| Basic Information | |
|---|---|
| Family ID | F070124 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MEKNQTNLEDLIKKMENLPVPERTCNIDDETCESCSG |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 11.38 % |
| % of genes from short scaffolds (< 2000 bps) | 60.16 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.285 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (23.577 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.488 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.431 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.32% β-sheet: 0.00% Coil/Unstructured: 75.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF01510 | Amidase_2 | 46.34 |
| PF13385 | Laminin_G_3 | 8.94 |
| PF14550 | Peptidase_S78_2 | 4.88 |
| PF12684 | DUF3799 | 3.25 |
| PF04466 | Terminase_3 | 2.44 |
| PF02562 | PhoH | 0.81 |
| PF03592 | Terminase_2 | 0.81 |
| PF03382 | DUF285 | 0.81 |
| PF02195 | ParBc | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 2.44 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.81 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.81 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.28 % |
| All Organisms | root | All Organisms | 44.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2236876001|none_p340448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Pusillimonas (ex Stolz et al. 2005) → unclassified Pusillimonas → Pusillimonas sp. (ex Stolz et al. 2005) | 526 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10007133 | Not Available | 7632 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10012092 | Not Available | 5470 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10030772 | All Organisms → Viruses → Predicted Viral | 2512 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10058075 | Not Available | 1644 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10022709 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3222 | Open in IMG/M |
| 3300001450|JGI24006J15134_10000630 | Not Available | 21554 | Open in IMG/M |
| 3300001460|JGI24003J15210_10001127 | Not Available | 11652 | Open in IMG/M |
| 3300001472|JGI24004J15324_10031253 | Not Available | 1724 | Open in IMG/M |
| 3300001589|JGI24005J15628_10140702 | Not Available | 747 | Open in IMG/M |
| 3300001965|GOS2243_1076261 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 1816 | Open in IMG/M |
| 3300002231|KVRMV2_100986451 | Not Available | 506 | Open in IMG/M |
| 3300005738|Ga0076926_119435 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 602 | Open in IMG/M |
| 3300005837|Ga0078893_10654111 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 811 | Open in IMG/M |
| 3300005837|Ga0078893_10959833 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1947 | Open in IMG/M |
| 3300006467|Ga0099972_13007658 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 928 | Open in IMG/M |
| 3300006622|Ga0101442_127641 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 2563 | Open in IMG/M |
| 3300006734|Ga0098073_1000505 | Not Available | 13280 | Open in IMG/M |
| 3300006735|Ga0098038_1014080 | Not Available | 3092 | Open in IMG/M |
