| Basic Information | |
|---|---|
| Family ID | F070132 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILEINNLI |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 21.14 % |
| % of genes from short scaffolds (< 2000 bps) | 70.73 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.358 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.138 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.732 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (73.984 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 78.57% β-sheet: 0.00% Coil/Unstructured: 21.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF05766 | NinG | 30.89 |
| PF13481 | AAA_25 | 9.76 |
| PF11325 | DUF3127 | 4.88 |
| PF02739 | 5_3_exonuc_N | 1.63 |
| PF08299 | Bac_DnaA_C | 1.63 |
| PF08291 | Peptidase_M15_3 | 0.81 |
| PF01555 | N6_N4_Mtase | 0.81 |
| PF02675 | AdoMet_dc | 0.81 |
| PF05063 | MT-A70 | 0.81 |
| PF12684 | DUF3799 | 0.81 |
| PF12518 | DUF3721 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 1.63 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 1.63 |
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 1.63 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.81 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.81 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.36 % |
| All Organisms | root | All Organisms | 27.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.14% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 17.07% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 6.50% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.50% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.88% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.06% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.06% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.06% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.44% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.44% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.44% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 2.44% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.63% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.63% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.63% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.63% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.63% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.63% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.63% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.81% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.81% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.81% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.81% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.81% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.81% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004279 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300011256 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300019036 | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027298 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100079167 | 3300000101 | Marine | MVNTNFSNETTNQLLTEYQFRVEALQNKIEELKAILQVNNLI* |
