Basic Information | |
---|---|
Family ID | F070181 |
Family Type | Metagenome |
Number of Sequences | 123 |
Average Sequence Length | 51 residues |
Representative Sequence | KLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.32 % |
% of genes near scaffold ends (potentially truncated) | 87.80 % |
% of genes from short scaffolds (< 2000 bps) | 92.68 % |
Associated GOLD sequencing projects | 99 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.187 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (20.325 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.829 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.033 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.53% β-sheet: 0.00% Coil/Unstructured: 64.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF00378 | ECH_1 | 27.64 |
PF13847 | Methyltransf_31 | 4.07 |
PF02776 | TPP_enzyme_N | 4.07 |
PF04909 | Amidohydro_2 | 2.44 |
PF12847 | Methyltransf_18 | 1.63 |
PF13472 | Lipase_GDSL_2 | 1.63 |
PF09084 | NMT1 | 1.63 |
PF13343 | SBP_bac_6 | 0.81 |
PF07883 | Cupin_2 | 0.81 |
PF12172 | DUF35_N | 0.81 |
PF08123 | DOT1 | 0.81 |
PF13649 | Methyltransf_25 | 0.81 |
PF03070 | TENA_THI-4 | 0.81 |
PF13607 | Succ_CoA_lig | 0.81 |
PF13416 | SBP_bac_8 | 0.81 |
PF06052 | 3-HAO | 0.81 |
PF02910 | Succ_DH_flav_C | 0.81 |
PF13379 | NMT1_2 | 0.81 |
PF07331 | TctB | 0.81 |
PF01541 | GIY-YIG | 0.81 |
PF00072 | Response_reg | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.63 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.63 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.19 % |
Unclassified | root | N/A | 0.81 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664021|ICCgaii200_c0253904 | Not Available | 516 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10021437 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1545 | Open in IMG/M |
3300002075|JGI24738J21930_10079745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 684 | Open in IMG/M |
3300003987|Ga0055471_10196324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
3300003993|Ga0055468_10032535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1231 | Open in IMG/M |
3300004114|Ga0062593_101068796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 834 | Open in IMG/M |
3300004782|Ga0062382_10333940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
3300005289|Ga0065704_10269999 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 945 | Open in IMG/M |
3300005294|Ga0065705_10887455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
3300005330|Ga0070690_100291303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1167 | Open in IMG/M |
3300005439|Ga0070711_101060446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 697 | Open in IMG/M |
3300005445|Ga0070708_100586640 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300005447|Ga0066689_10936154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
3300005450|Ga0066682_10801470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 569 | Open in IMG/M |
3300005457|Ga0070662_101292709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 628 | Open in IMG/M |
3300005458|Ga0070681_10903662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 801 | Open in IMG/M |
3300005526|Ga0073909_10013966 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
3300005713|Ga0066905_101715158 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 577 | Open in IMG/M |
3300005718|Ga0068866_11000432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 594 | Open in IMG/M |
3300005830|Ga0074473_11233136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 805 | Open in IMG/M |
3300006358|Ga0068871_100819087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 859 | Open in IMG/M |
3300006755|Ga0079222_11319617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 659 | Open in IMG/M |
3300006845|Ga0075421_100407082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1632 | Open in IMG/M |
3300006847|Ga0075431_100026687 | All Organisms → cellular organisms → Bacteria | 5924 | Open in IMG/M |
3300006847|Ga0075431_101397203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