| 3300006735|Ga0098038_1292078 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 507 | Open in IMG/M |
| 3300006737|Ga0098037_1003325 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 6843 | Open in IMG/M |
| 3300006752|Ga0098048_1011943 | All Organisms → Viruses → Predicted Viral | 3040 | Open in IMG/M |
| 3300006752|Ga0098048_1026159 | All Organisms → Viruses → Predicted Viral | 1921 | Open in IMG/M |
| 3300006789|Ga0098054_1048257 | All Organisms → Viruses → Predicted Viral | 1634 | Open in IMG/M |
| 3300006793|Ga0098055_1025143 | Not Available | 2507 | Open in IMG/M |
| 3300006802|Ga0070749_10000353 | Not Available | 30598 | Open in IMG/M |
| 3300006802|Ga0070749_10012828 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 5388 | Open in IMG/M |
| 3300006810|Ga0070754_10113016 | Not Available | 1329 | Open in IMG/M |
| 3300006916|Ga0070750_10003994 | Not Available | 8097 | Open in IMG/M |
| 3300006916|Ga0070750_10111295 | Not Available | 1262 | Open in IMG/M |
| 3300006924|Ga0098051_1088964 | Not Available | 833 | Open in IMG/M |
| 3300007276|Ga0070747_1019322 | Not Available | 2791 | Open in IMG/M |
| 3300007276|Ga0070747_1164314 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 794 | Open in IMG/M |
| 3300007344|Ga0070745_1120679 | All Organisms → Viruses → Predicted Viral | 1010 | Open in IMG/M |
| 3300007540|Ga0099847_1242258 | Not Available | 519 | Open in IMG/M |
| 3300009002|Ga0102810_1233388 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300009505|Ga0115564_10275726 | Not Available | 849 | Open in IMG/M |
| 3300009507|Ga0115572_10166459 | Not Available | 1287 | Open in IMG/M |
| 3300009550|Ga0115013_10191286 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 1220 | Open in IMG/M |
| 3300009790|Ga0115012_10003463 | Not Available | 9346 | Open in IMG/M |
| 3300010149|Ga0098049_1149892 | Not Available | 721 | Open in IMG/M |
| 3300010150|Ga0098056_1138002 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 825 | Open in IMG/M |
| 3300010392|Ga0118731_113246483 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 667 | Open in IMG/M |
| 3300011128|Ga0151669_122638 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 683 | Open in IMG/M |
| 3300011261|Ga0151661_1035741 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 1856 | Open in IMG/M |
| 3300012920|Ga0160423_10883982 | Not Available | 600 | Open in IMG/M |
| 3300017708|Ga0181369_1113707 | Not Available | 554 | Open in IMG/M |
| 3300017714|Ga0181412_1048117 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1089 | Open in IMG/M |
| 3300017714|Ga0181412_1129067 | Not Available | 578 | Open in IMG/M |
| 3300017717|Ga0181404_1073598 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 847 | Open in IMG/M |
| 3300017726|Ga0181381_1000049 | Not Available | 33032 | Open in IMG/M |
| 3300017726|Ga0181381_1051990 | Not Available | 898 | Open in IMG/M |
| 3300017727|Ga0181401_1073912 | Not Available | 896 | Open in IMG/M |
| 3300017728|Ga0181419_1000679 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 11901 | Open in IMG/M |
| 3300017728|Ga0181419_1088593 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 769 | Open in IMG/M |