| DelMOSum2010_102128462 | 3300000101 | Marine | MITNFSEQTTNELLTQYEFRVEALQNKIEELKALLEINNLI* |
| DelMOSum2011_100232317 | 3300000115 | Marine | MVNTNFSNETTNQLLTEYQFKVEALQNKIEELKAILQVNNLI* |
| DelMOSum2011_101076391 | 3300000115 | Marine | MITNFSDQTTNELLTQYEFRVEALQNKIEELKALLEINNLI* |
| DelMOSpr2010_1001027011 | 3300000116 | Marine | MFIPLQILILKTKQMVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILQVNNLI* |
| DelMOSpr2010_100358644 | 3300000116 | Marine | MYSHFSDQTTDTLLNQYEFRIEALQNKIEELKALLEVSNLI* |
| DelMOSpr2010_101049324 | 3300000116 | Marine | MNTHFSEQTTNELLTQYEFRIEALQNKIEELKALLEISNLI* |
| DelMOWin2010_102270632 | 3300000117 | Marine | MVKTNFSNQTTDAVLTEHQYRIEALQNRIKELETILIENNQ* |
| TDF_OR_ARG04_113mDRAFT_10356782 | 3300000121 | Marine | MKSHFSEQTTDTLLNQYEFRIEALQNKIEELKALLEINNLI* |
| TDF_OR_ARG05_123mDRAFT_10453282 | 3300000242 | Marine | MVNTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI* |
| OpTDRAFT_102875192 | 3300000928 | Freshwater And Marine | MITNFSEQTTNELLTQYEFRVEALQNKIEELKAVLEINNLI* |
| JGI24006J15134_1000396119 | 3300001450 | Marine | MVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILQVNNLI* |
| Ga0055584_1014908952 | 3300004097 | Pelagic Marine | MGTNFSEQTTNELLTQYEFRIEALQNKIEELKALLEINNLI* |
| Ga0066605_101011343 | 3300004279 | Marine | MINTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI* |
| Ga0065861_11216012 | 3300004448 | Marine | MVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILEINNLT* |
| Ga0070727_103229943 | 3300005590 | Marine Sediment | MVKTNFSNQTTDAVLTEQQYRIEALQNKIEELKAILETNNLI* |
| Ga0070722_101673722 | 3300005601 | Marine Sediment | MITNFSEQTTSELLTQYEFRVEALQNKIEELKALLEINNLI* |
| Ga0099972_104375092 | 3300006467 | Marine | MVKTNFSNQTTDAVLTEHQYRVEALQNRIKELEAKLEINNLN* |
| Ga0098054_10066827 | 3300006789 | Marine | MVKTNFSNQTTDQVLTENQYRVEALQNRIKELEAKLEINNLN* |
| Ga0098054_10128421 | 3300006789 | Marine | VVEISPFFCLLTELFIPLQILILKTKQMVNTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI* |
| Ga0098054_10136603 | 3300006789 | Marine | MINTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILEINNLI* |
| Ga0098054_12495072 | 3300006789 | Marine | MVKTNFSNQTTDAVLTEQQYRIEALQNKIEELKAILQVNNLI* |
| Ga0098054_13171722 | 3300006789 | Marine | FKTKQMVNTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI* |
| Ga0098055_100364110 | 3300006793 | Marine | MLNTNFSNQTTNQLISEYQFRVEALQNKIEELKAILQVNNLI* |
| Ga0098055_10233007 | 3300006793 | Marine | MVNTNYSNQTTNQLLTEYQYRVEALQKKIEELKAILEVNNLI* |
| Ga0098055_10800865 | 3300006793 | Marine | MVKTNFSNQTTDQVLTEHQYRVEALQNRIKELEAKLEINNLN* |
| Ga0098055_11108813 | 3300006793 | Marine | MINTNYSNQTTNQLLTEYQFRVEALQNKIEELKAILEINNLI* |
| Ga0098055_11523091 | 3300006793 | Marine | PLQLLILKTKQMVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILEINNLI* |
| Ga0098055_12803671 | 3300006793 | Marine | LLILKTKQMVNTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILEVNNLI* |
| Ga0075467_101588523 | 3300006803 | Aqueous | MITNFSDQTTNELLTQYEFRVEALQNKIEELKAHLEINNLI* |
| Ga0075467_101816581 | 3300006803 | Aqueous | MVNTNFSNQTTNQLLTEYQFKVEALQNKIEELKAILEINNLT* |
