All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300010397|Ga0134124_11713315All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300010399|Ga0134127_13010027All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300011445|Ga0137427_10346241All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300012212|Ga0150985_100006721All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300012892|Ga0157294_10019578All Organisms → cellular organisms → Bacteria → Acidobacteria1302Open in IMG/M
3300012908|Ga0157286_10262267All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300012944|Ga0137410_10078006All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2416Open in IMG/M
3300013297|Ga0157378_11413626All Organisms → cellular organisms → Bacteria → Acidobacteria739Open in IMG/M
3300014969|Ga0157376_11768883All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300015077|Ga0173483_10489988All Organisms → cellular organisms → Bacteria → Acidobacteria653Open in IMG/M
3300015200|Ga0173480_10066637All Organisms → cellular organisms → Bacteria → Acidobacteria1663Open in IMG/M
3300015200|Ga0173480_10763906All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300015200|Ga0173480_11093599All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300015371|Ga0132258_10943191All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2180Open in IMG/M
3300015372|Ga0132256_102587363All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300015373|Ga0132257_100451050All Organisms → cellular organisms → Bacteria → Acidobacteria1571Open in IMG/M
3300015373|Ga0132257_103304579All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300015374|Ga0132255_101316565All Organisms → cellular organisms → Bacteria → Acidobacteria1090Open in IMG/M
3300015374|Ga0132255_102989713All Organisms → cellular organisms → Bacteria → Acidobacteria722Open in IMG/M
3300018063|Ga0184637_10363368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300018081|Ga0184625_10178306All Organisms → cellular organisms → Bacteria → Acidobacteria1112Open in IMG/M
3300018422|Ga0190265_12786722All Organisms → cellular organisms → Bacteria → Acidobacteria584Open in IMG/M
3300018469|Ga0190270_12838068All Organisms → cellular organisms → Bacteria → Acidobacteria547Open in IMG/M
3300018476|Ga0190274_10040756All Organisms → cellular organisms → Bacteria → Acidobacteria3273Open in IMG/M
3300018476|Ga0190274_12948191All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300019361|Ga0173482_10344253All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300019377|Ga0190264_11626306All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300022904|Ga0247769_1181407All Organisms → cellular organisms → Bacteria → Acidobacteria526Open in IMG/M
3300023260|Ga0247798_1050843All Organisms → cellular organisms → Bacteria → Acidobacteria573Open in IMG/M
3300025901|Ga0207688_10996299All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300025903|Ga0207680_10415008All Organisms → cellular organisms → Bacteria → Acidobacteria953Open in IMG/M
3300025908|Ga0207643_10108605All Organisms → cellular organisms → Bacteria → Acidobacteria1632Open in IMG/M
3300025920|Ga0207649_10324959All Organisms → cellular organisms → Bacteria → Acidobacteria1131Open in IMG/M
3300025923|Ga0207681_10986002All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300025925|Ga0207650_10732893All Organisms → cellular organisms → Bacteria → Acidobacteria836Open in IMG/M