| 3300017741|Ga0181421_1089810 | Not Available | 802 | Open in IMG/M |
| 3300017743|Ga0181402_1006682 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3618 | Open in IMG/M |
| 3300017743|Ga0181402_1040442 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1276 | Open in IMG/M |
| 3300017749|Ga0181392_1015185 | Not Available | 2486 | Open in IMG/M |
| 3300017749|Ga0181392_1152976 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 675 | Open in IMG/M |
| 3300017753|Ga0181407_1003174 | Not Available | 5025 | Open in IMG/M |
| 3300017758|Ga0181409_1004937 | Not Available | 4678 | Open in IMG/M |
| 3300017769|Ga0187221_1229182 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 530 | Open in IMG/M |
| 3300017772|Ga0181430_1178033 | Not Available | 612 | Open in IMG/M |
| 3300017781|Ga0181423_1005107 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5818 | Open in IMG/M |
| 3300017782|Ga0181380_1123449 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 890 | Open in IMG/M |
| 3300017783|Ga0181379_1096038 | Not Available | 1089 | Open in IMG/M |
| 3300018416|Ga0181553_10647786 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 555 | Open in IMG/M |
| 3300018642|Ga0188867_1007984 | Not Available | 539 | Open in IMG/M |
| 3300020166|Ga0206128_1001122 | Not Available | 28212 | Open in IMG/M |
| 3300020182|Ga0206129_10088941 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1674 | Open in IMG/M |
| 3300020258|Ga0211529_1000818 | Not Available | 5324 | Open in IMG/M |
| 3300020347|Ga0211504_1099797 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 654 | Open in IMG/M |
| 3300020347|Ga0211504_1112827 | Not Available | 607 | Open in IMG/M |
| 3300020347|Ga0211504_1123621 | Not Available | 574 | Open in IMG/M |
| 3300020442|Ga0211559_10016208 | All Organisms → Viruses → Predicted Viral | 3794 | Open in IMG/M |
| 3300020469|Ga0211577_10017671 | Not Available | 5683 | Open in IMG/M |
| 3300020469|Ga0211577_10566540 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 680 | Open in IMG/M |
| 3300020474|Ga0211547_10026501 | Not Available | 3219 | Open in IMG/M |
| 3300021085|Ga0206677_10000718 | Not Available | 31490 | Open in IMG/M |
| 3300021185|Ga0206682_10276319 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 738 | Open in IMG/M |
| 3300021335|Ga0213867_1020221 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 2728 | Open in IMG/M |
| 3300021373|Ga0213865_10024752 | All Organisms → Viruses → Predicted Viral | 3384 | Open in IMG/M |
| 3300021373|Ga0213865_10024850 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 3377 | Open in IMG/M |
| 3300021373|Ga0213865_10028012 | All Organisms → Viruses | 3168 | Open in IMG/M |
| 3300021373|Ga0213865_10047439 | Not Available | 2384 | Open in IMG/M |
| 3300021957|Ga0222717_10000709 | Not Available | 28533 | Open in IMG/M |
| 3300022057|Ga0212025_1060557 | Not Available | 654 | Open in IMG/M |
| 3300022072|Ga0196889_1098461 | Not Available | 534 | Open in IMG/M |
| 3300022178|Ga0196887_1091164 | Not Available | 696 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10323771 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 660 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10371559 | Not Available | 616 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10001010 | Not Available | 33457 | Open in IMG/M |
