NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070162

Metagenome / Metatranscriptome Family F070162

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070162
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 141 residues
Representative Sequence RDDDEVDHSNEFFKATEHEKLGDGGYKRVTTPRFAADEDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAQARSASSEVLDTHKGLTGAARENYLKTYFPRTWAHFDVNRTGKVEAIKMPQFMRFLCSDQQMYLW
Number of Associated Samples 101
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 13.54 %
% of genes near scaffold ends (potentially truncated) 60.16 %
% of genes from short scaffolds (< 2000 bps) 78.05 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (78.049 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(21.951 % of family members)
Environment Ontology (ENVO) Unclassified
(56.098 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(77.236 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 37.42%    β-sheet: 10.43%    Coil/Unstructured: 52.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.05 %
UnclassifiedrootN/A21.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000136|KGI_S1_ANT02_95mDRAFT_c10154730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium562Open in IMG/M
3300000928|OpTDRAFT_10374021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300006374|Ga0075512_1287251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300006383|Ga0075504_1328449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium506Open in IMG/M
3300006401|Ga0075506_1790676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium553Open in IMG/M
3300006402|Ga0075511_1635749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium520Open in IMG/M
3300006403|Ga0075514_1762396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium522Open in IMG/M
3300006641|Ga0075471_10381807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium708Open in IMG/M
3300006803|Ga0075467_10373447All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300007231|Ga0075469_10197158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300007516|Ga0105050_10209314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1218Open in IMG/M
3300007516|Ga0105050_10479103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium737Open in IMG/M
3300007516|Ga0105050_10666741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300007523|Ga0105052_10558063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300007862|Ga0105737_1220063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium504Open in IMG/M
3300008835|Ga0103883_1059035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300009002|Ga0102810_1104804All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium880Open in IMG/M
3300009079|Ga0102814_10280523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium907Open in IMG/M
3300009235|Ga0103857_10114957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium558Open in IMG/M
3300009436|Ga0115008_11537611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300009442|Ga0115563_1149853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium938Open in IMG/M
3300009538|Ga0129287_10176193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium921Open in IMG/M
3300009538|Ga0129287_10279496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300009608|Ga0115100_10762353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300009679|Ga0115105_10211634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300010309|Ga0102890_1108217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium574Open in IMG/M
3300010312|Ga0102883_1231732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium519Open in IMG/M
3300010354|Ga0129333_11416222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300012271|Ga0136555_1112710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium592Open in IMG/M
3300012518|Ga0129349_1008456All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300016732|Ga0182057_1448182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300016743|Ga0182083_1422230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium502Open in IMG/M
3300016771|Ga0182082_1122529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300017949|Ga0181584_10834579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300017951|Ga0181577_10797517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium569Open in IMG/M
