| Basic Information | |
|---|---|
| Family ID | F070209 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSKGFLWFAQNNDKTDYVELSITLAKSIKRWNKHNQVCVIT |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.19 % |
| % of genes near scaffold ends (potentially truncated) | 97.56 % |
| % of genes from short scaffolds (< 2000 bps) | 91.06 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.488 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (17.073 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.041 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.927 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00749 | tRNA-synt_1c | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.75 % |
| Unclassified | root | N/A | 3.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10245584 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300000179|LPjun09P16500mDRAFT_c1036142 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300001460|JGI24003J15210_10052230 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300001952|GOS2224_1021950 | All Organisms → Viruses → Predicted Viral | 1768 | Open in IMG/M |
| 3300001952|GOS2224_1042727 | All Organisms → Viruses → Predicted Viral | 1520 | Open in IMG/M |
| 3300001963|GOS2229_1032896 | All Organisms → Viruses → Predicted Viral | 1606 | Open in IMG/M |
| 3300005431|Ga0066854_10232130 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005931|Ga0075119_1129279 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006325|Ga0068501_1004532 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300006737|Ga0098037_1170608 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006793|Ga0098055_1131575 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300006868|Ga0075481_10359754 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006869|Ga0075477_10377585 | Not Available | 554 | Open in IMG/M |
| 3300006919|Ga0070746_10130472 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300006919|Ga0070746_10245096 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300006925|Ga0098050_1096828 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300007234|Ga0075460_10213410 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300007542|Ga0099846_1299408 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300007960|Ga0099850_1128530 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300009124|Ga0118687_10239737 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300009152|Ga0114980_10218196 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1119 | Open in IMG/M |
| 3300009161|Ga0114966_10679712 | Not Available | 566 | Open in IMG/M |
| 3300009193|Ga0115551_1421637 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300009438|Ga0115559_1073287 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
| 3300009438|Ga0115559_1244882 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300009440|Ga0115561_1297744 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009449|Ga0115558_1270059 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009469|Ga0127401_1186859 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009476|Ga0115555_1067208 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300009495|Ga0115571_1250050 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300009508|Ga0115567_10440333 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300009705|Ga0115000_10102725 | All Organisms → Viruses → Predicted Viral | 1924 | Open in IMG/M |