| 3300024326|Ga0228652_1105491 | Not Available | 644 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10318965 | Not Available | 728 | Open in IMG/M |
| 3300025026|Ga0207879_101799 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 1503 | Open in IMG/M |
| 3300025057|Ga0208018_100115 | Not Available | 29996 | Open in IMG/M |
| 3300025086|Ga0208157_1001584 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 10095 | Open in IMG/M |
| 3300025086|Ga0208157_1035095 | Not Available | 1424 | Open in IMG/M |
| 3300025102|Ga0208666_1007482 | All Organisms → Viruses → Predicted Viral | 3956 | Open in IMG/M |
| 3300025103|Ga0208013_1035863 | Not Available | 1397 | Open in IMG/M |
| 3300025108|Ga0208793_1036941 | Not Available | 1583 | Open in IMG/M |
| 3300025127|Ga0209348_1049741 | Not Available | 1419 | Open in IMG/M |
| 3300025132|Ga0209232_1062043 | Not Available | 1336 | Open in IMG/M |
| 3300025168|Ga0209337_1000558 | Not Available | 30180 | Open in IMG/M |
| 3300025652|Ga0208134_1089173 | Not Available | 875 | Open in IMG/M |
| 3300025652|Ga0208134_1147204 | Not Available | 597 | Open in IMG/M |
| 3300025671|Ga0208898_1017918 | All Organisms → Viruses → Predicted Viral | 3233 | Open in IMG/M |
| 3300025759|Ga0208899_1000640 | Not Available | 26159 | Open in IMG/M |
| 3300025810|Ga0208543_1130339 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 592 | Open in IMG/M |
| 3300025887|Ga0208544_10358244 | Not Available | 553 | Open in IMG/M |
| 3300027506|Ga0208973_1004229 | All Organisms → Viruses | 5445 | Open in IMG/M |
| 3300027859|Ga0209503_10000650 | Not Available | 19803 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10425686 | Not Available | 620 | Open in IMG/M |
| 3300029309|Ga0183683_1004634 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4396 | Open in IMG/M |
| 3300029309|Ga0183683_1005227 | Not Available | 3992 | Open in IMG/M |
| 3300029309|Ga0183683_1024234 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 1167 | Open in IMG/M |
| 3300029318|Ga0185543_1018206 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1666 | Open in IMG/M |
| 3300031519|Ga0307488_10024748 | All Organisms → Viruses → Predicted Viral | 4814 | Open in IMG/M |
| 3300031774|Ga0315331_10033373 | Not Available | 3816 | Open in IMG/M |
| 3300032254|Ga0316208_1050056 | Not Available | 1257 | Open in IMG/M |
| 3300032274|Ga0316203_1024464 | Not Available | 1771 | Open in IMG/M |
| 3300032274|Ga0316203_1208489 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED209 | 538 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 23.58% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 18.70% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.63% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.76% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.88% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.06% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 2.44% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 