3300017964|Ga0181589_10922099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300018415|Ga0181559_10494560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300018424|Ga0181591_10824350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300018567|Ga0188858_110031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300018625|Ga0192842_1023760All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium665Open in IMG/M
3300018684|Ga0192983_1057290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium532Open in IMG/M
3300018763|Ga0192827_1061730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium652Open in IMG/M
3300018830|Ga0193191_1062538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300018842|Ga0193219_1053096All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300018842|Ga0193219_1074815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300018860|Ga0193192_1034254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium650Open in IMG/M
3300018880|Ga0193337_1050693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300018982|Ga0192947_10274613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300019033|Ga0193037_10341506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium528Open in IMG/M
3300019045|Ga0193336_10638767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300019048|Ga0192981_10158043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium895Open in IMG/M
3300019048|Ga0192981_10292580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300019050|Ga0192966_10283184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium586Open in IMG/M
3300019051|Ga0192826_10224383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium693Open in IMG/M
3300019103|Ga0192946_1068213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300019261|Ga0182097_1150564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium571Open in IMG/M
3300020013|Ga0182086_1116671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300021342|Ga0206691_1657397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300021345|Ga0206688_10571106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium530Open in IMG/M
3300021345|Ga0206688_10604936All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium515Open in IMG/M
3300021345|Ga0206688_10678429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium543Open in IMG/M
3300021355|Ga0206690_10274498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium578Open in IMG/M
3300021359|Ga0206689_10268902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium508Open in IMG/M
3300021359|Ga0206689_10851121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300021359|Ga0206689_11071967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium731Open in IMG/M
3300021373|Ga0213865_10372765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300021928|Ga0063134_1079063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300021941|Ga0063102_1114430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium573Open in IMG/M
3300021950|Ga0063101_1039576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300024346|Ga0244775_11412499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium535Open in IMG/M
3300025872|Ga0208783_10245292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium727Open in IMG/M
3300025887|Ga0208544_10232421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium746Open in IMG/M
3300026471|Ga0247602_1165671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium510Open in IMG/M
3300027159|Ga0208020_1056061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium727Open in IMG/M
3300027753|Ga0208305_10131698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium924Open in IMG/M
3300027976|Ga0209702_10249316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium737Open in IMG/M
3300027976|Ga0209702_10336389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300027976|Ga0209702_10450740All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium501Open in IMG/M
3300027983|Ga0209284_10372035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium709Open in IMG/M
3300030749|Ga0073969_11250311All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium631Open in IMG/M
3300030750|Ga0073967_10874113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300030786|Ga0073966_11815224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300030859|Ga0073963_10009713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium581Open in IMG/M
3300030957|Ga0073976_10001423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium630Open in IMG/M
3300031005|Ga0073974_1032015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300031063|Ga0073961_12247443All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium511Open in IMG/M