3300006847|Ga0075431_101550740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
3300006852|Ga0075433_10451626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1133 | Open in IMG/M |
3300006852|Ga0075433_10505615 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300006854|Ga0075425_100435832 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300006854|Ga0075425_102311595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
3300006880|Ga0075429_100221683 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
3300006880|Ga0075429_100969593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 743 | Open in IMG/M |
3300006880|Ga0075429_101970071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
3300006914|Ga0075436_100658758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 774 | Open in IMG/M |
3300006969|Ga0075419_10375233 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300006969|Ga0075419_10906235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 636 | Open in IMG/M |
3300006969|Ga0075419_11456081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
3300007076|Ga0075435_100545521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1004 | Open in IMG/M |
3300009012|Ga0066710_102998565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 657 | Open in IMG/M |
3300009094|Ga0111539_11776783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 715 | Open in IMG/M |
3300009147|Ga0114129_10202964 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
3300009147|Ga0114129_10856663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1155 | Open in IMG/M |
3300009147|Ga0114129_12203955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 663 | Open in IMG/M |
3300009156|Ga0111538_13870224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 518 | Open in IMG/M |
3300009157|Ga0105092_10288504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 925 | Open in IMG/M |
3300009162|Ga0075423_10687403 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300009553|Ga0105249_12774118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
3300009811|Ga0105084_1085868 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 584 | Open in IMG/M |
3300009821|Ga0105064_1084678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
3300010046|Ga0126384_11267986 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 682 | Open in IMG/M |
3300010047|Ga0126382_10126392 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1707 | Open in IMG/M |
3300010366|Ga0126379_12266351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 644 | Open in IMG/M |
3300010399|Ga0134127_13157103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 538 | Open in IMG/M |
3300011427|Ga0137448_1180669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 585 | Open in IMG/M |
3300011436|Ga0137458_1020953 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
3300011445|Ga0137427_10064817 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1451 | Open in IMG/M |
3300012038|Ga0137431_1017148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1977 | Open in IMG/M |
3300012039|Ga0137421_1053403 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1102 | Open in IMG/M |
3300012212|Ga0150985_121916527 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300012361|Ga0137360_10379615 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
3300012929|Ga0137404_10368802 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1260 | Open in IMG/M |
3300012948|Ga0126375_10093937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1756 | Open in IMG/M |
3300012948|Ga0126375_10151990 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1461 | Open in IMG/M |
3300012961|Ga0164302_11734035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
3300013297|Ga0157378_11246880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 784 | Open in IMG/M |
3300013306|Ga0163162_11659842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 729 | Open in IMG/M |
3300013306|Ga0163162_13313767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 515 | Open in IMG/M |
3300014267|Ga0075313_1122292 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 654 | Open in IMG/M |