2.44% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.44% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.63% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.63% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.63% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.63% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.81% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.81% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.81% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.81% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.81% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.81% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2236876001 | Marine microbial communities from Columbia River, CM, sample from CR-7km from mouth, GS312-0p1-CR7-chlmax | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300005738 | Seawater microbial communities from Vineyard Sound, MA, USA - sterilised with crude oil T0 | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006622 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ08 time point | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011261 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02 | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018642 | Metatranscriptome of marine microbial communities from Baltic Sea - GS695_0p1 | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020182 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2 | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300025026 | Marine viral communities from the Pacific Ocean - LP-24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027506 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| none_3404481 | 2236876001 | Marine Estuarine | VNGKNQTNLEDLIKKMENLPVPERTCNIDDETCESCSG |
| DelMOSum2010_100071338 | 3300000101 | Marine | MEKNQTNLEDLIKRMENLPVPERTCNIDDETCESCSG* |
| DelMOSum2010_100120925 | 3300000101 | Marine | MEKNQTNLEDLIKRMENLPVPERTCNIDDDTCESCSG* |
| DelMOSpr2010_100307722 | 3300000116 | Marine | MEKKQTDLEDLIKRMESLPVPERTCNIDDETCESCSG* |
| DelMOSpr2010_100580753 | 3300000116 | Marine | MEKNNQTNLEDLIKRMENLPVPERTCNIDDETCESCSG* |
| DelMOWin2010_100227095 | 3300000117 | Marine | MEKNNQTNLEELIKKLEKVPVPERTCNIDDETCESCSG* |
| JGI24006J15134_1000063026 | 3300001450 | Marine | MEKNNQTNLEDLIKKLENLPVPERTCNIENETCESCSG* |
| JGI24003J15210_100011275 | 3300001460 | Marine | MNKQTNLEELIKKMEKLPVPERTCNIDDETCESCSG* |
| JGI24004J15324_100312535 | 3300001472 | Marine | MEKNQTNLEDLIKKMENLPVPERTCNIDDESCESCSG* |
| JGI24005J15628_101407021 | 3300001589 | Marine | MEKNNQTNLEDLIKRMENLPVPERTCNIDDDTCESC |
| GOS2243_10762612 | 3300001965 | Marine | MDNKQTNLEELIKKMEKLPVPERTCNIEDENCESCSG* |
| KVRMV2_1009864512 | 3300002231 | Marine Sediment | MEKNNQTNLQELIKKLENVPVPERTCNIDDETCESCSG* |
| Ga0076926_1194352 | 3300005738 | Marine | MEKNQTNLEDLIKKMENLPVPERTCNIDDETCESCSG* |
| Ga0078893_106541112 | 3300005837 | Marine Surface Water | MEKNNQTNLEDLIKKMENLPVPERTCNIDDETCESC |
| Ga0078893_109598333 | 3300005837 | Marine Surface Water | MEKNNQTNLEELIKKLENVPVPERTCNIDDETCESCSG* |
| Ga0099972_130076582 | 3300006467 | Marine | MEKNQTNLEDLIKRMENLPVPERTCNIENETCESCSG* |