| 3300010297|Ga0129345_1326849 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010300|Ga0129351_1337107 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010318|Ga0136656_1244771 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300010368|Ga0129324_10103500 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
| 3300010883|Ga0133547_11968359 | All Organisms → Viruses → Predicted Viral | 1072 | Open in IMG/M |
| 3300012919|Ga0160422_10032655 | All Organisms → cellular organisms → Bacteria | 3014 | Open in IMG/M |
| 3300012928|Ga0163110_11777810 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300012953|Ga0163179_11225672 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300013010|Ga0129327_10714311 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300013087|Ga0163212_1198797 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 627 | Open in IMG/M |
| 3300016747|Ga0182078_10737475 | All Organisms → Viruses → Predicted Viral | 2944 | Open in IMG/M |
| 3300017725|Ga0181398_1104367 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300017728|Ga0181419_1064666 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300017737|Ga0187218_1106452 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300017746|Ga0181389_1094544 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300017759|Ga0181414_1115854 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300017768|Ga0187220_1064237 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300017771|Ga0181425_1014354 | All Organisms → Viruses → Predicted Viral | 2642 | Open in IMG/M |
| 3300017771|Ga0181425_1040414 | All Organisms → Viruses → Predicted Viral | 1528 | Open in IMG/M |
| 3300017949|Ga0181584_10544899 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300017957|Ga0181571_10449075 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300017958|Ga0181582_10486893 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300017969|Ga0181585_10998111 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300018039|Ga0181579_10136591 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300018039|Ga0181579_10439752 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300018049|Ga0181572_10123295 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300018410|Ga0181561_10320076 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300018420|Ga0181563_10768129 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300019784|Ga0181359_1266641 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 511 | Open in IMG/M |
| 3300020055|Ga0181575_10162111 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300020055|Ga0181575_10453253 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300020165|Ga0206125_10263068 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300020175|Ga0206124_10334106 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300020189|Ga0181578_10139752 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300020189|Ga0181578_10216404 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300020343|Ga0211626_1139086 | Not Available | 550 | Open in IMG/M |
| 3300020377|Ga0211647_10107814 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300020388|Ga0211678_10288713 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300020399|Ga0211623_10253583 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300020417|Ga0211528_10037203 | All Organisms → cellular organisms → Bacteria | 2224 | Open in IMG/M |