3300014270|Ga0075325_1145794 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 596 | Open in IMG/M |
3300014326|Ga0157380_11540876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 719 | Open in IMG/M |
3300014745|Ga0157377_10789881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 699 | Open in IMG/M |
3300014864|Ga0180068_1079297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
3300014865|Ga0180078_1030037 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 856 | Open in IMG/M |
3300014865|Ga0180078_1071454 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 598 | Open in IMG/M |
3300014968|Ga0157379_11478683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 660 | Open in IMG/M |
3300014969|Ga0157376_10903125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 901 | Open in IMG/M |
3300015372|Ga0132256_103662049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300015373|Ga0132257_101184509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 967 | Open in IMG/M |
3300015374|Ga0132255_100161095 | All Organisms → cellular organisms → Bacteria | 3140 | Open in IMG/M |
3300016294|Ga0182041_10598864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 968 | Open in IMG/M |
3300016404|Ga0182037_10820917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 803 | Open in IMG/M |
3300018073|Ga0184624_10118545 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 1145 | Open in IMG/M |
3300018073|Ga0184624_10218561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 852 | Open in IMG/M |
3300018073|Ga0184624_10372032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 638 | Open in IMG/M |
3300018422|Ga0190265_12518394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 613 | Open in IMG/M |
3300018422|Ga0190265_12560974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 608 | Open in IMG/M |
3300018429|Ga0190272_10483329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1045 | Open in IMG/M |
3300018476|Ga0190274_13792602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 511 | Open in IMG/M |
3300019886|Ga0193727_1026578 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
3300020060|Ga0193717_1053010 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300021081|Ga0210379_10030944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2071 | Open in IMG/M |
3300022756|Ga0222622_11357471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
3300023064|Ga0247801_1076405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
3300025558|Ga0210139_1122489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300025567|Ga0210076_1032432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1120 | Open in IMG/M |
3300025903|Ga0207680_10561454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 815 | Open in IMG/M |
3300025915|Ga0207693_11456609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 506 | Open in IMG/M |
3300025916|Ga0207663_10875182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 718 | Open in IMG/M |
3300025916|Ga0207663_11709924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300025931|Ga0207644_10132757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1908 | Open in IMG/M |
3300025939|Ga0207665_11437816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 549 | Open in IMG/M |
3300025972|Ga0207668_11523095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 604 | Open in IMG/M |
3300026557|Ga0179587_10498367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 799 | Open in IMG/M |
3300027006|Ga0209896_1011507 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 958 | Open in IMG/M |
3300027163|Ga0209878_1017992 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 957 | Open in IMG/M |
3300027462|Ga0210000_1018716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1053 | Open in IMG/M |
3300027548|Ga0209523_1026927 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
3300027617|Ga0210002_1010422 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
3300027665|Ga0209983_1025806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1241 | Open in IMG/M |
3300027722|Ga0209819_10107384 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 975 | Open in IMG/M |