3300031382|Ga0307971_1206934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium540Open in IMG/M
3300031398|Ga0307979_1075625All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium814Open in IMG/M
3300031729|Ga0307391_10506853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium678Open in IMG/M
3300031735|Ga0307394_10188601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium808Open in IMG/M
3300031735|Ga0307394_10465822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300031739|Ga0307383_10353651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium717Open in IMG/M
3300031739|Ga0307383_10643611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium537Open in IMG/M
3300032707|Ga0314687_10605829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300033572|Ga0307390_10440114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium801Open in IMG/M
3300034073|Ga0310130_0202557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine21.95%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh14.63%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.82%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.38%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater7.32%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater6.50%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine6.50%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water2.44%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.63%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.63%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.63%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater1.63%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.81%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.81%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.81%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.81%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.81%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.81%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.81%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.81%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.81%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.81%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300006373Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009235Microbial communities of water from Amazon river, Brazil - RCM10EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010312Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300012271Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E5 #432EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016743Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018567Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dTEnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019277Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019280Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071401AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019281Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021928Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S9 C1 B7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300030749Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030750Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030786Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030957Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031005Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031063Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031269Marine microbial communities from Ellis Fjord, Antarctic Ocean - #991EnvironmentalOpen in IMG/M
3300031382Saline water microbial communities from Organic Lake, Antarctica - #714EnvironmentalOpen in IMG/M
3300031398Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1058EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KGI_S1_ANT02_95mDRAFT_1015473013300000136MarineDHSDEFFKHSEHDMLGDGGYQRVTTSRFAADQDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGAKAASTEVLDTHRHLSGKAQEDYMKTYFARSWSHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW*
OpTDRAFT_1037402113300000928Freshwater And MarineESEDSNESGNDGSLVALEGDSSEEIDHSKEFFKPGQHEMLGGGGYDRVTTARFAADQDDIFMRSMIEQYSLEQKNKDGTPSGKFWMDEAGTRAASHEILETNCKVTGKAREDWLNTYFKKAWNHFDVNRTGKIEVIKMPQFARFLCSDQRMYLW*
Ga0075483_126876113300006373AqueousEETHLMTIAEALAKVNKHHKKHHEMVQLGDDEPDHSGEFFRVNEAGKLGGGGYERVTTARFAADSDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEGAARAASSEVLHTHKGLTGAARTNYLRTYFPRTWAHFDVNRSGKIEVIKMPQFMRFLCSDQSMYLW*