| Ga0101442_1276412 | 3300006622 | Marine Surface Water | MEKNNQTNLEDLIKRMENVPVPERTCNIDDETCESCSG* |
| Ga0098073_100050511 | 3300006734 | Marine | MEKNNQTNLEDLIKKLEKLPVPERTCNIDDETCESCSG* |
| Ga0098038_10140803 | 3300006735 | Marine | MEKNNQTNLEELIKKLEKVPVPERTCNIEDETCESCSG* |
| Ga0098038_12920782 | 3300006735 | Marine | MDNRQTNLEDLIKKMEKLPVPERTYNIDDENCESCSG* |
| Ga0098037_10033252 | 3300006737 | Marine | MDNRQTNLEDLIKKMEKLPVPERTCNIDDENFESCSG* |
| Ga0098048_10119433 | 3300006752 | Marine | MEKNQTNLEDLIKRMENVPVPERTCNIEDESCESCSG* |
| Ga0098048_10261593 | 3300006752 | Marine | MEKNNQTNLEDLIKKMENLPVPERTCNIDDETCESCSG* |
| Ga0098054_10482574 | 3300006789 | Marine | MEKNQTNLEDLIKRMEKVPVPERTCNIEDESCESCSG* |
| Ga0098055_10251433 | 3300006793 | Marine | MEKNNQTNLEDLIKRMENVPVPQRTCNIDDETCESCSG* |
| Ga0070749_1000035335 | 3300006802 | Aqueous | MDNKQTNLEDLIKKMEKLPVPERTCNIEDENCESCSG* |
| Ga0070749_100128283 | 3300006802 | Aqueous | MEKNQTNLEDLIKRMENVPVPERTCNIDDETCESCSG* |
| Ga0070754_101130162 | 3300006810 | Aqueous | MGKQTNLEELIKKMEKLPVPERTCNIDDDNCESCSG* |
| Ga0070750_100039949 | 3300006916 | Aqueous | MEKNNQTNLEELIKKLENIPVPERTCNIDDETCESCSG* |
| Ga0070750_101112952 | 3300006916 | Aqueous | MEKNQTNLEDLIKRMENVPVPERTCNIDDETCESCSR* |
| Ga0098051_10889643 | 3300006924 | Marine | MENNQTNLEGLIKKMENLPVPERTCNIDDETCESCSG* |
| Ga0070747_10193227 | 3300007276 | Aqueous | MNKQTDLEELIKKMEKLPVPERTCNIEDETCESCSG* |
| Ga0070747_11643142 | 3300007276 | Aqueous | MEKNQTNLEDLIKRMEKVPVPERTCNIDDETCESCSG* |
| Ga0070745_11206793 | 3300007344 | Aqueous | EKNNQTNLEDLIKRMENLPVPERTCNIDDETCESCSG* |
| Ga0099847_12422582 | 3300007540 | Aqueous | MEKNNQTNLEELIKKLENLPVPERTCNIDDETCESCSG* |
| Ga0102810_12333881 | 3300009002 | Estuarine | MEKNQTNLEDLIKRMENLPVPERTCNIDDESCESCSG* |
| Ga0115564_102757262 | 3300009505 | Pelagic Marine | MEKNQTNLEDLIKKMENLPVPERTCNIDDEICESCSG* |
| Ga0115572_101664592 | 3300009507 | Pelagic Marine | MEKNNQTNLEDLIKKLENLPVPERTCNIEDETCESCSG* |
| Ga0115013_101912862 | 3300009550 | Marine | MEKNNQTNLEELIKKLENIPVPERTCNIEDETCESCSG* |
| Ga0115012_1000346319 | 3300009790 | Marine | MEKNQTNLEDLIKRLEKVPVPERTCNIDDNNCESCSG* |
| Ga0098049_11498922 | 3300010149 | Marine | MEKNNQTNLEELIKRMENLPVPERTCSIDDETCESCSG* |
| Ga0098056_11380022 | 3300010150 | Marine | MDNRQTNLEDLIKKMEKLPVSERTCNIDDENCESCSG* |
| Ga0118731_1132464832 | 3300010392 | Marine | MEKNNQTNLEELIKKLENLPVPERTCNIDDETCESC |
| Ga0151669_1226381 | 3300011128 | Marine | MEKNQTNLEDLIKRMENFPVPERTCNIDDETCESCCG* |
| Ga0151661_10357413 | 3300011261 | Marine | MEKNQTNLEDLIKRMEKVPVPERTCNIDDESCESCWG* |
| Ga0160423_108839821 | 3300012920 | Surface Seawater | MEKNNQTNLEDLIKKMENLPVPERTCNIDDDTCESCSG* |
| Ga0181369_11137072 | 3300017708 | Marine | MEKNNQTNLEDLIKKMENLPVPELTCNIDDETCESC |
| Ga0181412_10481171 | 3300017714 | Seawater | MEKNNQTNLEDLIKKLENLPVPERTCNIDDETCESCSG |
| Ga0181412_11290671 | 3300017714 | Seawater | KMNKQTNLEDLIKKMEKLPVPERTCNIDDENCESCSG |
| Ga0181404_10735982 | 3300017717 | Seawater | MEKKNQTNLEDLIKKMENLPVPERTCNIDDETCESCSGXKS |
| Ga0181381_100004914 | 3300017726 | Seawater | MKNKQTDLEELIKSLENIPVPERTCDIEDENCESCSG |
| Ga0181381_10519902 | 3300017726 | Seawater | MEKNQTNLEDLIKKMENLPVPERTCNIDDETCESCSGXKS |