3300027787|Ga0209074_10237747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 702 | Open in IMG/M |
3300027880|Ga0209481_10039771 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
3300027909|Ga0209382_10242137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2052 | Open in IMG/M |
3300027909|Ga0209382_11935569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 568 | Open in IMG/M |
(restricted) 3300031150|Ga0255311_1107463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
3300031820|Ga0307473_10099276 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
3300031890|Ga0306925_11368314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 700 | Open in IMG/M |
3300031954|Ga0306926_10125041 | All Organisms → cellular organisms → Bacteria | 3174 | Open in IMG/M |
3300032126|Ga0307415_100179859 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
3300032205|Ga0307472_101418723 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300033004|Ga0335084_11700546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 620 | Open in IMG/M |
3300033433|Ga0326726_10699705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 978 | Open in IMG/M |
3300034147|Ga0364925_0289500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 612 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 20.33% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.69% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.06% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.25% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.44% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.44% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.44% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.44% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.63% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.63% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.63% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.63% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.81% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.81% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.81% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011427 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014864 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10D | Environmental | Open in IMG/M |
3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICCgaii200_02539041 | 2228664021 | Soil | WKEYPFKREYPERGMTSAEYEKAEDRWTQLTRGITKR |
AF_2010_repII_A001DRAFT_100214371 | 3300000793 | Forest Soil | VAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRATTQR* |
JGI24738J21930_100797452 | 3300002075 | Corn Rhizosphere | YPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR* |
Ga0055471_101963241 | 3300003987 | Natural And Restored Wetlands | EGQKLMEQFRYGVAWKEYPFKREYPERGMSSAEYEDAEDKWLQLTRSITKK* |
Ga0055468_100325352 | 3300003993 | Natural And Restored Wetlands | MERFCYGVAWKDYPFKREYPERGMTSSEYENAEDKWLQLTRSITKRQN* |
Ga0062593_1010687961 | 3300004114 | Soil | VAWKDYSFKREYPERGMTSAEYEKAEDRWAQLTRAITKR* |
Ga0062382_103339401 | 3300004782 | Wetland Sediment | EQFRYGVAWKEYSFKREYPERGMTSVEYEKAEDKWMQATRALTKR* |
Ga0065704_102699991 | 3300005289 | Switchgrass Rhizosphere | HAALLLTDFVIGADGQKLMEQFRYGVAWKQYPFKREYPERGMTAAQYQDAEEKWSQLLRSITHR* |
Ga0065705_108874551 | 3300005294 | Switchgrass Rhizosphere | AEGQKIMEQFRYGIAWKEYPFKREYPERGVTTAQYQDAEEKWSQLLRSITQR* |
Ga0070690_1002913032 | 3300005330 | Switchgrass Rhizosphere | FRYGVAWKDYPFKREYPEQGMTSAEYEKAEDRWLQLTRAITKRQN* |
Ga0070711_1010604461 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | GQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR* |
Ga0070708_1005866402 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLTDFVIGAEGQKLMEQFRYGVAWKEYTFKREYPERGMTTSQYQDAEEKWSDLLRSITRR* |
Ga0066689_109361541 | 3300005447 | Soil | MEQYRYGVAWKEYPFKRDYPDRGMTSAEYEKAEDKWTQLVRSITRR* |
Ga0066682_108014702 | 3300005450 | Soil | MEQFRYGVAWRQYPFKREYPERGMTSAEYEKAEDKWLQLTRSITKRQN* |
Ga0070662_1012927092 | 3300005457 | Corn Rhizosphere | LLFTDFVIGADGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN* |
Ga0070681_109036622 | 3300005458 | Corn Rhizosphere | DGQKLMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQN* |