Ga0075512_128725113300006374AqueousFASLFLLGAVAAIKGDDEEVDHSNEFFKATEHEKLGSGGYNRVTTARFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAAARAASSEVLHTHKNLTGAARENYLKTYFPRTWAHFDVNRGGKIEAIKMPQFMRFLCSDQQMYLW*
Ga0075504_132844913300006383AqueousMKFASLFLLGAVAAIKGDDEEVDHSNEFFKATEHEKLGSGGYNRVTTARFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAAARAASSEVLHTHKNLTGAARENYLKTYFPRTWAHFDVNRGGKVEAIKMPQFMRFLCSDQQMYLW*
Ga0075506_173093523300006401AqueousMLGDGGYKRVTTPRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEAGARAASSEVLDTHKGLTGKAREQYLSTYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQ
Ga0075506_179067613300006401AqueousKFASLFLLGAVAAIKGDDEEVDHSNEFFKATEHEKLGSGGYNRVTTARFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAAARAASSEVLHTHKNLTGAARENYLKTYFPRTWAHFDVNRGGKVEAIKMPQFMRFLCSDQQMYLW*
Ga0075511_163574913300006402AqueousFASLFLLGAVAAIKGDDEEVDHSNEFFKATEHEKLGSGGYNRVTTARFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAAARAASSEVLHTHKNLTGAARENYLKTYFPRTWAHFDVNRGGKVEAIKMPQFMRFLCSDQQMYLW*
Ga0075514_176239613300006403AqueousSDSDDDKKVQLGDDDEVDHSNEFFKASEHEKLGDGGYKRVTTPRFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAASSEVLDTHKGLTGKAREQYLGTYFPRTWGHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLW*
Ga0075515_1087203313300006404AqueousMLGDGGYKRVTTPRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEAGARAASSEVLDTHKGLTGKAREQYLSTYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSD
Ga0075471_1038180713300006641AqueousLGLAAAKHHKHHHGQGLVMLAAGDDVDHSGEFFKATDSGQLHGGGYERVTTARFASDSDDIFMRSMIEQYALEGKNKDGSPNGAFWMDEAGARAAASEVLHTHKGLTGKARDDYLKTYFPRTWAHFDVNRSGKIEVIKMPQFMRFLCSDQRMYLW*
Ga0075467_1037344713300006803AqueousMKFAALALIGVISAVQLQDDVDHSGEFFKAAEHEKLGSGGYKRVTTANFSADSDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEAAARAASAEVLNTHKQMSGAALETYLKTYFPRTWAHFDVNRTGKVEALKMPQFMRFLASDQQMYLW*
Ga0075469_1019715813300007231AqueousPDEEEDWDLQLHGDDEEVDHSGEFYHPHEHEMEGDGGYTRVPTAHFSADSDDIFMRSMIQQYAVEGKNKDGSPNGNFLMDEASALAAAKEVLHTHKGLEGAALETYCQTYFPRTWSHFDVNQAGKIEVIKMPQLMRFLASDQQMYLW*
Ga0105050_1020931423300007516FreshwaterMKFTLLALVSVASAVRLADDDHSGEFFAPGEHDKMGGGGYARAVPARFSADSDDIFMRSMINTYSLEGKNKDGSPNGQFWMDEASTRAASAEVLGTHKAMQGAELKTYLNTYFGKAWGHFDVNRSGKIEVIKMPQFMRFLSSDQQMYLW*
Ga0105050_1047910313300007516FreshwaterMKFAILALISVVSAVQLKDDVDHSGEFFQPGEHEQLGKGGYDRVTPARFAGDSDDIFMRSMINQYALEGKNKDGSPSGQFWMTEAGARAASSEVLATHKGMHGAELATYLNSYFAKAWGHFDVNRVGKVEVIKMPQFMRFLSSDQYMYLW*
Ga0105050_1066674113300007516FreshwaterEFFTTAEKEKAGAGGYTRVVPARFSADSDDIFMRSMVDNYSVEGKNKDGSPNGQFWMTEANTRSAAQEVLATHKGLKATELDTYLKSYFGKAWGHFDVNRTGKIEVIKMPQFMRFLSSDQQMYLW*
Ga0105052_1055806313300007523FreshwaterMKFAILALISVVSAVQLKDDVDHSGEFFQPGEHEQLGKGGYDRVTPARFAGDSDDIFMRSMINQYALEGKNKDGSPSGQFWMTEAGARAASSEVLATHKGMHGAELATYLDSYFAKAWGHFDVNRVGKVEVIKMPQFMRFLSSDQYMYLW*
Ga0105737_122006313300007862Estuary WaterEHDKLGDGGYKRVTTPRFSADSDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANTRSAAAEVMTTHKNLSGEALNTYLKTYFPRTWAHFDVNRSGKVESLKMPQFMRFLASDQQMYLW*
Ga0103883_105903523300008835Surface Ocean WaterRILDDDEVDHSGEFFKASEHEKLGDGGYKRVTTPRFAADEDDIFMRSMIEQYALEGKNKDGSPNGSFWMDEAGARAAASEVVETHRGLRGAAKDNYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW*
Ga0102810_110480413300009002EstuarineMKFATLAFIGAVAAVRIADDDVDHSGEFFKSTEHEKLGDGGYKRVTTPRFSADSDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARSASAEVLATHKALSGAALETYLKTYFPRTWAHFDVNRSGKIESLKMPQFMRFLASDQQMYLW*
Ga0102810_113035123300009002EstuarineMLGEGGYKRVTTPRFSADSDDIFMRSMIEQYALEGKNKDGSPNGNFQMDEAATRAATSEVLATHKGLKGAALATYLKTYFPRSWAHFDVNRTGKIEVSKMPQFMRFIASDQQMYLW*
Ga0102829_115711013300009026EstuarineMLGEGGYKRVTTPRFSADSDDIFMRSMIEQYALEGKNKDGSPNGNFLIDEAAARAAAAEVLTTHKKMTGKTLDTYLKTYFPRTWAHFDVNRTGKVEAIKMPKIMRFLASDQQMYLW
Ga0102814_1028052313300009079EstuarineMLGAMGDDEVDHSGEFFAPGEHEKLAEGGYKRVAPTHFSADSDDIFMRSMVNTYSLEGKNKDGSPNGQFWVDEAGARAAAGEVLNTHKGLKGKELESYLKTYFPRTWAHFDVNRTGKIEVIKMPQVMRFLASDQQMYL
Ga0103857_1011495723300009235River WaterLSDVDHSGEFFKASDSGQLHGGGYERVTTPRFSADSDDIFMRSMIEQYALEGKNKDGSPNGAFWIDEAGARAASREVLDTHKGLTGKARDDYLATYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQYMYLW*
Ga0115008_1153761113300009436MarineVQLGDDDEEVDHSNEFFKAAEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARSAASEVLHTHKGLAGAARETYLKTYFPRTWAHFDVNRSGKVESIKMPQFMRFLCSDQQMYLW*
Ga0115563_114985313300009442Pelagic MarineMKYTLAIAALLAATAQAIQFPTYKDEVDHSGEFFVPNDHKMLGDGGYVRAIPANFVDDSDDIFMRSMYEQYALEAKNKDGSPSGKFWLDEAAARAASKEVLATHKGLVGAELQAYMDTYFAKSWGHFDVNKSGSVEAIRMPQFMRFLCSDQQMTLLP*