| Ga0070750_102138622 | 3300006916 | Aqueous | MVNTNFSNQTTNQLLTEYQFKVEALQNKIEELKAILQVNNLI* |
| Ga0070748_10906082 | 3300006920 | Aqueous | MVNTNFSNETTNQLLTEYQFRVEALQNKIEELKAILEINNLT* |
| Ga0070748_10960333 | 3300006920 | Aqueous | MINTNYSNQTTNQLLTEYQFRVEALQNKIEELKAILEVNNLI* |
| Ga0070748_11894242 | 3300006920 | Aqueous | MVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILEINNLI* |
| Ga0098060_12123292 | 3300006921 | Marine | SQTTDAVLTEQQYRIEALQNKIEELKAILQVNNLI* |
| Ga0098045_11141703 | 3300006922 | Marine | MVKTNFSNQTTDQVLTENQYRVEALQNRIKELEAKLE |
| Ga0098045_11333862 | 3300006922 | Marine | SNETTNQLLSEYQFRVEALQNKIEELKAILQVNNLI* |
| Ga0098045_11568421 | 3300006922 | Marine | IINFKTKQMVNTNYSNQTTNQLITAYQYRVEALQNKIEELKAILEVNNIT* |
| Ga0070747_12492111 | 3300007276 | Aqueous | MITNFSDQTTNELLTQYEFRVEALQNKIEELKAILEINNLI* |
| Ga0099847_11885242 | 3300007540 | Aqueous | VYTFTNINFKTKQMVNTNFSNQTTNQLLTEYQFKVEALQNKIEELKAILQVNNLI* |
| Ga0115371_102023909 | 3300008470 | Sediment | MYSHFSQQTTDTLLNQYEFRIEALQNKIEELKALLEINNLI* |
| Ga0115371_103241023 | 3300008470 | Sediment | MGTNFSQQTMQTSITEHDYRVEALQKRIKELENEKR* |
| Ga0115371_105792773 | 3300008470 | Sediment | MDSHFSQQTTDTLLNQYEFRVEALQNKIEELKALLEINNLI* |
| Ga0102816_11201651 | 3300008999 | Estuarine | MVNTNYSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI* |
| Ga0102814_103451172 | 3300009079 | Estuarine | MITNFSEQTTNELLTQYQFRVEALQNKIEELKALLEINNLI* |
| Ga0114918_102645453 | 3300009149 | Deep Subsurface | MNTNFSDQVTNELITQYEFRIEALQNKIEELKALLEISNLI* |
| Ga0114918_103131173 | 3300009149 | Deep Subsurface | MNTNFSQQTTSELLTQYEFRVEALQNKIEELKALLEINNLI* |
| Ga0114915_10013398 | 3300009428 | Deep Ocean | MQSHFSQQTTDTLLNQYEYRIEALQNKIEELKAFLEINNSTTFL* |
| Ga0114915_10698574 | 3300009428 | Deep Ocean | MDSHFSQQTTDTLLNQYEFRIEALQNKIEELKALLEINNLI* |
| Ga0098056_10742002 | 3300010150 | Marine | MFIPLQLLILKTKQMVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILEVNNLT* |
| Ga0151664_10854422 | 3300011256 | Marine | TNINFKTKQMVNTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILEINNLT* |
| Ga0129327_103430012 | 3300013010 | Freshwater To Marine Saline Gradient | MVNTNFSNETTNQLLTEYQFKVEALQNKIEELKAILEINNLT* |
| Ga0181390_100012920 | 3300017719 | Seawater | MFIPLRLLILKTKQMVNTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0181401_10320493 | 3300017727 | Seawater | MVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILEVNNLI |
| Ga0181400_11275381 | 3300017752 | Seawater | MINTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILEVNNLI |
| Ga0181430_12245921 | 3300017772 | Seawater | MVKTNFSNQTTDAVLTEQQYRIEALQNKIEELKAILEVNN |
| Ga0192945_100460704 | 3300019036 | Marine | MRTNFSEQTTNELLTQYEFRVEALQNKIEELKALLEINNLI |
| Ga0211504_10210854 | 3300020347 | Marine | MVNTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0211653_103742952 | 3300020421 | Marine | MDRINFSNETTNQLLTEYQYRVEALQNKIEELKAILEVNNLI |
| Ga0211577_106291342 | 3300020469 | Marine | MINTNYSNQTTNQLLTEYQFRVEALQNKIEELKAILEINNLI |
| Ga0206683_102536682 | 3300021087 | Seawater | MVKTNFSNQTTDAVLTEHQYRVEALQNRIKELEAKLEINNLN |