Ga0073909_100139661 | 3300005526 | Surface Soil | KLMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGGDRF* |
Ga0066905_1017151581 | 3300005713 | Tropical Forest Soil | MEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRATTQR* |
Ga0068866_110004322 | 3300005718 | Miscanthus Rhizosphere | VIGADGQKLMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQGGDRF* |
Ga0074473_112331362 | 3300005830 | Sediment (Intertidal) | EYPFKREYPERGMTSVEYEKAEDRWTQLTRAITKR* |
Ga0068871_1008190872 | 3300006358 | Miscanthus Rhizosphere | LMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR* |
Ga0079222_113196172 | 3300006755 | Agricultural Soil | ALLFTDFVIGADGQKLMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKQQGTNRF* |
Ga0075421_1004070821 | 3300006845 | Populus Rhizosphere | MEQFRYGVAWKEYPFKREYIERGMSSAEYEHAEDKWLQLTRSISKK* |
Ga0075431_1000266871 | 3300006847 | Populus Rhizosphere | MEQFRYGVAWKEYPFKREYPERGMTSAEYENAEDKWLQLTRSISKK* |
Ga0075431_1013972031 | 3300006847 | Populus Rhizosphere | AALLFTDFVIGADGQKLMEQFRYGVAWRDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGDRF* |
Ga0075431_1015507401 | 3300006847 | Populus Rhizosphere | EQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR* |
Ga0075433_104516262 | 3300006852 | Populus Rhizosphere | FTDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKRQN* |
Ga0075433_105056151 | 3300006852 | Populus Rhizosphere | MEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR* |
Ga0075425_1004358321 | 3300006854 | Populus Rhizosphere | YGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR* |
Ga0075425_1023115951 | 3300006854 | Populus Rhizosphere | LMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR* |
Ga0075429_1002216833 | 3300006880 | Populus Rhizosphere | GAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR* |
Ga0075429_1009695932 | 3300006880 | Populus Rhizosphere | GVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR* |
Ga0075429_1019700712 | 3300006880 | Populus Rhizosphere | DFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN* |
Ga0075436_1006587581 | 3300006914 | Populus Rhizosphere | KDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN* |
Ga0075419_103752332 | 3300006969 | Populus Rhizosphere | LMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR* |
Ga0075419_109062352 | 3300006969 | Populus Rhizosphere | VIGADGQKLMEQFRYGVAWRDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGDRF* |
Ga0075419_114560811 | 3300006969 | Populus Rhizosphere | GAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR* |
Ga0075435_1005455212 | 3300007076 | Populus Rhizosphere | QKLMEQFRYGVAWKDYPFKRDYPERGMSSAEYEKAEDRWLQLTRAITKRPN* |
Ga0066710_1029985652 | 3300009012 | Grasslands Soil | MERVAWKEYPFKREYPERGMTTAQYQDAEEKWTQLLRSTTHR |
Ga0111539_117767832 | 3300009094 | Populus Rhizosphere | FTDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPEQGMTSAEYERAEDRWLQLTRAITKRQN* |
Ga0114129_102029641 | 3300009147 | Populus Rhizosphere | PHATLLLTDFVIGAEGQKLMEQFKYGVAWKEYPFKREYPERGITAAQYQDAEEKWSQLLRSITHR* |
Ga0114129_108566631 | 3300009147 | Populus Rhizosphere | DFVIGADGQKLMEQFRYGVAWKDYPFKRDYPERGMSSAEYEKAEDKWLQLTRSITKRQGGDRF* |
Ga0114129_122039551 | 3300009147 | Populus Rhizosphere | KLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR* |
Ga0111538_138702241 | 3300009156 | Populus Rhizosphere | LLTDFVIGAEGQKLMEQFRYGIAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR |
Ga0105092_102885042 | 3300009157 | Freshwater Sediment | VAWKEYPFKKEYPERGMSSAEYENAEDKWLQLTRSISKK* |
Ga0075423_106874031 | 3300009162 | Populus Rhizosphere | KLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR* |
Ga0105249_127741182 | 3300009553 | Switchgrass Rhizosphere | FTDFVIGADGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN* |
Ga0105084_10858681 | 3300009811 | Groundwater Sand | NAGGSAVIANAPHSHAALLLTDFVIGADGQKLMEQFKYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITRR* |
Ga0105064_10846781 | 3300009821 | Groundwater Sand | MEQFKYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITHR* |
Ga0126384_112679861 | 3300010046 | Tropical Forest Soil | FRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQSLRAVTQR* |