Ga0129287_1017619313300009538Beach Aquifer PorewaterMLGGGGYERVTPARFAADNDDIFMRSMIEQYSLEQKNKDGTPSGKFWMDEAATRAAAREVLETNCKLGGKGRDDWLNTYFAKAWAHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLW*
Ga0129287_1027949623300009538Beach Aquifer PorewaterKKVQLRDDEEEDHSDEFFKASEHAKLGDGGYKRVTPVRFAADEDDIFMRSMIEQYALEGKNKDGSPNGQFWMDKAGTFAAAREVLHTHRHLLGKPRDEYLKTYFDRTWDHFDVNKTGKVEVIKMPQLMRFLCSDQ*
Ga0115102_1035878813300009606MarineMLGGGGYERVTPSRFAQDSDDIFMRSMIEQYSLEQKNKDGTPSGKFWMDEASTRAAAREVLETNGKIVGKARDDWLNTYFPKAWNHFDVNRTGK
Ga0115102_1066913813300009606MarineMKFATLLLVSAVAAVQLRDDDEVDHSGEHFTAQQHDMLGGGEYKRVTPARFAADDDDIFMRSMIQQYANEGKNKDGSPNGSFWMGEAETRAAAREVLNTHMKMSGAALDGYMAKYFPKAWAHFDVNRSGSVEVIKMPQLMRFLSSDQQMYLW*
Ga0115100_1076235313300009608MarineMDAEQALIQDDEEVDHSGEFFKASEHEKLGDGGYKRVTTSRFAADEDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARSAASEVLDTHKGLKGAARDNYLKTYFARTWAHFDVNRSGKVESLKMPQFMRFLCSDQQMYLW*
Ga0115105_1021163413300009679MarineFYKPTEHDKLGGGGYSRVTTPRFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWIDEAGARAAASEVVHTHKGMTGAVRDNYLKTYFPRTWAHFDVNRGGKVEAIKMPQFMRFLCSDQQMYLW*
Ga0102890_110821713300010309EstuarineQPGQHEMLGGGGYERQTPKRFAADSDDIFMRSMIEQYALEQKTKEGYPSGKFWMDEASTRAAASEVLETNCKMTGAAKAEWLKTYFSKAWGHFDVNRSGKVEVIKMPQLMRFLCSNQQMYLW*
Ga0102883_123173213300010312EstuarineSSDSDIQLGDDDVDHSGEFFKASEHNDDGRGYFRNGIAHFSADSDDIFMRSMIKNYALEGKNKDGSPNGQYWVDEAGARQAAMEVLNTHKGMSGAALAGYLDTYFPRTWNHFDVNRTGKIEVLKMPQLMRFLASDQQMYLW*
Ga0129333_1141622213300010354Freshwater To Marine Saline GradientGKHSFAQLSLGDDEDHSGEFFRVTEGGKLGGGGYERVTTARFAADQDDIFMRSMIEQYALEGKNKDGSPNGQFWMDESSARAAASEVLNTHKKLSGAARTNYLRTYFPRTWAHFDVNRTGKIEVIKMPQFMRFLCSDQQMYLW*
Ga0136555_111271013300012271Saline LakeDKKNVQTLDEEEVDHSGEFFKHSEHDMLGDGGYQRVTTARFAADQDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAASAEVLDTHRKLAGKASEDYLKTYFARTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW*
Ga0129349_100845613300012518AqueousVDHSGEFFPVGAHGQEGAGAYERKTTARFAADTDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGAKAAAQEVLATHKGIKGAAADKYFATYWKKAWGHFDVNLTGKIEVIKAPQLMRFLASDQYMSLQP*
Ga0182057_144818213300016732Salt MarshDSSDDEDVQMQDESDHSGEFYPVGQHGQEGAGSYERKTTPRFAADSDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGAKAAASEVLATHKGIKGAALADYLKTYWSKAWGHFDVNLVGKIEVIKAPQLMRFLASDQYMSLQP
Ga0182083_142223013300016743Salt MarshKASKDPAVDDEVADVNSIEAPKGISDALAQMTVEDEEDHSGEFFKVTEGGKLGGGGYERVTPARFAADSDDIFMRSLVEQYALEGKNKDGSPNGQFWMDEGAARAAASEVLHTHKGLTGAARANYLKTYFPRTWAHFDVNRTGKVEVIKMPQFMRFLCSDQQMYL
Ga0182062_147551913300016751Salt MarshGDSDEEVDHSNEYFQPGQHEMLGGGGYERVTPARFAQDSDDIFMRSMIEQYALEQKNKDGTPSGKFWMDEAATRAAAREVLETNCKVTSKGRDDWMNTYFQKAWNHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLW
Ga0182082_112252913300016771Salt MarshFFRVNEAGKLGGGGYERVTTARFAADSDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEGAARAASSEVLHTHKGLTGAARANYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0181584_1083457913300017949Salt MarshDSSSSSDVQLGDDEVDHSGEFFKASDHEMLGGGEYKRVVPNRFAADDDDIFMRSMVKTYAVEGKNKDGSPNGNFLVDEANARAAAQEVLHTHKQMKGADLNEYMTTYFPKAWAHFDVNRTGKIEVIKMPQFMRFLASDQTMALW
Ga0181577_1079751713300017951Salt MarshKPGQHEMLGGGGYDRVTPARFAADSDDIFMRSMIEQYALEQKNKDGTPSGKFWMDEAGARAAAHEVLETNCKVTGKPREDWLNTYFKKAWNHFDVNRTGKVEVIKMPQFMRFLCSDQRMYLW
Ga0181589_1092209913300017964Salt MarshFFTPTQHDMLGGGEYKRVITPRFAADDDDIFMRSMIKTYADEGKNKDGSPNGSFTVTEAAARQAAMEVLHTHKGMKGAELDQYIQTYFPRTWSHFDVNRTGRIEVIKMPQVMRFLASDQQMYLW
Ga0181559_1049456013300018415Salt MarshEDHSKEVFNPWEHTKPEDNKEGGYSRVTPVHFAADSDDIFMRSMIQQYSLEGKNKDGSPNGQFWMDEAATRAAASEVLATHKGMTGAALSSYLNTYFSKAWGHFDVNRSGKVEVIKMPQFMRFLASDQYLSLQHY
Ga0181591_1082435013300018424Salt MarshDANKVQVQDDDEVDHSGEFFKASEHEKLGDGGYKRVTTPRFAADDDDICMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAASSEVLDTHKGLTGKSREQYLSTYFPRTWAHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLW
Ga0188858_11003113300018567Freshwater LakeKMKFASLFLLGAVAAIKGDDEEVDHSNEFFKATEHEKLGSGGYNRVTTARFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAAARAASSEVLHTHKNLTGAARENYLKTYFPRTWAHFDVNRGGKVEAIKMPQFMRFLCSDQQMYLW
Ga0192842_102376013300018625MarineHGGDTEVGRAPWTTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAASSEVLDTHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0192983_105729013300018684MarineDDEEVDHSNEVFAAGEHGKLGDDGYKRVTPTNFAADNDDIFMRSMIEQYANEGKNKDGSPNGSFTMTEATARAASSEVLDTHKKLTGAKRDAYLKTYFPRTWAHFDVNKSGAIGVSAMPQFMRFLCSDQQMYLQP