3300025926|Ga0207659_10235066All Organisms → cellular organisms → Bacteria → Acidobacteria1480Open in IMG/M
3300025930|Ga0207701_11281954All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300025932|Ga0207690_10273915All Organisms → cellular organisms → Bacteria → Acidobacteria1312Open in IMG/M
3300025936|Ga0207670_10313174All Organisms → cellular organisms → Bacteria1233Open in IMG/M
3300025936|Ga0207670_11283758All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300025938|Ga0207704_11980352All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300025945|Ga0207679_10804792All Organisms → cellular organisms → Bacteria → Acidobacteria857Open in IMG/M
3300025972|Ga0207668_11264086All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300026023|Ga0207677_12110938All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300026067|Ga0207678_10091973All Organisms → cellular organisms → Bacteria2593Open in IMG/M
3300026078|Ga0207702_12411439All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300026089|Ga0207648_11555952All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300027636|Ga0214469_1057898All Organisms → cellular organisms → Bacteria → Acidobacteria1193Open in IMG/M
3300027907|Ga0207428_10138801All Organisms → cellular organisms → Bacteria → Acidobacteria1857Open in IMG/M
3300027909|Ga0209382_10528176All Organisms → cellular organisms → Bacteria → Acidobacteria1295Open in IMG/M
3300028379|Ga0268266_11669677All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300028380|Ga0268265_10885858All Organisms → cellular organisms → Bacteria → Acidobacteria875Open in IMG/M
3300028592|Ga0247822_10327502All Organisms → cellular organisms → Bacteria → Acidobacteria1177Open in IMG/M
3300031184|Ga0307499_10189515All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300031198|Ga0307500_10134200All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300031226|Ga0307497_10236899All Organisms → cellular organisms → Bacteria → Acidobacteria809Open in IMG/M
3300031538|Ga0310888_10929139All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300031562|Ga0310886_10705739All Organisms → cellular organisms → Bacteria → Acidobacteria628Open in IMG/M
3300031572|Ga0318515_10476665All Organisms → cellular organisms → Bacteria → Acidobacteria667Open in IMG/M
3300031740|Ga0307468_101041999All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300031748|Ga0318492_10432199All Organisms → cellular organisms → Bacteria → Acidobacteria694Open in IMG/M
3300031892|Ga0310893_10453454All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300031908|Ga0310900_10313963All Organisms → cellular organisms → Bacteria → Acidobacteria1158Open in IMG/M
3300031913|Ga0310891_10375272All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300031944|Ga0310884_10269058All Organisms → cellular organisms → Bacteria → Acidobacteria938Open in IMG/M
3300032003|Ga0310897_10112426All Organisms → cellular organisms → Bacteria → Acidobacteria1099Open in IMG/M
3300032012|Ga0310902_10389333All Organisms → cellular organisms → Bacteria → Acidobacteria884Open in IMG/M
3300032013|Ga0310906_10571704All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300032017|Ga0310899_10470793All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300032075|Ga0310890_10970148All Organisms → cellular organisms → Bacteria → Acidobacteria682Open in IMG/M