| Ga0181401_10739123 | 3300017727 | Seawater | MEKNNQTNLEDLIKRMENLPVPERTCNIDDETCESCSGXSN |
| Ga0181419_10006794 | 3300017728 | Seawater | MDNRQTNLEDLIKKMEKLPVPERTCNIDDENCESCSG |
| Ga0181419_10885933 | 3300017728 | Seawater | MEKNQTNLEDLIKKMEKVPVPERTCNIEDESCESCSG |
| Ga0181421_10898101 | 3300017741 | Seawater | MEKNQTNLEDLIKRMENLPVPERTCNIDDETCESCSGXSN |
| Ga0181402_10066825 | 3300017743 | Seawater | MEKNQTNLEDLIKKMESLPVPERTCNIDDDTCESCSG |
| Ga0181402_10404423 | 3300017743 | Seawater | MNKQTNLEDLIKKMEKLPVPERTCNIDDENCESCSG |
| Ga0181392_10151856 | 3300017749 | Seawater | MEKNNQTNLEDLIKKLENLPVPERTCNIEDETCESCSG |
| Ga0181392_11529762 | 3300017749 | Seawater | MEKNQTNLEDLIRKMENLPVPERTCNIDDETCESCSG |
| Ga0181407_10031745 | 3300017753 | Seawater | MEKNNQTNLEELIKKLEKVPVPERTCNIDDETCESCSG |
| Ga0181409_100493710 | 3300017758 | Seawater | MEKNQTNLEDLIKKMENLPVPERTCNIDNETCESCSG |
| Ga0187221_12291822 | 3300017769 | Seawater | MEKNQTNLEELIKKLEKVPVPERTCNIEDETCESCSGXK |
| Ga0181430_11780331 | 3300017772 | Seawater | QKKQMEKNNQTNLEELIKKLEKVPVPERTCNIDDETCESCSG |
| Ga0181423_10051078 | 3300017781 | Seawater | MEKNQTNLEDLIKRMENLPVPERTCNIEDENCESCSG |
| Ga0181380_11234492 | 3300017782 | Seawater | MEKNQTNLEDLIKKMENLPVPERTCNIDDESCESCSGXIN |
| Ga0181379_10960382 | 3300017783 | Seawater | MEKNNQTNLEDLIKKMENLPVPERTCNIDDDTCESCSG |
| Ga0181553_106477862 | 3300018416 | Salt Marsh | MEKNNQTNLEDLIKKMENLPVPERTCNINDETCESCSGXTN |
| Ga0188867_10079842 | 3300018642 | Freshwater Lake | MEKNQTNLEDLIKKMENLPVPERTCNIDDETCESSSXXX |
| Ga0206128_100112225 | 3300020166 | Seawater | MEKNNQTNLEDLIKRMENLPVPERTCNIDDETCESCSG |
| Ga0206129_100889413 | 3300020182 | Seawater | MEKNQTNLEDLIKKMENLPVPERTCNIDDETCESCSG |
| Ga0211529_10008187 | 3300020258 | Marine | MEKNNQTNLEELIKKLENVPVPERTCNIDDETCESCSG |
| Ga0211504_10997972 | 3300020347 | Marine | MEKNQTNLEDLIKKMENLPVPERTCNIDDETCESCSGXIN |
| Ga0211504_11128272 | 3300020347 | Marine | MNKQTNLEDLIKKMEKLPVPERTCDIDDENCESCSG |
| Ga0211504_11236212 | 3300020347 | Marine | MNKQTNLEELIKKMEKLPVPERTCNIDDETCESCSG |
| Ga0211559_100162088 | 3300020442 | Marine | MEKNNQTDLEDLIKKLEKLPVPERTCNIDDESCESCSG |
| Ga0211577_100176715 | 3300020469 | Marine | MEKNQTNLEDLIKRMENLPVPERTCNIDDENCESCSG |
| Ga0211577_105665402 | 3300020469 | Marine | MDNKQTNLEDLIKKMEKLPVPERTCNIEDDNCESCSG |
| Ga0211547_100265013 | 3300020474 | Marine | MEKNNQTNLEELIKKLENVPVPERTCNIENETCESCSG |
| Ga0206677_1000071813 | 3300021085 | Seawater | MEKNQTNLEDLIKRMENVPVPERTCNIEDESCESCSG |
| Ga0206682_102763192 | 3300021185 | Seawater | MEKNQTDLEDLIKRLEKIPTPERTCNIEDETCESCSG |
| Ga0213867_10202212 | 3300021335 | Seawater | MEKNQTNLEDLIKRMENLPVPERTCNIDDDTCESCSG |
| Ga0213865_100247521 | 3300021373 | Seawater | ILNMDNKQTNLEELIKKMEKLPVPERTCNIDDDNCESCSG |
| Ga0213865_100248503 | 3300021373 | Seawater | MNKQTDLEELIKKMEKLPVPERTCNIEDETCESCSG |
| Ga0213865_100280123 | 3300021373 | Seawater | MEKNNQTNLEDLIKRMENVPVPERTCNIDDETCESCSG |
| Ga0213865_100474392 | 3300021373 | Seawater | MEKNNQTNLEDLIKKMENLPVPERTCNIDDETCESCSG |
| Ga0222717_1000070924 | 3300021957 | Estuarine Water | MEKNQTNLEDLIKRMENVPVPERTCNIDDETCESCSG |
| Ga0212025_10605571 | 3300022057 | Aqueous | MGKQTNLEELIKKMEKLPVPERTCNIDDDNCESCSG |