Ga0192827_106173013300018763MarineHGGRAPWTTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAAASEVLDTHKGLTGAARETYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0193191_106253813300018830MarineTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAAASEVLDTHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0193219_105309613300018842MarineMRFIAIVALLGAAVASEAVVDVQAVRSHNKKAKAHKAKKHHKKHHEDSLIRIGDDDEVDHSNEFFKASEHEKLGDGGYKRVTTPRFAADEDDIFMRSMIEQYALEGKNKDGSPNGSFWLDEANARAASSEVLDTHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0193219_107481513300018842MarineRDDDEVDHSNEFFKATEHEKLGDGGYKRVTTPRFAADEDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAQARSASSEVLDTHKGLTGAARENYLKTYFPRTWAHFDVNRTGKVEAIKMPQFMRFLCSDQQMYLW
Ga0193253_107869823300018846MarineMLGDGGYKRVTTPRFANDDDDIFMRSMIEQYALEGKNKDGSPNGQFWIDEAGAKAASSEVLDTHKGLTGKAREQYLATYFPRTWGHFDVNRGGKIEVIKMPQFMRFLCSDQQMYLW
Ga0193192_103425413300018860MarineMGRAPWTTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAAASEVLDTHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0193192_103587113300018860MarineEDRNVQFCFDDDEKDHSNEYFQPGQHEMLGGGGYERVTPARFANDSDDIFMRSMIEQYALEQKNKDGTPSGKFWMDEAGARAASREVLETNCKVSDKARDDWLNTYFSKAWNHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLW
Ga0193337_105069313300018880MarineEGDENVQLGDSDDEVDHSNEFFLPGQHEMLGGGGYERVTPARFAADSDDIFMRSMIEQYALEQKNKDGTPSGKFWMDEASTRAAAQEVLETNCKITGKARDDWLNTYFGKAWSHFDVNRTGKVEVIKMPQFMRFICSDQQMYLW
Ga0192947_1012702733300018982MarineMLGGGGYERVTTARFAQDSDDIFMRSMVEQYAQEGKNKDGSPNGQFWMGEADARAASHEVLDTHKGLTGAARDTYLNTYFPRTWGHFDVNRTGKIEAIKMPQLIRFLCSDQQMYLW
Ga0192947_1027461313300018982MarineKKAAKAAKAKKHHAPAALSQEELVRLFDDDEVDHSNEFFKSTEHEKLGDGGYKRVTTPRFAADEDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANAKSAASEVLDTHRGLKGAARENYLKTYFPRTWAHFDVNRTGKVESIKMPQFMRFLCSDQSMYLW
Ga0193037_1034150613300019033MarineQGDDEVDHSNEFYKPTEHDKLGGGGYTRVTTPRFAADDDDIFMRSMVEQYALEGKNKDGSPNGQFWMDEAATRAAASEVVHTHKGMTGAVRDNYLKTYFPRTWAHFDVNRTGKVEAIKMPQFMRFLCSDQQMYLW
Ga0193336_1029789813300019045MarineMLGDGGYKRVTTPRFANDDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGARSASSEVLDTHKGLTGKAREQYLATYFPRTWGHFDVNRSGKIEVIKMPQFMRFLCSDQQMYLW
Ga0193336_1046411713300019045MarineMLGDGGYKRVTTPRFANDDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGAKAASSEVLDTHKGLTGKAREQYLATYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQQMYLW
Ga0193336_1063876713300019045MarineDDEVDHSNEFFLPGQHEMLGGGGYERVTPARFANDSDDIFMRSMIEQYALEQKNKDGTPSGKFWMDEAATRAAASEVLETNCKITGKARTDWLNTYFAKAWSHFDVNRTGKVEVIKMPQFMRFICSDQQMYLW
Ga0192981_1015804323300019048MarineMLGDEEDHSGEFFKVTEAGKIGGGGYERVTTPRFAADNDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGTRAAASEVLHTHNGLTGAPRANYLKSYFPRTWAHFDVNRTGKVEAIKMPQLMRFLCSDQQMYLW
Ga0192981_1029258013300019048MarineDVQMGDDDEEVDHSNEFFKAGMHDMLGEGGYSRATTTRFAADSDDIFMRSMIEQYSLEGKNKDGSPNGLFVMDEALAKAASAEVLDTHKGLKGKAGETYLNTYFPRTWAHFDVNRTGKIESIKMPQFMRFLCSDQQMYLW
Ga0192966_1028318413300019050MarineDEALVQVEGSSDEEIDHSNEYYKPGQHEMLGGGGYERVTPANFAQDNDDIFMRSMIEQYALEQKNKDGTPSGKFWLDEAGARAASSEILETNCKVSGKSRTDWLNTYFPKAWAHFDVNRTGKIEAIKMPQFSRFLCSDQQVYLF
Ga0192826_1020533123300019051MarineMGETRQNMHKPVAVKTWAYDAVKMNTMLAEDRNVQFCFDDDEKDHSNEYFQPGQHEMLGGGGYERVTPARFANDSDDIFMRSMIEQYALEQKNKDGTPSGKFWMDEAGARAASREVLETNCKVSDKARDDWLNTYFSKAWNHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLW
Ga0192826_1022438313300019051MarineMGRAPWTTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTPRFANDDDDIFMRSMIEQYSLEGKNKDGSPNGHFWMDEASARAASTEVLDIHKGLTGKAREKYLATYFPRTWGHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0192946_104480623300019103MarineMLGGGGYERVTPARFAQDSDDIFLRSMIEQYSLEQKNKDGTPSGKFWMDEASTRAAAKEVLETNCKVGGKSREDWMNTYFTKAWNHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLWXARNDSAQPKQLVNDEKLIIN
Ga0192946_106821313300019103MarineLPGQHEMLGGGGYERVTPARFAADTDDIFMRSMIEQYALEQKNKDGTPSGKFWMDEAATRAAAREALETNCKVTGKARDNWLNTYFAKAWNHFDVNRTGKIEVIKMPQLMRFLCSDQQMYLW
Ga0188870_1011846113300019149Freshwater LakeMLGDGGYKRVTTPRFANDDDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAASSEVLDTHKGLSGKSREQYLSTYFPRTWGHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0182097_115056413300019261Salt MarshSSDDEDVQMQDESDHSGEFYPVGQHGQEGAGSYERKTTPRFAADSDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAAASEVLATHKGIKGAALATYLKTYWSKAWGHFDVNLVGKIEVIKAPQLMRFLASDQYMSLQP
Ga0182061_150425213300019266Salt MarshMLGDGGYKRVTTPRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEAGARAASSEVLDTHKGLTGKAREQYLSTYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQYMQLGESG
Ga0182059_109793123300019272Salt MarshMLGDGGYKRVTTPRFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGARAASSEVLDTHKGLTGIAREQYLSTYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQQMYLW
Ga0182073_110503813300019274Salt MarshMLGDGGYKRVTTPRFANDDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGARAASSEVLDTHKGLTGKSREQYLATYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCS
Ga0182081_116387913300019277Salt MarshMLGDGGYKRVTTPRFANDDDDIFMRSMIEQYALEGKNKDGSPNGQFRRDEAGARAASSEVLDTHKGLTGKSREQYLATYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQQMY
Ga0182068_101373913300019280Salt MarshMLGDGGYKRVTTPRFANDDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGARAASSEVLDTHKGLTGKSREQYLATYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQQMYLW
Ga0182077_149576613300019281Salt MarshMLGDGGYKRVTTPRFANDDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGARAASSEVLDTHKGLTGKSREQYLATYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQ
Ga0182058_136658223300019283Salt MarshMLGDGGYKRVTTPRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEAGARAASSEVLDTHKGLTGKAREQYLSTYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQQMYLW
Ga0182086_111667113300020013Salt MarshTSTSSSSSSSSDEKKVQLADDEEEVDHSGEFFKATEHDKLGDGGYSRVTTPRFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGARAAAHEVLDTHRHLTGKAREDYLNTYWARTWAHFDVNRSGKVEVIKMPQLIRFLCSDQQMYLW
Ga0206696_158545823300021334SeawaterMKKGDPPTYFAPGQHEMLGGGGYDRVTTPRFAADTDDIFMRSMIENYALELKNDESGAPTGQFWLDEAGARAAASEVLGTHKGLFGANLQNYLDSYWAKAWGHFDVNRVGKIEVIKAPQLMRFLCSDQYMFLW
Ga0206691_165739713300021342SeawaterMKFAALALLGFAAAVSVRDDDDVDHSGEFFKSTEHEKLGSGGYNRVTTARFSADNDDIFMRSMVEQYALEGKNKDGSPNGQFWMDEANARSASSEVLDTHKGLKGKAREDYLKTYFPRTWAHFDVNRGGKIEAIKMPQFMRFLCSDQQMYLW
Ga0206688_1057110613300021345SeawaterMKFTAALLIGIVAAVQIKGDDEVDHSGEFFKATEHGQLGGGGYSRVTPSRFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAAASEVLHTHRGLVGAPREAYLKTYFPRTWGHFDVNRTGKVEVIKLPQLMRFLCSDQQMYLW
Ga0206688_1060493613300021345SeawaterEGDDKEEDDKEEKKSLIQIGDDEVDHSGEFFKSTEHDMLGDGGYKRVTTPRFAADSDDIFMRSMIEQYALEGKNKDGSPNGQFLMDEANTRSAAAEVLGTHKGLKGAELDKYLKTYFPRSWAHFDVNRAGKVEVAKMPQFMRFIASDQQMYLW
Ga0206688_1067842913300021345SeawaterKKSLVEIMDDAWDGVDHSGEFFQPGQHEMLGGGGYERQTPKRFAADSDDIFMRSMIEQYALEQKTKEGYPSGKFWMDEAATRAAASEVLDTNCNMKGASKGEWLKTYFGKAWGHFDVNRSGKVEVIKMPQFMRFLCSDQQMYLW
Ga0206690_1027449813300021355SeawaterPYRSHVQMNDSDDSDSESSSSEEEVQVGAGGDDEVDHSGEFFKASGDGKLGGGGYDRVTPSRFAADSDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAAASEVLHTHRGLVGAPREAYLKTYFPRTWGHFDVNRTGKVEVIKLPQLMRFLCSDQQMYLW
Ga0206689_1026890213300021359SeawaterFINMKFTLLVGMAAAVQIKDDDVDHSGEFFKATEHGQLGGGGYSRVTPSRFAADDDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAASSEVLHTHRGLVGAPRENYLKTYFPRTWGHFDVNRTGKVEVIKLPQLMRFLCSDQQMYLW
Ga0206689_1085112113300021359SeawaterQMRTYFALIGLAAAVKQTQKSVIDAMTMDDEVDHSGEFFKVGEHGMLGSGGYERVTTPRFAADSDDIFMRSMIEQYAQEGKNKDGSPNGQFWMSEANARSAASEVLNTHRGLSGKAREEYLKTYFPRSWAHFDVNRVGKIEVIKMPQLMRFLSSDQQMYLW
Ga0206689_1107196733300021359SeawaterSSSDSSSSDEKKVQIGDDDEEVDHSGEFFKAAEHEKLGDGGYKRVTTARFAADDDDIFMRSMIANYAIEKNCSGPDDPPTTCGKFTMNPATMRAAASEVLCTHKGLCGGALVTYLDTYFDKAWGHFDVNKVGEVEVIKSPQFMRFLASDQYMSLQ
Ga0213865_1037276513300021373SeawaterDDEVDHSGEFFKVGEAGKLGGGGYERVTTARFAADSDDIFMRSMIEQYAQEGKNKDGSPNGQFWMSEANARAAASEVLDTHRQLRGKAREDYLRTYFPRTWAHFDVNRTGMVEAIKMPQLMRFLCSDQQMYLW
Ga0063134_107906313300021928MarineLIRLNTSLYDEEEVDHSNEFFKASEHEMLGEGGYKRVTTPRFSADQDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEANARSASHEVLGTNCKIAGDAKEKYLTTYFPRTWAHFDVNRTGKVEAIKMPQFMRFLCSDQYMYLW
Ga0063102_111443013300021941MarineMEGDDEDVDHSGEFFKASEHGQKGEGSYERVTPPRFAADDDDIFMRSMIEQYAQEGKNKDGSPNGQFSLTEAAARAASSEVLHTHRHLEGKAREAYLATYFPRTFAHFDVNRTGSIDAIKMPQFMRFLSSDQ
Ga0063101_103957613300021950MarineMEGDDEDVDHSGEFFKASEHGQKGEGSYERVTPPRFAADDDDIFMRSMIEQYAQEGKNKDGSPNGQFSLTEAAARAASSEVLHTHRHLEGKAREAYLATYFPRTFAHFDVNRTGSIDAIKMPQFMRFLSSDQQMYLW
Ga0222713_1046176813300021962Estuarine WaterVYLGDEEDHSGEFFPAGQHEQEGAGAYNRVTPTRFSADSDDIFMRSMIQNYALEGKNKDGSPNGQFWIDEAGARAAAKEVLKTNAKMKSAAIPGYLNTYFGKAWGHFDVNRTGKIEVIKMPQFMRFLASDQSMYLW
Ga0244775_1141249913300024346EstuarineMLGAMGDDEVDHSGEFFAPGEHEKLAEGGYKRVAPTHFSADSDDIFMRSMVNTYSLEGKNKDGSPNGQFWVDEAGARAAAGEVLNTHKGLKGKELESYLKTYFPRTWAHFDVNRTGKIEVIKMPQVMRFLASD
Ga0209307_120613513300025832Pelagic MarineGQHEMLGGGGYERVTPARFAQEADDIFMRSMVEQYALEQKNKDGTPSGKFWMDEAATRAAAREVLETNCRISGKARDDWLNTYFSKAWGHFDVNRTGKVEAIKMPQFMRFLCSDQQMYLW
Ga0208783_1024529213300025872AqueousMKYSLLLLGLAAAKHHKHHHGQGLVMLAAGDDVDHSGEFFKATDSGQLHGGGYERVTTARFASDSDDIFMRSMIEQYALEGKNKDGSPNGAFWMDEAGARAAASEVLHTHKGLTGKARDDYLKTYFPRTWAHFDVNRGGKIEVIKMPQFMRFLCSDQRMYLW
Ga0208544_1023242113300025887AqueousMKFAALALIGVISAVQLQDDVDHSGEFFKAAEHEKLGSGGYKRVTTANFSADSDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEAAARAASAEVLNTHKQMSGAALETYLKTYFPRTWAHFDVNRTGKVEALKMPQFMRFLASDQQMYLW
Ga0247602_116567113300026471SeawaterEKAFVQDDDEVDHSNEFFKATEHEKLGDGGYKRVTTSRFAADEDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARSAASEVLDTHKGLKGAARDNYLKTYFPRTWAHFDVNRSGKVESIKMPQFMRFLCSDQQMYLW