3300032122|Ga0310895_10175922All Organisms → cellular organisms → Bacteria → Acidobacteria945Open in IMG/M
3300032144|Ga0315910_11191732All Organisms → cellular organisms → Bacteria → Acidobacteria595Open in IMG/M
3300032157|Ga0315912_10325486All Organisms → cellular organisms → Bacteria → Acidobacteria1213Open in IMG/M
3300032179|Ga0310889_10148637All Organisms → cellular organisms → Bacteria → Acidobacteria1047Open in IMG/M
3300032179|Ga0310889_10494923All Organisms → cellular organisms → Bacteria → Acidobacteria619Open in IMG/M
3300032211|Ga0310896_10546966All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300032211|Ga0310896_10890732All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300033486|Ga0316624_10563875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium985Open in IMG/M
3300034115|Ga0364945_0080435All Organisms → cellular organisms → Bacteria → Acidobacteria939Open in IMG/M
3300034150|Ga0364933_066282All Organisms → cellular organisms → Bacteria → Acidobacteria899Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil13.82%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.88%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.06%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.06%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.25%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.25%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.63%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.63%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.63%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.81%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.81%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.81%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009527Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold CreekEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300022904Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L166-409R-6EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027636Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeqEnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1073183913300000363SoilMTRKRHIVIVDDEPNIGRSLRLILEGEGYRVSVCDSVA
JGI11643J12802_1185109323300000890SoilMTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSTTAF
JGI10214J12806_1002195613300000891SoilMTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICDSVSRFNALRGLGPVDLYLL
C688J18823_1045941323300001686SoilMSRLRHILIVDDEPNIGSSLRLILEGAGHRVTVCESA
JGI24036J26619_1009684723300002128Corn, Switchgrass And Miscanthus RhizosphereMTRKRHIVIVDDEPNIGLSLRLILEGEGYRVSICESAA
Ga0062593_10155049323300004114SoilMTRQIVIVDDEPNIGPSLELILKREGYAVSVCKSVKEFEKQFS
Ga0062589_10022378213300004156SoilVSRMRHIVVVDDEPNIGRSLRLILEGEGYRVTVCESAARFHVERRKGRVD
Ga0062589_10056337513300004156SoilMSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESAARFTAQHGMGPVDL
Ga0063356_10408614013300004463Arabidopsis Thaliana RhizosphereMTRKPHVVIVDDEPNIGLSLRLILEGGGYTVSICESVARFQ
Ga0065707_1114327313300005295Switchgrass RhizosphereMTRKHHIVIVDDEPNIGRSLRLILEGEGHRVTVFDSAAAFTTGRNRA
Ga0066388_10232148113300005332Tropical Forest SoilMTRRPRIVIVDDEANIGASLRLILEGEGYGVTVCGSIAEFQAQ
Ga0066388_10646743613300005332Tropical Forest SoilMIRKPRIVVVDDEPNIGASLRLILEGEGCSVTVCESIAEFQAQRSP
Ga0070689_10138517513300005340Switchgrass RhizosphereVTRMRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSAAQFHVERRRVRA
Ga0070661_10003796943300005344Corn RhizosphereMTRKRHIVIVDDEPNIGLSLRLILEGEGYRVSICESAAGFNAQRAMG