| Ga0196889_10984611 | 3300022072 | Aqueous | MEKNQTNLEDLIKRMENLPVPERTCNIDDETCESCSG |
| Ga0196887_10911642 | 3300022178 | Aqueous | MEKNQTNLEDLIKRMENLPVPERTCNIDDETCESCSGXIN |
| (restricted) Ga0255039_103237712 | 3300024062 | Seawater | MEKNNQTNLEDLIKKLENLPVPERTCNIEDETCESCSGXKK |
| (restricted) Ga0255039_103715592 | 3300024062 | Seawater | MEKNQTNLEDLIKRMENLPVPERTCNIEDETCESCSG |
| (restricted) Ga0233444_1000101038 | 3300024264 | Seawater | MEKNQTDLEDLIKRLEKVPVPERTCNIEDENCESCSG |
| Ga0228652_11054912 | 3300024326 | Seawater | MEKNQTNLEDLIKKMENLPVPERTCNIDDETCESCSGXNN |
| (restricted) Ga0255046_103189653 | 3300024519 | Seawater | KNQTNLEDLIKRMENVPVPERTCNIDDETCESCSG |
| Ga0207879_1017992 | 3300025026 | Marine | MEKNQTNLEDLIKKMENLPVPERTCNIDDESCESCSG |
| Ga0208018_10011521 | 3300025057 | Marine | MEKNNQTNLEDLIKKLEKLPVPERTCNIDDETCESCSG |
| Ga0208157_10015844 | 3300025086 | Marine | MDNRQTNLEDLIKKMEKLPVPERTCNIDDENFESCSG |
| Ga0208157_10350953 | 3300025086 | Marine | MEKNNQTNLEELIKKLEKVPVPERTCNIEDETCESCSG |
| Ga0208666_10074822 | 3300025102 | Marine | MDNRQTNLEDLIKKMEKLPVPERTYNIDDENCESCSG |
| Ga0208013_10358633 | 3300025103 | Marine | MEKNQTNLEDLIKRMENVPVPQRTCNIDDETCESCSG |
| Ga0208793_10369414 | 3300025108 | Marine | MEKNNQTNLEDLIKRMENVPVPQRTCKIDDETCESCSG |
| Ga0209348_10497413 | 3300025127 | Marine | MEKNNQTNLQDLIKRMENLPVPERTCNIDDETCESCSG |
| Ga0209232_10620433 | 3300025132 | Marine | MEKNQTNLEDLIKKMESLPVPERTCNIDDETCESCSG |
| Ga0209337_100055843 | 3300025168 | Marine | MEKNNQTNLEDLIKKLENLPVPERTCNIENETCESCSG |
| Ga0208134_10891732 | 3300025652 | Aqueous | MEKNQTNLEDLIKRMENLPVPERTCNIDDETCESCSGXRS |
| Ga0208134_11472042 | 3300025652 | Aqueous | MEKNNQTNLEDLIKRMENLPVPERTCNIDDETCESCSGXIN |
| Ga0208898_10179182 | 3300025671 | Aqueous | MDNKQTNLEDLIKKMEKLPVPERTCNIEDENCESCSG |
| Ga0208899_100064010 | 3300025759 | Aqueous | MEKNNQTNLEELIKKLENIPVPERTCNIDDETCESCSG |
| Ga0208543_11303392 | 3300025810 | Aqueous | MEKNNQTNLEELIKKLENIPVPERTCNIDDETCESCSGXKK |
| Ga0208544_103582441 | 3300025887 | Aqueous | MEKNQTNLEDLIKRMENLPVPERTCNIDDETCESCSGXNN |
| Ga0208973_100422914 | 3300027506 | Marine | MEKNQTNLEDLIKRMQNVPVPERTCNIDDETCESCSG |
| Ga0209503_1000065016 | 3300027859 | Marine | MEKNNQTNLQELIKKLENIPVPERTCNIEDETCESCSG |
| (restricted) Ga0233414_104256862 | 3300028045 | Seawater | MEKNQTNLEDLIKRMENLPVPERTCNIDDDTCESCSGXIN |
| Ga0183683_10046342 | 3300029309 | Marine | MEKNNQTNLEQLIKKLENVPVPERTCNIEDESCESCSG |
| Ga0183683_10052278 | 3300029309 | Marine | MEKNNQTNLEELIKKLEKVPVPERTCNIEDESCESCSG |
| Ga0183683_10242343 | 3300029309 | Marine | MKNKQTDLEELIKSLENIPVPERTCDIENENCESCSG |
| Ga0185543_10182063 | 3300029318 | Marine | MEKNNQTNLEELIKKLENVPVPERTCNIEDETCESCSG |
| Ga0307488_100247482 | 3300031519 | Sackhole Brine | MEKKQTDLEDLIKRMENLPVPERTCNIDDETCESCSG |
| Ga0315331_100333738 | 3300031774 | Seawater | MKKNNQTNLEDLIKKLENVPVPERTCNIDDETCESCSG |
| Ga0316208_10500563 | 3300032254 | Microbial Mat | MKKNQTNLEDLIKRMENVPVPERTCNIDDETCESCSG |
| Ga0316203_10244643 | 3300032274 | Microbial Mat | MEKNQTNLEDLIKRMEKVPVPERTCNIDDETCESCSG |
| Ga0316203_12084892 | 3300032274 | Microbial Mat | MEKNQTNLEDLIKKMENLPVPERTCNIDDETCESCSGXRS |
| ⦗Top⦘ |