Ga0208020_105606113300027159EstuarineMKFATLAFIGAVAAVRIADDDVDHSGEFFKSTEHEKLGDGGYKRVTTPRFSADSDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARSASAEVLATHKALSGAALETYLKTYFPRTWAHFDVNRSGKIESLKMPQFMRFLASDQQMYLW
Ga0208305_1013169813300027753EstuarineMLGAMGDDEVDHSGEFFAPGEHEKLAEGGYKRVAPTHFSADSDDIFMRSMVNTYSLEGKNKDGSPNGQFWVDEAGARAAAGEVLNTHKGLKGKELESYLKTYFPRTWAHFDVNRTGKIEVIKMPQVMRFLASDQQMYLW
Ga0209702_1024931623300027976FreshwaterMKFAILALISVVSAVQLKDDVDHSGEFFQPGEHEQLGKGGYDRVTPARFAGDSDDIFMRSMINQYALEGKNKDGSPSGQFWMTEAGARAASSEVLATHKGMHGAELATYLNSYFAKAWGHFDVNRVGKVEVIKMPQFMRFLSSDQYMYLW
Ga0209702_1033638913300027976FreshwaterSGEFFTTAEKEKAGAGGYTRVVPARFSADSDDIFMRSMVDNYSVEGKNKDGSPNGQFWMTEANTRSAAQEVLATHKGLKATELDTYLKSYFGKAWGHFDVNRTGKIEVIKMPQFMRFLSSDQQMYLW
Ga0209702_1045074013300027976FreshwaterMKFTLLALVSVASAVRLADDDHSGEFFAPGEHDKMGGGGYARAVPARFSADSDDIFMRSMINTYSLEGKNKDGSPNGQFWMDEASTRAASAEVLGTHKAMQGAELKTYLNTYFGKAWGHFDVNRSGKIEVIKM
Ga0209284_1037203523300027983FreshwaterMKFTLLALVSVASAVRLADDDHSGEFFAPGEHDKMGGGGYARAVPARFSADSDDIFMRSMINTYSLEGKNKDGSPNGQFWMDEASTRAASAEVLGTHKAMQGAELKTYLNTYFGKAWGHFDVNRSGKIEVIKMPQFMRFLSSDQQMYLW
Ga0073969_1125031113300030749MarineRAPWTTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAASSEVLDTHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0073967_1087411313300030750MarineTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAASSEVLDIHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0073966_1181522413300030786MarineRAPWTTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAASSEVLDIHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0073963_1000971313300030859MarineRPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAASSEVLDIHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0073976_1000142313300030957MarineEVGRAPWTTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAAASEVLDTHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0073974_103201513300031005MarineSSKSSDSSSDSDDDKKVQLGSDDEVDHSNEFFKHTEHDMLGDGGYKRVTTPRFANDDDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGAKAASSEVLDTHKGLTGKAREQYLATYFPRTWGHFDVNRTGKIEVIKMPQFMRFLCSDQQMYLW
Ga0073961_1224744313300031063MarineTTTQTENMARPTLHTTDYAVATTAFLVEKANISFDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFAADDDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARAASSEVLDIHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0307983_109322913300031269Saline WaterMLGDGGYQRVTTARFAADQDDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAASAEVLDTHRKLAGKASEDYLKTYFARTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMYLW
Ga0307971_120693413300031382Saline WaterLDLHHHHEAVQIQDEEEVDHSTEFFKAGEHDMLGDGGYQRVTTARFAADADDIFMRSMIEQYALEGKNKDGSPNGQFWLDEAGARAAASEVLDTHRHLNGAARETYMKTYFPRTWAHFDVNRSGKVEAIKMPQLMRFLCSDQQMYLW
Ga0307979_107562513300031398Saline WaterMPGQHEMLGGGGYERVTPARFSNDADDIFMRSMIEQYALEQKNKDGTPSGKFWMDEAGTRAATREVLETNCRVSGKSREEWMNTYFAKAWGHFDVNRTGKVEVIKMPQFMRFLCSDQQMYLW
Ga0307391_1050685323300031729MarineMGDDDEEVDHSNEFFKAGMHDMLGEGGYSRVTTTRFAADSDDIFMRSMIEQYSLEGKNKDGSPNGLFVMDEALAKAASAEVLDTHKGLKGKAGETYLNTYFPRTWAHFDVNRTGKIESIKMPQFMRFLCSDQQMYLW
Ga0307394_1018860113300031735MarineMLGDEEDHSGEFFKVTEAGKIGGGGYERVTTPRFAADNDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEACTRAAASEVLHTHNGLTGAPRANYLKSYFPRTWAHFDVNRTGKVEAIKMPQLMRFLCSDQQMYL
Ga0307394_1046582213300031735MarineKFAVLAILGAVSAVTLRDDEDHSGEFFKAAEHEKLGDGGYKRVTTPRFSADSDDIFMRSMIQQYALEAKGPKDAPNEGEPTGHFWMNEATTRAAASEVLTTHKGLSGGALQSYLDTYFPRTWAHFDVNRGGFVEVIKMPQVMRFLASDQYMSLGE
Ga0307383_1035365123300031739MarineMQLAGDDEVDHSGEFFKSGEHDMLGDGGYKRVTTPRFSADSDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAASRAASSEVLSTHRNLSGKALETYLTTYFPRTWAHFDVNRTGKIEVSKMPQVMRFLSSDQQMYLW
Ga0307383_1064361113300031739MarineMKFAVLAILGAVSAVTLRDEEDHSGEFFKAAEHEKLGDGGYKRVTTPRFSADSDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEAASRAASAEVLSTHKGMTGAALETYLKTYFPRTWAHFDVNRSGKVESLKMPQFMRFLCSDQQMFLW
Ga0314687_1060582913300032707SeawaterMDDDEVDHSNEFFKASEHEKLGDGGYKRVTTSRFADDGDDIFMRSMIEQYSLEGKNKDGSPNGQFWMDEANARSAASEVLDTHKGLTGAARENYLKTYFPRTWAHFDVNRTGKIEAIKMPQFMRFLCSDQQMY
Ga0307390_1044011423300033572MarineMLGDEEDHSGEFFKVTEAGKIGGGGYERVTTPRFAADNDDIFMRSMIEQYALEGKNKDGSPNGQFWMDEAGTRAAASEVLHTHNGLTGAPRANYLKSYFPRTWAHFDVNRTGKVEAIKMPQLMRFLCSDQQM
Ga0310130_0202557_90_5423300034073Fracking WaterMKFATLCFIGAVAAVRLSDEEDHSGEFFPAGQHEQEGAGAYNRAIPARFSEDSDDIFMRSMIKNYALEGKNKDGSPNGQYWVDEAGARQAAMEVLNTHKGMSGAALSGYLDTYFPRTWNHFDVNRTGKIEVLKMPQLMRFLASDQQMYLW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.