Ga0126382_101263921 | 3300010047 | Tropical Forest Soil | HAALLLTDFVIGAEGQKLMEQFQYGVAWKEYPFKREYPERSMTTAQYQDAEEKWSQLLRSTTQR* |
Ga0126379_122663511 | 3300010366 | Tropical Forest Soil | EQYRYGVAWKEYSFKREYPERGMTSSEYEKAEDKWTQLVRSMTRR* |
Ga0134127_131571032 | 3300010399 | Terrestrial Soil | FVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSADYETAEDKWLQLTRAITKRQN* |
Ga0137448_11806692 | 3300011427 | Soil | MEQFRYGVAWKEYPFKREYPERGMSSAEYEKAEDRWTQLTRAVTKR* |
Ga0137458_10209531 | 3300011436 | Soil | TDFVIGAEGQKLMEQFRYGVAWKEYAFKREYPERGMTSAEYEKAEDRWTQATRALTKR* |
Ga0137427_100648171 | 3300011445 | Soil | LMEQFKYGVAWKEHAFKREYPERGMTSAQYQDAEDKWSQLLRSSTQR* |
Ga0137431_10171483 | 3300012038 | Soil | EGQKLMEQFKYGVAWKEHAFKREYPERGMTSAQYQDAEDKWSQLLRSSTQR* |
Ga0137421_10534031 | 3300012039 | Soil | QFKYGVAWKEHAFKREYPERGMTSAQYQDAEDKWSQLLRSSTQR* |
Ga0150985_1219165271 | 3300012212 | Avena Fatua Rhizosphere | LLTEFILGAEGQKLMEQYRYGVAWKEYPFKREYPERGMTTSEYEKAEDRWTQLVRSITHR |
Ga0137360_103796153 | 3300012361 | Vadose Zone Soil | YPFKRDYPERGMTSAEYEKAEDKWTQLVRSITRR* |
Ga0137404_103688022 | 3300012929 | Vadose Zone Soil | FVTGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSTTHR* |
Ga0126375_100939371 | 3300012948 | Tropical Forest Soil | GVAWKEYPFKREYPERSMTTAQYQDAEEKWSQLLRSTTQR* |
Ga0126375_101519901 | 3300012948 | Tropical Forest Soil | TDFVIGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRATTQR* |
Ga0164302_117340351 | 3300012961 | Soil | QKLMEQFRYGIAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR* |
Ga0157378_112468802 | 3300013297 | Miscanthus Rhizosphere | DGQKLMEQFRYGVAWKDYPFKRDYPERGMTSTEYEKNEDKWLQLTRAITKRQGGDRF* |
Ga0163162_116598421 | 3300013306 | Switchgrass Rhizosphere | EQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQGGDRF* |
Ga0163162_133137671 | 3300013306 | Switchgrass Rhizosphere | EQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGDRF* |
Ga0075313_11222921 | 3300014267 | Natural And Restored Wetlands | LMEKFKYGVAWKEYPFKREYPERGMTSTQYQDAEDKWIQLLRSIAQRQ* |
Ga0075325_11457942 | 3300014270 | Natural And Restored Wetlands | FKYGVAWKEYPFKREYPERGMTSTQYQDAEDKWIQLLRSITQRQ* |
Ga0157380_115408761 | 3300014326 | Switchgrass Rhizosphere | AEGQKLMEQFRYGVAWKDYAFKREYPERGMTSAQYEAAEDKWMNLTRTVTKR* |
Ga0157377_107898811 | 3300014745 | Miscanthus Rhizosphere | GQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN* |
Ga0180068_10792972 | 3300014864 | Soil | MEQFRYGVAWKEYAFKREYPERGMTSVEYEKAVDRWTQLTRAVTKR* |
Ga0180078_10300371 | 3300014865 | Soil | KLMEQFKYGVAWKEHAFKREYPERGMTSAQYQDAEDKWSQLLRSSTQR* |
Ga0180078_10714541 | 3300014865 | Soil | FVIGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR* |
Ga0157379_114786831 | 3300014968 | Switchgrass Rhizosphere | MEQFRYGVAWKNYPFKREYPEQGMTSAQYEAAEDKWTQLSRALTKR* |
Ga0157376_109031252 | 3300014969 | Miscanthus Rhizosphere | FTDFVIGADGQKLMEQFRYGVAWKDYPFKREYPEQGMTSAEYEKAEDRWLQLTRAITKRQN* |
Ga0132256_1036620491 | 3300015372 | Arabidopsis Rhizosphere | LMEQFRYGVAWKDYPFKREYPEQGMTSAEYERAEDRWLQLTRAITKRQN* |
Ga0132257_1011845091 | 3300015373 | Arabidopsis Rhizosphere | KLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN* |
Ga0132255_1001610951 | 3300015374 | Arabidopsis Rhizosphere | RYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR* |
Ga0182041_105988641 | 3300016294 | Soil | EGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN |
Ga0182037_108209172 | 3300016404 | Soil | DFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN |
Ga0184624_101185451 | 3300018073 | Groundwater Sediment | FRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR |
Ga0184624_102185612 | 3300018073 | Groundwater Sediment | MEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRAITKRQGGGDRF |
Ga0184624_103720321 | 3300018073 | Groundwater Sediment | LMEQFRYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRTITKRQGGDRF |
Ga0190265_125183942 | 3300018422 | Soil | FTDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSTDYENAEDKWLQLTRSITKK |
Ga0190265_125609742 | 3300018422 | Soil | LLFTDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSTDYENAEDKWLQLTRSITK |
Ga0190272_104833291 | 3300018429 | Soil | LLFTDFVIGADGQKIMEQFRYGVSWKEPPFKREYVELGMSVAEYNKAEKQWGNLLRTLTR |