| 3300020419|Ga0211512_10220151 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300020420|Ga0211580_10183371 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300020421|Ga0211653_10271226 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300020438|Ga0211576_10630299 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300020440|Ga0211518_10231529 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300020448|Ga0211638_10246906 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300020474|Ga0211547_10318795 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300021347|Ga0213862_10212033 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300021364|Ga0213859_10461290 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 556 | Open in IMG/M |
| 3300021959|Ga0222716_10754146 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300021964|Ga0222719_10155235 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
| 3300022929|Ga0255752_10119262 | All Organisms → Viruses → Predicted Viral | 1383 | Open in IMG/M |
| 3300022935|Ga0255780_10144006 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300022935|Ga0255780_10206090 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
| 3300022937|Ga0255770_10112166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1526 | Open in IMG/M |
| 3300023116|Ga0255751_10451546 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300023170|Ga0255761_10308655 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300025102|Ga0208666_1110509 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300025632|Ga0209194_1067963 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300025676|Ga0209657_1022174 | All Organisms → Viruses → Predicted Viral | 2624 | Open in IMG/M |
| 3300025680|Ga0209306_1209597 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300025685|Ga0209095_1024239 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
| 3300025816|Ga0209193_1073280 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300025818|Ga0208542_1094675 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300025818|Ga0208542_1165307 | Not Available | 593 | Open in IMG/M |
| 3300025876|Ga0209223_10043295 | All Organisms → Viruses → Predicted Viral | 2807 | Open in IMG/M |
| 3300025894|Ga0209335_10359599 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300025897|Ga0209425_10203558 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
| 3300026183|Ga0209932_1142888 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300026258|Ga0208130_1202579 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300027499|Ga0208788_1040893 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300027672|Ga0209383_1082329 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
| 3300027782|Ga0209500_10009823 | All Organisms → cellular organisms → Bacteria | 5945 | Open in IMG/M |
| 3300027830|Ga0209359_10378417 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300027830|Ga0209359_10583453 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027847|Ga0209402_10138957 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300027974|Ga0209299_1138258 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 927 | Open in IMG/M |
| 3300028115|Ga0233450_10242113 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300028197|Ga0257110_1282677 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300028418|Ga0228615_1039604 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300029448|Ga0183755_1063031 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300031519|Ga0307488_10142394 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300031596|Ga0302134_10013253 | All Organisms → cellular organisms → Bacteria | 3888 | Open in IMG/M |
| 3300031621|Ga0302114_10241775 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300031626|Ga0302121_10011160 | All Organisms → cellular organisms → Bacteria | 3254 | Open in IMG/M |