Ga0070668_10146375723300005347Switchgrass RhizosphereMKRKHRIVIVDDEPNIGSSLRLILEGEGYGVTVCGSVAEFQPHRA
Ga0070675_10203059323300005354Miscanthus RhizosphereMTSRKRHIVILDDEPNIGLSLRLILEREGYRVTVCESVASFQAER
Ga0070705_10133063023300005440Corn, Switchgrass And Miscanthus RhizosphereMSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESAARFTAQHGMGPVD
Ga0068867_10028324813300005459Miscanthus RhizosphereVTRRHHVMILDDEPNIGSSLRLILEGEGFRVTVCDSAAEFQAE
Ga0068867_10166320713300005459Miscanthus RhizosphereVTRMRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSAAQFHLERRRVRA
Ga0070685_1132547413300005466Switchgrass RhizosphereMILDDEPNIGSSLRLILEGEGFRVTVCDSAAEFQAERGRARADLY
Ga0068857_10252514723300005577Corn RhizosphereMTRQIVIVDDEPNIGPSLELILKREGYAVSVCKSVKEFEKQFSSGRATAY
Ga0068859_10112789823300005617Switchgrass RhizosphereVTRMRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSAAQFHVERRRV
Ga0068864_10221292213300005618Switchgrass RhizosphereVTRVRHVMVVDDEPNIGRSLRLILEGAGYRVTVCDSVA
Ga0066903_10379940713300005764Tropical Forest SoilMYRKRHIVVVDDEANIGLSLRLILEGEGYRVTICDSAGAFARQRAAGGADLYL
Ga0066903_10599702423300005764Tropical Forest SoilLTGARHVVVVDDEPNIGRSLRLILEGEGYRVTVCESAAKLQAERRRTR
Ga0068862_10126943923300005844Switchgrass RhizosphereMIRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSLAA
Ga0097621_10023831623300006237Miscanthus RhizosphereMTRKRHIVIVDDEPNIGLSLRLILEGEGYRVSICES
Ga0075430_10168639523300006846Populus RhizosphereMTRKPHVVVVDDEPNIGLSLRLILEGEGYTVSICDSVARFQARRAT
Ga0075430_10173508223300006846Populus RhizosphereMRKQRITVVDDEPNIGLSLRLILEGEGYGVTICGSVADFQAQRSPG
Ga0075431_10021196033300006847Populus RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSIAAF
Ga0079217_1043291413300006876Agricultural SoilMPRAQHILVVDDEANIGLSLRLILEGEGYRVTLCTSI
Ga0068865_10044695913300006881Miscanthus RhizosphereVTRLRHVVVVDDEPNIGRSLRLILEGAGYRVTVCESA
Ga0079215_1080177823300006894Agricultural SoilMTRKHRITIVDDEPNIGKSLRLILEGEGHAVTICGSVAEFQAQRSPGRAD
Ga0075419_1049040813300006969Populus RhizosphereMKRKHRIVIVDDEPNIGSSLRLILEGEGYGVTICSSVAEFQPHRAPGRADL
Ga0079218_1181413623300007004Agricultural SoilVTPRTRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESAA*
Ga0079218_1243606223300007004Agricultural SoilMTRRHHIVVLDDEPNIGLSLRLILEGAGYRATVCDSAAGFR
Ga0105095_1023446713300009053Freshwater SedimentMTRTPHITVVDDEPNIGRSLRLILEGEGYRVTTCDS
Ga0105106_1020003313300009078Freshwater SedimentMTRTPHITVVDDEPNIGRSLRLILEGEGYRVTTCDSAQSFE
Ga0111539_1066266813300009094Populus RhizosphereVGIVTRRRHIMILDDEPNIGLSLRMILEGEGYRVTIC
Ga0111539_1126039113300009094Populus RhizosphereMTRKPHIVIVDDEANIGRSLRLILEGEGYRVSVYDTVATFVADRHRA
Ga0114129_1167070013300009147Populus RhizosphereMKRKHRIVIVDDEPNIGSSLRLILEGEGYGVTVCSSIA
Ga0114942_137238613300009527GroundwaterMVRKRHITVVDDEANIGLSLRLILEGAGYAVTVCD
Ga0126305_1069714313300010036Serpentine SoilMIRRPHIVIVDDEPNIGRSLRLILEGDGCRVSVFESTSAFLAERSRAV
Ga0134124_1171331513300010397Terrestrial SoilMTRGRHVIVVDDEPNIGRSLRLILEGEGYRVTICDSAARF
Ga0134127_1301002713300010399Terrestrial SoilMSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICES
Ga0137427_1034624113300011445SoilMKRKHRIVVVDDEPNIGSSLRLILEGEGYGVTVCGSVAE
Ga0150985_10000672113300012212Avena Fatua RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGHRVSVFDSASAFAAERK
Ga0157294_1001957823300012892SoilMRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESAAQFHAERR
Ga0157286_1026226723300012908SoilMTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICDSVSRF
Ga0137410_1007800613300012944Vadose Zone SoilMTRKPHIVIVDDEANIGRSLRLILEGEGYRVSVFDSVG
Ga0157378_1141362613300013297Miscanthus RhizosphereMKRKHRIVIVDDEPNIGSSLRLILEGEGYRVSVFDSVAAFTADRNRAAADVY
Ga0157376_1176888313300014969Miscanthus RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFESATAFA
Ga0173483_1048998823300015077SoilMTRKRHIVIVDDEPNIGRSLRLILEGEGYRVSVFESIAAS
Ga0173480_1006663733300015200SoilMSRVRHILIVDDEPNIGSSLRLILEGAGYRATVCDSAARLNALKEV
Ga0173480_1076390613300015200SoilMTRKPHIIILDDEPNIGLSLRLILEGEGYGVTICDSVERFHAQRGRSR
Ga0173480_1109359913300015200SoilMTRKHRILVIDDEPNIGLSLRLILEGEGYGVVVADS
Ga0132258_1094319133300015371Arabidopsis RhizosphereMMRWRHVIVVDDEPNIGRSLRLILEGEGYRVTICDRAARFQFERQRGRADL
Ga0132256_10258736313300015372Arabidopsis RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSAMAFAKERSR
Ga0132257_10045105013300015373Arabidopsis RhizosphereMTRKRHIVVVDDEANIGRSLRLILEGEGYRVSVFETIAAFSADRN
Ga0132257_10330457913300015373Arabidopsis RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSATAFANERSRAA
Ga0132255_10131656523300015374Arabidopsis RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGHRVTVFDTAASFMAGRSR
Ga0132255_10298971313300015374Arabidopsis RhizosphereVGIVTRRQQIMILDDEPNIGSSLRLILEGEGYRVTVCETAAQFQ
Ga0184637_1036336823300018063Groundwater SedimentMTRKAHIIVVDDEPNIGLSLRLILEGEGYRVTICDSAARFQAQRAAGRADL
Ga0184625_1017830623300018081Groundwater SedimentMTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSAR
Ga0190265_1278672213300018422SoilMKHRHRIVVVDDEPNVGSSLRLILEGEGYAVTVCESVARFRAE
Ga0190270_1283806813300018469SoilMTRRNRHIVILDDEPNIGLSLRLILEREGYRVTVCESVTAFHAERARG
Ga0190274_1004075613300018476SoilVTRRHHIMILDDEPNIGSSLRLILEGEGYRVTVCD
Ga0190274_1294819113300018476SoilLTRMRHIVVVNDNPNIGKSLRLFLEGEGYRVRVCESAAQFHAERRRGRADL
Ga0173482_1034425323300019361SoilMILDDEPNIGSSLKLILEGEGFRVTVCESAAGFQA
Ga0190264_1162630623300019377SoilMSRKPRITIVDDEPNIGLSLRLILEGEGYGVTLCRSFAEFQAERGAG
Ga0247769_118140723300022904Plant LitterMTRRYRITIVDDEPNIGLSLRLILEGEGYGVTICGSVAEFQAQRGPGRAD
Ga0247798_105084323300023260SoilMTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICESVARFNALRGLGP
Ga0207688_1099629923300025901Corn, Switchgrass And Miscanthus RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFD
Ga0207680_1041500813300025903Switchgrass RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFES
Ga0207643_1010860533300025908Miscanthus RhizosphereMSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESAARFTAQHGMGP
Ga0207649_1032495913300025920Corn RhizosphereMTRKRHIAIVDDEPNIGRSLRLILEGEGYRVSVFDS
Ga0207681_1098600223300025923Switchgrass RhizosphereMIRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDALAA
Ga0207650_1073289313300025925Switchgrass RhizosphereMSRVRHILIVDDEPNIGSSLRLILEGAGYRATVCDSAARLNALKE
Ga0207659_1023506613300025926Miscanthus RhizosphereMTRQIVIVDDEPNIGPSLELILKREGYAVSVCKSVKEFEKQFASGRATA
Ga0207701_1128195413300025930Corn, Switchgrass And Miscanthus RhizosphereMVHKRQIVVVDDEPNIGLSLRLILEGAGYAVTVCDSALQF
Ga0207690_1027391513300025932Corn RhizosphereVTRKPHVVVVDDEPNIGASLRLILEGEGYRVTVCDTAA
Ga0207670_1031317433300025936Switchgrass RhizosphereMPPSRHIVVVDDEPNIGLSLRLILEGEGYRVSICDSVAQFHAQR
Ga0207670_1128375813300025936Switchgrass RhizosphereMSRVRHILIVDDEPNIGSSLRLILEGAGYRATVCDSAARLNALREV
Ga0207704_1198035223300025938Miscanthus RhizosphereMTRKRHIVVVDDESNIGLSLRLILEGEGYRVSTCESA