| Ga0213863_1000048910 | 3300021371 | Seawater | MVNTNFSNQTTNQLLTEYQFKVEALQNKIEELKAILQVNNLI |
| Ga0213869_102438232 | 3300021375 | Seawater | MVKTNFSNQTTDAVLTEHQYRIEALQNRIKELETILIENNQ |
| Ga0222717_1000067334 | 3300021957 | Estuarine Water | MITNFSEQTTNELLTQYQFRVEALQNKIEELKAVLEINNLI |
| Ga0222717_1003241410 | 3300021957 | Estuarine Water | MFIPLQLLILKTKQMVNTNYSNQTTNQLITEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0222717_102264143 | 3300021957 | Estuarine Water | MVNTNFSNQTTNQLITEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0222718_101386662 | 3300021958 | Estuarine Water | MVNTNYSNQTTNQLITEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0222715_102922043 | 3300021960 | Estuarine Water | KQMVNTNYSNQTTNQLITEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0212030_10619962 | 3300022053 | Aqueous | MVNTNFSNQTTNQLLTEYQFKVEALQNKIEELKAILEINNLT |
| Ga0212023_10020991 | 3300022061 | Aqueous | MVNTNFSNQTTNQLLTEYQFKVEALQNGKEELKAILEINNLT |
| Ga0212023_10072844 | 3300022061 | Aqueous | MITNFSEQTTNELLTQYEFRVEALQNKIEELKALLEINNLI |
| Ga0212023_10267883 | 3300022061 | Aqueous | INKYCIMITNFSDQTTNELLTQYEFRVEALQNKIEELKALLEINNLI |
| Ga0212023_10274503 | 3300022061 | Aqueous | MITNFSDQTTNELLTQYEFRVEALQNKIEELKALL |
| Ga0196889_10050784 | 3300022072 | Aqueous | MITNFSDQTTNELLTQYEFRVEALQNKIEELKALLEINNLI |
| Ga0196889_10158872 | 3300022072 | Aqueous | MITNFSEQTTSELLTQYEFRVEALQNKIEELKALLEINNLI |
| Ga0212022_10327912 | 3300022164 | Aqueous | MVNTNFSNETTNQLLTEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0196887_10387261 | 3300022178 | Aqueous | MVNTNFSNETTNQLLTEYQFRVEALQNKIEELKAILEINNLT |
| Ga0224502_103494702 | 3300022218 | Sediment | MLKTNFSNQTTNQLITEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0224504_100282511 | 3300022308 | Sediment | DQTTNELLTQYQFRVEALQNKIEELKAVLEINNLI |
| (restricted) Ga0233411_100174432 | 3300023112 | Seawater | MITNFSEQTTNELLTQYQFRVEALQNKIEELKALLEINNLI |
| (restricted) Ga0233411_100489352 | 3300023112 | Seawater | MFIPLQILILKTKQMVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILQVNNLI |
| (restricted) Ga0233412_100304757 | 3300023210 | Seawater | MVNTNYSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI |
| (restricted) Ga0233412_101201561 | 3300023210 | Seawater | MINTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI |
| (restricted) Ga0255040_101195424 | 3300024059 | Seawater | NYSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI |
| (restricted) Ga0255039_104389361 | 3300024062 | Seawater | MVKTNFSNQTTDAVLTQHQYRVEALQNRIKELEAKLEINNLN |
| (restricted) Ga0233438_100054126 | 3300024255 | Seawater | MVNTNYSNQTTNQLLTEYQYRVEALQKKIEELKAILEINNLI |
| Ga0210003_10151348 | 3300024262 | Deep Subsurface | MNTNFSDQVTNELITQYEFRIEALQNKIEELKALLEISNLI |
| (restricted) Ga0233444_100188607 | 3300024264 | Seawater | MINTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILEINNLI |
| Ga0244775_112160561 | 3300024346 | Estuarine | NFKTKQMVNTNYSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0208667_10545223 | 3300025070 | Marine | NKMVKTNFSNQTTDQVLTENQYRVEALQNRIKELEAKLEINNLN |