| 3300031638|Ga0302125_10035833 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
| 3300031644|Ga0308001_10251168 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300031644|Ga0308001_10296579 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031700|Ga0302130_1009087 | All Organisms → cellular organisms → Bacteria | 3712 | Open in IMG/M |
| 3300031785|Ga0310343_10543931 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300032360|Ga0315334_10818368 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 17.07% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.82% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.38% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.32% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.50% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.06% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.25% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.25% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.44% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.44% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 1.63% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.63% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.81% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.81% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.81% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.81% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.81% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.81% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.81% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000179 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 500m | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001952 | Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300005431 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75 | Environmental | Open in IMG/M |
| 3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020343 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025676 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026258 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300028418 | Seawater microbial communities from Monterey Bay, California, United States - 16D | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031596 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCM | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300031638 | Marine microbial communities from Western Arctic Ocean, Canada - CB4_surface | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031700 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_surface | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_102455842 | 3300000117 | Marine | MSKGFLWFAQNNDKTDYVELSIRLAKSIKKHNSQNKI |
| LPjun09P16500mDRAFT_10361421 | 3300000179 | Marine | MSKGFLWFCQNTDKVDYVKCSIELAKSIKKYNKENKICVVTDKKFESEY |
| JGI24003J15210_100522301 | 3300001460 | Marine | MSKGFLWFAQNNDNTDYVELSIKLAETIKRHNRENKIC |
| GOS2224_10219504 | 3300001952 | Marine | MSRGFLWFAQNNSKTDYVELSITLAKSIKRWNRHNQ |
| GOS2224_10427271 | 3300001952 | Marine | MSKGFVWICQNNDKTDYVELSVALAKSIKRHNKDSAVCVITDSKT |
| GOS2229_10328962 | 3300001963 | Marine | MSRGFLWFAQNNDKTDYVELSITLAKSIKRWNIDNKVCVVT |
| Ga0066854_102321301 | 3300005431 | Marine | MFKGFLWFCQNTDKVDYVKCSIELAKSIKKFNKENNICVVTDEKSKF |
| Ga0075119_11292791 | 3300005931 | Saline Lake | MSKGFLWFAQNNDKTDYVELSITLAKSIKRWNKHN |
| Ga0068501_10045321 | 3300006325 | Marine | MNKGYMWFAQNNDKTDYIKLSVELAKSIKSHNKENLV |
| Ga0098037_11706081 | 3300006737 | Marine | MTKGFLWFAQNNANTDYVELSIKLARSIKKYNKHNKICVVTDKQSQFN |