Ga0207679_1080479213300025945Corn RhizosphereMSRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESA
Ga0207668_1126408623300025972Switchgrass RhizosphereMTRRYRITIVDDEPNIGLSLRLILEGEGYGVTICGSVTEFQA
Ga0207677_1211093823300026023Miscanthus RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFESATAFAKERSRAAAD
Ga0207678_1009197313300026067Corn RhizosphereMTRKRHIVIVDDEPNIGLSLRLILEGEGYRISICESAAGFN
Ga0207702_1241143913300026078Corn RhizosphereMTSPRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSSAQFHLE
Ga0207648_1155595213300026089Miscanthus RhizosphereVTRMRHVVVVDDEPNIGRSLRLILEGEGYRVTVCDSAAQFHLERRRVRADL
Ga0214469_105789813300027636SoilMTRKRHIVIVDDEPNIGRSLRLILEGEGYLVTVFDSA
Ga0207428_1013880143300027907Populus RhizosphereMTRKPHIVIVDDEANIGRSLRLILEGEGYRVSVYDTVATFVADRHRAAADVY
Ga0209382_1052817613300027909Populus RhizosphereMTRKRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSA
Ga0268266_1166967713300028379Switchgrass RhizosphereMKRRRRIVVVDDEANIGLSLRLILEGEGYTVDICASV
Ga0268265_1088585823300028380Switchgrass RhizosphereMTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICESVA
Ga0247822_1032750213300028592SoilMTRKRHIVIVDDEANIGRSLRLILEGESYRVSVFDSVQAFAARLR
Ga0307499_1018951513300031184SoilMTRKRHIVVVDDESNIGLSLRLILEGEGFRVSICESV
Ga0307500_1013420023300031198SoilMTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICESV
Ga0307497_1023689913300031226SoilMTRTRHIVIVDDEANIGRSLRLILEGEGYRVSVFDSVGSFTAGAHGAIADV
Ga0310888_1092913913300031538SoilMTRRRHIMILDDEPNIGLSLRLILEGEGYRVTICDSAARFQAERE
Ga0310886_1070573923300031562SoilMKRKHRIVIVDDEPNIGSSLRLILEGEGYGVIVCGSVAEF
Ga0318515_1047666513300031572SoilMTRRRHVVVVDDEPNIGRSLRMILEGEGFRVTICESGAAF
Ga0307468_10104199913300031740Hardwood Forest SoilMTRKPHIVIVDDEPNIGSSLRLILEGEGYGVIVCGSVAEFQPHRAPG
Ga0318492_1043219913300031748SoilMTRRRHVVVVDDEPNIGRSLRMILEGEGFRVTICESG
Ga0310893_1045345423300031892SoilVKRMRHVVVVDDEPNIGRSLRLILEGEGHRVTVCESVAQLH
Ga0310900_1031396313300031908SoilVTRMRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESA
Ga0310891_1037527213300031913SoilMTRKPHIIILDDEPNIGLSLRLILEGEGYGVTICDSVERF
Ga0310884_1026905813300031944SoilMTRKPHIVIVDDEPNIGRSLRLILEGEGYRVSVFDST
Ga0310897_1011242623300032003SoilVTRTRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESA
Ga0310902_1038933323300032012SoilVTRRQHIVILDDEPNIGSSLRLILEGEGFRVTVCDSVAEFQAERGGPRAD
Ga0310906_1057170423300032013SoilMTRKRHIVVVDDEANIGLSLRLILEGEGYRVSICESAARFGAQ
Ga0310899_1047079313300032017SoilMTRSRHIVIVDDEPNIGLSLRLILEGEGYRVSTCESAAKFHAQRAMGR
Ga0310890_1097014823300032075SoilVTRTRHIVIVDDEPNIGRSLRLILEGERHRVTVCESVAKFHVERRRSR
Ga0310895_1017592213300032122SoilVTRTRHIVVVDDEPNIGKSLRLILEGEGYRVTVCESAARFHLVKRQARAD
Ga0315910_1119173223300032144SoilVTRARHIVVVDDEPNIGRSLRLILEGEGYRVTVCDSVAQ
Ga0315912_1032548613300032157SoilMTRKHRIFIVDDEPNIGASLRLILEGEGYGVVVADS
Ga0310889_1014863713300032179SoilVTRTRHIVIVDDEPNIGRSLRLILEGEGHRVTVCESAAKFQAER
Ga0310889_1049492323300032179SoilMTRSRHIVIVDDEPNIGLSLRLILEGEGYRVSTCESAAKFHAQRAMGRVD
Ga0310896_1054696623300032211SoilMRARHVVVVDDEPNIGRSLRLTLEGEGYRVTVCESAAKFHL
Ga0310896_1089073213300032211SoilMTRKRHIVVVDDESNIGLSLRLILEGEGYRVSICDSVSRFNALRGLGP
Ga0316624_1056387513300033486SoilMAGKRIIVVDDEKNIGVSLRLILEGVGYSVQVCRNAAEFRIE
Ga0364945_0080435_1_1053300034115SedimentMTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFE
Ga0364933_066282_2_1363300034150SedimentMTRKRHIVIVDDEANIGRSLRLILEGEGYRVTVFESATAFAKERS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.