| Ga0208791_10114165 | 3300025083 | Marine | FSNETTNQLLSEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0208298_100314111 | 3300025084 | Marine | MVKTNFSNQTTDQVLTENQYRVEALQNRIKELEAKLEINNLN |
| Ga0208792_10488821 | 3300025085 | Marine | MVKTNFSNQTTDQVLTEHQYRVEALQNRIKELEAKLEINNLN |
| Ga0208434_10127102 | 3300025098 | Marine | MFIPLQLLILKTKQMVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILQVNNLI |
| Ga0208013_10378233 | 3300025103 | Marine | MVNTNFSNETTNQLLSEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0208013_10452024 | 3300025103 | Marine | MINTNFSNQTTNQLLTEYQFRVEALQNKIEELKAILEVNNLI |
| Ga0208793_10207725 | 3300025108 | Marine | MLNTNFSNQTTNQLISEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0209337_10308624 | 3300025168 | Marine | MVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILQVNNLI |
| Ga0208814_10003328 | 3300025276 | Deep Ocean | MQSHFSQQTTDTLLNQYEYRIEALQNKIEELKAFLEINNSTTFL |
| Ga0208814_11124301 | 3300025276 | Deep Ocean | MDSHFSQQTTDTLLNQYEFRIEALQNKIEELKALLEINNLI |
| Ga0208814_11158102 | 3300025276 | Deep Ocean | MDSHFSQQTTDTLLNQYEFRIEALQNKIEELKAVLEINNLI |
| Ga0208660_10112137 | 3300025570 | Aqueous | MITNFSEQTTSDLLTQYEFRVEALQNKIEELKALLEINNLI |
| Ga0209194_11282691 | 3300025632 | Pelagic Marine | KNIQMLNTNFSNQTTNQLISEYQFRVEALQNKIEELKAILQVNNLI |
| Ga0208643_10533711 | 3300025645 | Aqueous | MVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILEINNLI |
| Ga0208134_10663324 | 3300025652 | Aqueous | MITNFSEQTTSELLTQYEFRVEALQNKIEELKALLEINNL |
| Ga0208134_11573442 | 3300025652 | Aqueous | KQKQMINTNYSNQTTNQLLTEYQFRVEALQNKIEELKAILEINNLI |
| Ga0209666_10390074 | 3300025870 | Marine | MVNTNFSNQTTNQLITEYQFRVEALQNKIEELKAILEINNLI |
| Ga0208970_10395282 | 3300027298 | Marine | MFIPLQILILKTKQMVNTNFSNQTTNQLLTEYQYKVEALQNKIEELKAILQVNNLI |
| Ga0209692_104193241 | 3300027828 | Marine Sediment | NKMVKTNFSNQTTDAVLTEQQYRIEALQNKIEELKAILETNNLI |
| (restricted) Ga0233415_1000450017 | 3300027861 | Seawater | MFIPLQILILKTKQMVNTNYSNQTTNQLLTEYQYRVEALQNKIEELKAILQVNNLI |
| (restricted) Ga0233414_100602085 | 3300028045 | Seawater | MITNFSEQTTNELLTQYQFRVEALQNKIEELKAILEINNLI |
| Ga0256368_10204454 | 3300028125 | Sea-Ice Brine | MNTNFSEQTTNELLTQYEFRIEALQNKIEELKALLEINNLI |
| Ga0257126_11068463 | 3300028287 | Marine | MINTNYSNQTTNQLITEYQYRVEALQKKIEELKAILEVNNLI |
| Ga0307488_101637304 | 3300031519 | Sackhole Brine | MNTHFSEQTTNELLTQYEFRIEALQNKIEELKALLEINNLI |
| Ga0307488_103376754 | 3300031519 | Sackhole Brine | MNTNFSEQTTNELLTQYEFRVEALQNKIEELKALLEINNLI |
| Ga0307489_103701894 | 3300031569 | Sackhole Brine | MNTNFSEQTTNELLTQYEFRIEALQNKIEELKALLEISNLI |
| Ga0307984_10198752 | 3300031658 | Marine | MDSHFSEQTTDTLLNQYEFRIDALQNKIEELKAVLEINNLI |
| Ga0307984_10986832 | 3300031658 | Marine | MNTNFSPQTTESLLTQYEFRIVALQNKIEELKAQIEVSQIFR |
| Ga0307375_101629143 | 3300031669 | Soil | MNTNFSEQVTNELITQYEFRIEALQNKIEELKALLEISNLI |
| Ga0316202_100119691 | 3300032277 | Microbial Mat | KQMVNTNFSNQTTNQLLTEYQYRVEALQNKIEELKAILQVNNLI |
| Ga0316202_101120384 | 3300032277 | Microbial Mat | MVNTNYSNQTTNQLLTEYQFRVVALQNKIEELKAILQVNNLI |
| Ga0314858_034084_306_476 | 3300033742 | Sea-Ice Brine | MFIPLQILILKTKQMVNTNYSNQTTNQLLTEYQFRVEALQNKIEELKAILQVNNLI |
| ⦗Top⦘ |