| Ga0098055_11315753 | 3300006793 | Marine | MSKGFLWFAQNNDKTDYVEISIKLAESIKKHNSENKICVIT |
| Ga0075481_103597541 | 3300006868 | Aqueous | MSRGFLWFAQNNSKTDYVELSITLAESIKRCNKHNQ |
| Ga0075477_103775852 | 3300006869 | Aqueous | MSKGFLWFCQNNTKTDYVELSIELAKSIKKFNKENTVCVI |
| Ga0070746_101304723 | 3300006919 | Aqueous | MSKGFLWFAINNDKNDYMELSFNLAKSLKIFCQQNKVCVI |
| Ga0070746_102450961 | 3300006919 | Aqueous | MSKGFLWFAQNNDATDYVELSIKLAKSIKKHNKTNKI |
| Ga0098050_10968282 | 3300006925 | Marine | MSKGFLWFAQNNDKTDYVEMSIKLAESIKMHNSENK |
| Ga0075460_102134101 | 3300007234 | Aqueous | MSKGFLWFAQNNDKTDYVELSIRLAKSIKKHNSQNK |
| Ga0099846_12994081 | 3300007542 | Aqueous | MSKGFLLFAQNNSKTDYVGLSIKLAESIKRCNKDNSVC |
| Ga0099850_11285302 | 3300007960 | Aqueous | MSRGFLWFAQNNNTTDYVELSIRLAESIKEWNKVN* |
| Ga0118687_102397372 | 3300009124 | Sediment | MSKGFLWFAQNNSKTDYVELSITLAKSIKRWNKHNQVCVITDDKSK |
| Ga0114980_102181961 | 3300009152 | Freshwater Lake | MSKGFLWFAQNNSTTDYAKLSIELAKSIKKFNRDNNVCVIVDNNTD |
| Ga0114966_106797121 | 3300009161 | Freshwater Lake | MSRGFLWFAQNNTIDYARLSSELAKSIKTHNKENSI |
| Ga0115551_14216372 | 3300009193 | Pelagic Marine | MSKGFLWFCQNNNETDYVELSISLARSIKKFNKEN |
| Ga0115559_10732874 | 3300009438 | Pelagic Marine | MSRGFLWFAQNNDKTDYVELSITLAKSIKRWNKHNQICVITDEASKFEN |
| Ga0115559_12448821 | 3300009438 | Pelagic Marine | MSKGFLWICQNNNVTDYVELSVALAKSIKKFNKDNNVCV |
| Ga0115561_12977441 | 3300009440 | Pelagic Marine | MSKGFLWFAQNNDRTDYVELSITLAKSIKRLNKHNHI |
| Ga0115558_12700592 | 3300009449 | Pelagic Marine | MSKGFLWFAQNNDKTDYVELSITLAKSIKRWNKHNQVCVIT |
| Ga0127401_11868592 | 3300009469 | Meromictic Pond | MSKGFAWFCQNNKDVDYVPLSIALAKSIKKHNKTNKICVITDSASCFSSE |
| Ga0115555_10672084 | 3300009476 | Pelagic Marine | MSKGFLWFAQNNDNTDYVELSITLAKSIKRWNKHNQICVVT |
| Ga0115571_12500502 | 3300009495 | Pelagic Marine | MSKGFLWFAQNNDRTDYVELSITLAKSIKRLNKHNHICVVTDE |
| Ga0115567_104403331 | 3300009508 | Pelagic Marine | MSKGFLWFAQNNDRTDYVELSITLAKSIKRLNKHNHIC |
| Ga0115000_101027254 | 3300009705 | Marine | MSKGFLWFAQNNDKTDYVKLSITLAKSIKRWNKHNKVCVITDQASKF |
| Ga0129345_13268492 | 3300010297 | Freshwater To Marine Saline Gradient | MRKGFLWFAQNNDHTDYVELSTVLAKSIKRWNKDNQICVIT |
| Ga0129351_13371071 | 3300010300 | Freshwater To Marine Saline Gradient | MSRGFLWFAQNNPKTDYVRLSIKLAETIKKHNKIDKVCVITDEKSKF |
| Ga0136656_12447711 | 3300010318 | Freshwater To Marine Saline Gradient | MSKGFLWFAQNNSKTDYVELSIKLARSIKKWNRHNTICVVTDAKS |
| Ga0129324_101035003 | 3300010368 | Freshwater To Marine Saline Gradient | MRKGFLWFAQNNDHTDYVELSTVLAKSIKRWNKDNQICVITD |
| Ga0133547_119683591 | 3300010883 | Marine | MSKGFLWFAQNNDNTNYVELSVKLAESIKRHNRENKICVVTDE |
| Ga0160422_100326551 | 3300012919 | Seawater | MSNGFLWFAQNNDSTDYVDLSIKLAESIKKHNRQNKICVVTDKK |
| Ga0163110_117778101 | 3300012928 | Surface Seawater | MSKGYLWFAQNNDKTDYVKLSISLAESIKKVNKENKIC |
| Ga0163179_112256721 | 3300012953 | Seawater | MSKGFLWFAQNNDKTDYVELSIKLAESIKRHNREN |
| Ga0129327_107143111 | 3300013010 | Freshwater To Marine Saline Gradient | MSKGFLWFAQNNSKTDYVGLSIKLAESIKRWNKDN |
| Ga0163212_11987971 | 3300013087 | Freshwater | MSKGFLWFAQNNDSTDYAKLSVALARSIKKNCKIN |
| Ga0182078_107374755 | 3300016747 | Salt Marsh | MSKGFLWFAQNNDTTDYVELSIKLAESIKSFNSENKICVVTDE |
| Ga0181398_11043672 | 3300017725 | Seawater | MSKGFLWFAQNNSKTDYVELSINLAKSIKRWNKHNQVCVITDDQSKFESE |
| Ga0181419_10646661 | 3300017728 | Seawater | MSKGFLWFAQNNDTTDYVKCSIELAKSIKQHNKENAICVVTDEKSKFESE |
| Ga0187218_11064522 | 3300017737 | Seawater | MSKGFLWFAQNNDTTDYIKCSIALAESIKQHNKENAI |
| Ga0181389_10945442 | 3300017746 | Seawater | MTKGFLWFAQNNANTDYVELSIKLAESIKRWNRNNQVCVVTDEKSKFE |