Ga0190274_137926022 | 3300018476 | Soil | LLFTDFVIGAEGQKLMEQFRYGVAWKEYAFKREYPERGMTSAEYEKAEDRWTQLTRAMTK |
Ga0193727_10265784 | 3300019886 | Soil | LLLTDFVIGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSTTH |
Ga0193717_10530101 | 3300020060 | Soil | FRYGVAWKDYPFKREYPERGMTSTEYENAEDKWLQLTRSITKRQN |
Ga0210379_100309443 | 3300021081 | Groundwater Sediment | GVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITQR |
Ga0222622_113574712 | 3300022756 | Groundwater Sediment | GAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSTTHR |
Ga0247801_10764052 | 3300023064 | Soil | MEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR |
Ga0210139_11224891 | 3300025558 | Natural And Restored Wetlands | MDQFRYGVAWKDYPFKREYPERGMTSAQYQDAEDKWSQLLRSTTQR |
Ga0210076_10324322 | 3300025567 | Natural And Restored Wetlands | MERFCYGVAWKDYPFKREYPERGMTSSEYENAEDKWLQLTRSITKRQN |
Ga0207680_105614541 | 3300025903 | Switchgrass Rhizosphere | DGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR |
Ga0207693_114566092 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VIGAEGQKLMEQFRYGVAWKEYTFKREYPERGMTTSQYQDAEEKWSDLLRSITRR |
Ga0207663_108751821 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR |
Ga0207663_117099242 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DYPFKREYPEQGMTSAEYEKAEDRWLQLTRAITKRQN |
Ga0207644_101327571 | 3300025931 | Switchgrass Rhizosphere | GVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR |
Ga0207665_114378162 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | ALLFTEFVIGADGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRSLTKRQN |
Ga0207668_115230952 | 3300025972 | Switchgrass Rhizosphere | YPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQGGDRF |
Ga0179587_104983671 | 3300026557 | Vadose Zone Soil | RYGVAWKDYPFKRDYPERGMTSAEYEKNEDKWLQLTRSITKRQGGDRF |
Ga0209896_10115072 | 3300027006 | Groundwater Sand | MEQFKYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITRR |
Ga0209878_10179922 | 3300027163 | Groundwater Sand | ALLFTDFVIGADGQKLMEQFKYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSITRR |
Ga0210000_10187161 | 3300027462 | Arabidopsis Thaliana Rhizosphere | PFKREYPERGMTSSEYENAEDKWLQLTRSITKRQN |
Ga0209523_10269274 | 3300027548 | Forest Soil | RYGVAWKEYPFKREYPERGMTSSEYEKAEDKWTQLVRSITRR |
Ga0210002_10104221 | 3300027617 | Arabidopsis Thaliana Rhizosphere | FVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSADYENAEDKWLQLTRSITKRQN |
Ga0209983_10258061 | 3300027665 | Arabidopsis Thaliana Rhizosphere | DFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSADYENAEDKWLQLTRSITKRQN |
Ga0209819_101073842 | 3300027722 | Freshwater Sediment | HAALLLTDFVIGADGQKLMEQFRYGVAWKQYPFKREYPERGMTTAQYQDAEEKWSQLLRSITRR |
Ga0209074_102377472 | 3300027787 | Agricultural Soil | DFVIGADGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDKWLQLTRAITKR |
Ga0209481_100397713 | 3300027880 | Populus Rhizosphere | QKLMEQFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSQLLRSIIHR |
Ga0209382_102421371 | 3300027909 | Populus Rhizosphere | MEQFRYGVAWKEYPFKREYIERGMSSAEYEHAEDKWLQLTRSISKK |
Ga0209382_119355692 | 3300027909 | Populus Rhizosphere | TDFVIGADGQKLMEQFRYGVAWRDYPFKRDYPERGMTSAEYEKAEDKWLQLTRSITKRQGGGDRF |
(restricted) Ga0255311_11074632 | 3300031150 | Sandy Soil | WKDYSFKREYPERGMTSAEYEKAEDRWAQLTRAITKR |
Ga0307473_100992762 | 3300031820 | Hardwood Forest Soil | ALLLADFVIGAEGQKLMEQFRYGVAWKEYPFKREYPERGMTTSQYQDAEEKWSDLLRSITRR |
Ga0306925_113683142 | 3300031890 | Soil | TDFVIGAEGQKLMEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN |
Ga0306926_101250412 | 3300031954 | Soil | MEQFRYGVAWKDYPFKREYPERGMTSAEYEKAEDRWLQLTRAITKRQN |
Ga0307415_1001798593 | 3300032126 | Rhizosphere | EGQKLMEQFRYGVAWKDYPFKREYPERGMTSTEYENAEDKWLQLTRSISKK |
Ga0307472_1014187231 | 3300032205 | Hardwood Forest Soil | GVAWKKQPFKREYPERGMTSLQYQDAEEKWDQLLQSIVVRR |
Ga0335084_117005462 | 3300033004 | Soil | EQFKYGVAWKEYSFKREYPERGMTSLQYQDAEEKWDNLMHSIVVRK |
Ga0326726_106997052 | 3300033433 | Peat Soil | GQKLMEHFRYGVAWKEYPFKREYPERGMTTAQYQDAEEKWSELLRSITHR |
Ga0364925_0289500_2_109 | 3300034147 | Sediment | EYSFKREYPERGMTSAEYEKAEDRWMQLTRAITKR |
⦗Top⦘ |