| Ga0181414_11158542 | 3300017759 | Seawater | MSKGFLWFAQNNDTTDYVKCSIELAKSIKQHNKENAICVVTDEKSKFEN |
| Ga0187220_10642373 | 3300017768 | Seawater | MSKGFLWFAQNNDTTDYIKCSIALAKSIKQHNKENAICVV |
| Ga0181425_10143545 | 3300017771 | Seawater | MSKGFLWFAQNNDKTDYVELSIKLAESIKKYNKENKICVVTDE |
| Ga0181425_10404144 | 3300017771 | Seawater | MSKGFLWFAQNNDTTDYVKCSIELAKSIKQHNKENAICVVT |
| Ga0181584_105448991 | 3300017949 | Salt Marsh | MSKGFLWFAQNNDTTDYVGLSINLAESIKRWNRDNQICVV |
| Ga0181571_104490751 | 3300017957 | Salt Marsh | MSRGFLWFAQNNSKTDYVDLSITLAKSIKRWNKHNQV |
| Ga0181582_104868932 | 3300017958 | Salt Marsh | MSKGFLWFAQNNSKTDYVGLSIKLAESIKRWNKDNSV |
| Ga0181585_109981111 | 3300017969 | Salt Marsh | MSKGFVWFAQNNDKTDYTELSISLAKSIKKHNAQNKVCVITDENSKFQSEY |
| Ga0181579_101365914 | 3300018039 | Salt Marsh | MSNKGFLWFCQNNDNTDYVELSIALAESIKKHNKVNKVCVITDSKTKI |
| Ga0181579_104397521 | 3300018039 | Salt Marsh | MYRGFLWFAQNNDTTDYVELSIKLAESIKLWNKEN |
| Ga0181572_101232951 | 3300018049 | Salt Marsh | MSKGFVWFAQNNDKTDYTELSISLAKSIKKHNAQNKVCVITD |
| Ga0181561_103200762 | 3300018410 | Salt Marsh | MSRGFVWICQNNKNTDYVELSVSLAKSIKKHNRHNDICVITDK |
| Ga0181563_107681291 | 3300018420 | Salt Marsh | MSRGFLWFAQNNAQTDYVSMSIRLAESIKKKNRQNKVCVVTDERSKF |
| Ga0181359_12666411 | 3300019784 | Freshwater Lake | MSKGFLWFAQNNDTTDYAALSIALAKSIKKNCILF |
| Ga0181575_101621111 | 3300020055 | Salt Marsh | MSKGFLWFAQNNASTDYVELSIKLAESIKKHNRHNKICVVTD |
| Ga0181575_104532532 | 3300020055 | Salt Marsh | MSKGFVWFAQNNSKTDYVKLSITLAKSIKRWNKHNQVCVITDEKSKFE |
| Ga0206125_102630681 | 3300020165 | Seawater | MSKGFLWFAQNNSKTDYVELSITLAKSIKRWNKHNQVCVVTDEKSK |
| Ga0206124_103341062 | 3300020175 | Seawater | MSKGFLWFAQNNNKTDYTELSITLAKSIKRWNKHNQVCVIT |
| Ga0181578_101397521 | 3300020189 | Salt Marsh | MSRGFLWIAQNNSTTDYVELSLRLAESIKKHNKHNQICVI |
| Ga0181578_102164041 | 3300020189 | Salt Marsh | MSKGFLWFAQNNDTTDYVGLSIKLAESIKRWNKDNQICVVTDENSKFEHP |
| Ga0211626_11390861 | 3300020343 | Marine | MSKGFLWFAQNNDKTDYVKCSIELAKSIKKHNKENSICVITDEKSKFE |
| Ga0211647_101078141 | 3300020377 | Marine | MSKGFLWFAQNNSKTDYVELSIKLARSIKKWNRHN |
| Ga0211678_102887132 | 3300020388 | Marine | MSKGFLWFAQNNDKTDYVELSITLAKSIKRWNKHNKVCVITDEKSKFNSE |
| Ga0211623_102535831 | 3300020399 | Marine | MSKGFLWFCQNTDKVDYVKCSIELAKSIKKYNKENKIC |
| Ga0211528_100372032 | 3300020417 | Marine | MSDSRGFLWFAQNNAKTDYVELSIKLAESIKKHTKTQT |
| Ga0211512_102201512 | 3300020419 | Marine | MSKGFLWFAQNNDKTDYVELSIKLAESIKRHNRENKVCVITDEK |
| Ga0211580_101833712 | 3300020420 | Marine | MSKGFVWFCQNNDTTDYVKCSIELAKSIKKYNRNNNIC |
| Ga0211653_102712261 | 3300020421 | Marine | MSKGFLWFAQNNDTTDYVKCSIALAKSIKQHNKENA |
| Ga0211576_106302992 | 3300020438 | Marine | MSKGFLWFAQNNDTTDYVKCSIALAKSIKQHNKENAICV |
| Ga0211518_102315291 | 3300020440 | Marine | MSKGFLWFAQNNDTTDYVKCSIALAKSIKQHNKENAICVVTDEKS |
| Ga0211638_102469062 | 3300020448 | Marine | MSKGFLWFAQNNSKTDYVELSIKLAESIKKYNKEN |
| Ga0211547_103187952 | 3300020474 | Marine | MSKGFVWFAQNNSKTDYVELSINLAKSIKRWNRYNKVC |
| Ga0213862_102120331 | 3300021347 | Seawater | MSKGFLWFCQNNDKTDYAELSISLAKSIKKHNTENNICVITDAKTK |
| Ga0213859_104612902 | 3300021364 | Seawater | MSKGFLWFAQNNEKTDYAKLSIELAKSIKQHNNEN |
| Ga0222716_107541462 | 3300021959 | Estuarine Water | MSKGFVWFAQNNSKTDYVELSINLAKSIKRWNKHNQVCVVTDEKSK |
| Ga0222719_101552354 | 3300021964 | Estuarine Water | MSRGFLWFAQNNDSTDYVELSITLAKSIKRWNRDNKVCVVTDQSSEF |
| Ga0255752_101192624 | 3300022929 | Salt Marsh | MSRGFLWFAQNNDKTDYVELSITLAKSIKRWNKHNQVCVITDDKSKFES |
| Ga0255780_101440064 | 3300022935 | Salt Marsh | MSRGFLWFAQNNSKTDYVKLSITLAKSIKRWNKHNQVCV |
| Ga0255780_102060901 | 3300022935 | Salt Marsh | SRGFLWFAQNNAKTDYVELSISLAKSIKRWNKHNQVCVVTDEKQVS |
| Ga0255770_101121664 | 3300022937 | Salt Marsh | MYRGFLWFAQNNDTTDYVELSIKLAESIKLWNKENKI |
| Ga0255751_104515461 | 3300023116 | Salt Marsh | MSRGFLWFAQNNSKTDYVKLSITLAKSIKRWNKHNQVCVITDEKSKF |
| Ga0255761_103086551 | 3300023170 | Salt Marsh | MSKGFLWFAQNNDKTDYVELSITLAKSIKRWNRHNQICVITDEKSKFSSE |
| Ga0208666_11105092 | 3300025102 | Marine | MSKGFLWFAQNNAKTDYVALSIKLAQSIKTWNRENKVCVVTDENSK |
| Ga0209194_10679631 | 3300025632 | Pelagic Marine | MCMSLIRRYSMSRGFLWFAQNNDKTDYVELSITLAKSIKRWNKHNKICVITDE |
| Ga0209657_10221745 | 3300025676 | Marine | MSRGFLWFAQNNSKTDYVELSITLAKSIKCWNKHNQVCVI |
| Ga0209306_12095971 | 3300025680 | Pelagic Marine | MSKGFLWFAQNNDKTDYVELSITLAKSIKRWNKHNQVCVVTDEKSK |
| Ga0209095_10242395 | 3300025685 | Pelagic Marine | MSKGFLWFAQNNEKTDYVELSIKLAESIKKYNKENKICVVTDEKSKFE |
| Ga0209193_10732802 | 3300025816 | Pelagic Marine | MSKGFLWFAQNNDKVDYVELSITLAKSIKRWNKNNKV |
| Ga0208542_10946752 | 3300025818 | Aqueous | MSKGFLWFAQNNDTTDYVELSIRLAKSIKKWNRENKVCVIT |
| Ga0208542_11653072 | 3300025818 | Aqueous | MSKGFLWFCQNNTKTDYVELSIELAKSIKKFNKEN |
| Ga0209223_100432955 | 3300025876 | Pelagic Marine | MSKGFLWFAQNNENTDYVELSIKLAESIKKHNKENKICVVTDENSKFQH |
| Ga0209335_103595992 | 3300025894 | Pelagic Marine | MSKGFLWFCQNNDKTDYVELSIALAKSIKKQNTHNNVCVITD |
| Ga0209425_102035581 | 3300025897 | Pelagic Marine | MSKGFLWFAQNNDKTDYVELSITLAKSIKRWNKHNQVCVVTDEKS |
| Ga0209932_11428882 | 3300026183 | Pond Water | MYTCSTRMWPMSRGFLWFAQNNHSTDYVELSITLAKSIKRWNRHNQVCVITD |
| Ga0208130_12025793 | 3300026258 | Marine | MSKGFLWFAQNNDKTDYVDLSIKLAKTIKRWNKNNKI |
| Ga0208788_10408933 | 3300027499 | Deep Subsurface | MSKGFLWIAQNNKNTDYVKISVDLCKSIKKRCTINNVCLITDQ |
| Ga0209383_10823291 | 3300027672 | Marine | MSKGYLWFAQNNSKTDYVDISIKLAQSIKRTTRDNKIC |
| Ga0209500_100098238 | 3300027782 | Freshwater Lake | MSKGFLWFAQNNSTTDYAKLSIELAKSIKKFNRDNNVCVIVDN |
| Ga0209359_103784172 | 3300027830 | Marine | MSRGFLWFAQNNDKVDYVEISIKLAESIKKHNSENKICVITDEKSKF |
| Ga0209359_105834532 | 3300027830 | Marine | MSKGYLWFAQNNDKTDYVKLSISLAESIKKVNKENK |
| Ga0209402_101389571 | 3300027847 | Marine | MSKGFLWFAQNNDNTDYVELSIKLAETIKRHNRENKICVITDEKSNFQN |
| Ga0209299_11382581 | 3300027974 | Freshwater Lake | MSKGFLWFAQNNSTTDYAKLSIELAKSIKKFNRDNNVCVIV |
| Ga0233450_102421131 | 3300028115 | Salt Marsh | MSRGFLWFAQNNSKTDYVELSITLAESIKRCNKHNQVCV |
| Ga0257110_12826771 | 3300028197 | Marine | MSKGFLWFAQNNDTTDYVELSIRLAKSIKKWNREN |
| Ga0228615_10396044 | 3300028418 | Seawater | MSRGFLWFAQNNDKTDYVELSITLAKSIKRWNIHNQICVITD |
| Ga0183755_10630312 | 3300029448 | Marine | MSKGFLWFAQNNDNTDYVELSIKLAKSIKKHNKENTI |
| Ga0307488_101423941 | 3300031519 | Sackhole Brine | MSKGFLWFAQNNDKTDYVELSITLAKSIKRWNKNNQVCVV |
| Ga0302134_100132535 | 3300031596 | Marine | MSRGFLWFAQNNDTTDYVELSIELAKSIKHNSRNK |
| Ga0302114_102417751 | 3300031621 | Marine | MSKGFLWFAQNNSKTDYVDISIKLAQSIKRTTRDNKICVVTDEASEFE |
| Ga0302121_100111605 | 3300031626 | Marine | MSKGFLWFAQNNDKTDYVKLSITLAKSIKRWNKYNKVCVITD |
| Ga0302125_100358331 | 3300031638 | Marine | MSKGFLWFAQNNDKTDYVKLSITLAKSIKRWNKHNKVCVITDQ |
| Ga0308001_102511681 | 3300031644 | Marine | MSKGFLWFAQNNDSTDYVELSIKLAKSIKRHNRENKI |
| Ga0308001_102965791 | 3300031644 | Marine | MYKGFLWFAQNNDNTDYVGLSVKLAESIKRHNRENKICVVTDEKSKFE |
| Ga0302130_10090875 | 3300031700 | Marine | MSKGFLWFAQNNDKTDYVKLSITLAKSIKRWNKYNKVCVITDQASKF |
| Ga0310343_105439312 | 3300031785 | Seawater | MSKGFLWFAQNNDKTDYVDLSIKLAKSIKRYNKDS |
| Ga0315334_108183682 | 3300032360 | Seawater | MSKGFLWFCQNTDKVDYVKCSIELAKSIKKYNKDKICVVTDKKF |
| ⦗Top⦘ |