| Basic Information | |
|---|---|
| Family ID | F070095 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGTIALVYSIRLIRKDK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 91.87 % |
| % of genes near scaffold ends (potentially truncated) | 24.39 % |
| % of genes from short scaffolds (< 2000 bps) | 77.24 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.341 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (26.829 % of family members) |
| Environment Ontology (ENVO) | Unclassified (80.488 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (82.114 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.05% β-sheet: 0.00% Coil/Unstructured: 53.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF02675 | AdoMet_dc | 14.63 |
| PF02945 | Endonuclease_7 | 2.44 |
| PF01521 | Fe-S_biosyn | 0.81 |
| PF00255 | GSHPx | 0.81 |
| PF00041 | fn3 | 0.81 |
| PF14025 | DUF4241 | 0.81 |
| PF00011 | HSP20 | 0.81 |
| PF01391 | Collagen | 0.81 |
| PF10145 | PhageMin_Tail | 0.81 |
| PF06067 | DUF932 | 0.81 |
| PF04860 | Phage_portal | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 14.63 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.81 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.66 % |
| Unclassified | root | N/A | 46.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2199916473 | Not Available | 25101 | Open in IMG/M |
| 3300002835|B570J40625_100000109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 112996 | Open in IMG/M |
| 3300002835|B570J40625_100000320 | Not Available | 77705 | Open in IMG/M |
| 3300002835|B570J40625_101421211 | Not Available | 572 | Open in IMG/M |
| 3300003277|JGI25908J49247_10090116 | Not Available | 747 | Open in IMG/M |
| 3300003388|JGI25910J50241_10013375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2928 | Open in IMG/M |
| 3300003388|JGI25910J50241_10074687 | Not Available | 982 | Open in IMG/M |
| 3300003393|JGI25909J50240_1072783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 693 | Open in IMG/M |
| 3300003394|JGI25907J50239_1081421 | Not Available | 637 | Open in IMG/M |
| 3300003411|JGI25911J50253_10076978 | All Organisms → Viruses → Predicted Viral | 1065 | Open in IMG/M |
| 3300005517|Ga0070374_10476910 | Not Available | 623 | Open in IMG/M |
| 3300005581|Ga0049081_10015344 | Not Available | 2896 | Open in IMG/M |
| 3300005581|Ga0049081_10073947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
| 3300005581|Ga0049081_10102759 | Not Available | 1065 | Open in IMG/M |
| 3300005582|Ga0049080_10171568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella → unclassified Eikenella → Eikenella sp. HMSC061C02 | 722 | Open in IMG/M |
| 3300005582|Ga0049080_10277094 | Not Available | 543 | Open in IMG/M |
| 3300005584|Ga0049082_10057642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1363 | Open in IMG/M |
| 3300005584|Ga0049082_10065927 | All Organisms → Viruses → Predicted Viral | 1271 | Open in IMG/M |
| 3300005584|Ga0049082_10235605 | Not Available | 620 | Open in IMG/M |
| 3300005584|Ga0049082_10279050 | Not Available | 560 | Open in IMG/M |
| 3300005584|Ga0049082_10299642 | Not Available | 537 | Open in IMG/M |
| 3300005585|Ga0049084_10185366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300005805|Ga0079957_1070803 | All Organisms → Viruses → Predicted Viral | 2015 | Open in IMG/M |
| 3300005805|Ga0079957_1321388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
| 3300006484|Ga0070744_10228446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300006639|Ga0079301_1147896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300007973|Ga0105746_1259124 | Not Available | 600 | Open in IMG/M |
| 3300008107|Ga0114340_1015826 | All Organisms → Viruses → Predicted Viral | 3612 | Open in IMG/M |
| 3300008108|Ga0114341_10037713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3241 | Open in IMG/M |
| 3300008114|Ga0114347_1115051 | Not Available | 1016 | Open in IMG/M |
| 3300008116|Ga0114350_1191000 | Not Available | 515 | Open in IMG/M |
| 3300008116|Ga0114350_1192745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300008259|Ga0114841_1084824 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| 3300009068|Ga0114973_10077964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1906 | Open in IMG/M |
| 3300009068|Ga0114973_10185686 | All Organisms → Viruses → Predicted Viral | 1141 | Open in IMG/M |
| 3300009068|Ga0114973_10330305 | Not Available | 808 | Open in IMG/M |
| 3300009152|Ga0114980_10272017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300009155|Ga0114968_10039754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3091 | Open in IMG/M |
| 3300009159|Ga0114978_10000090 | Not Available | 70347 | Open in IMG/M |
| 3300009161|Ga0114966_10779029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300009161|Ga0114966_10806560 | Not Available | 506 | Open in IMG/M |
| 3300009183|Ga0114974_10185679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1279 | Open in IMG/M |
| 3300009187|Ga0114972_10360340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
| 3300010354|Ga0129333_10062611 | All Organisms → Viruses → Predicted Viral | 3466 | Open in IMG/M |
| 3300010885|Ga0133913_11428238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1758 | Open in IMG/M |
| 3300011010|Ga0139557_1013309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1580 | Open in IMG/M |
| 3300011010|Ga0139557_1019028 | Not Available | 1269 | Open in IMG/M |
| 3300011116|Ga0151516_10057 | Not Available | 57194 | Open in IMG/M |
| 3300012000|Ga0119951_1005346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6137 | Open in IMG/M |
| 3300012017|Ga0153801_1021516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1147 | Open in IMG/M |
| 3300012725|Ga0157610_1262475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300012772|Ga0138287_1219602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300013004|Ga0164293_10083277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2492 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10053348 | Not Available | 3189 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10150480 | Not Available | 1538 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10587495 | Not Available | 600 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10719073 | Not Available | 588 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10186130 | Not Available | 1590 | Open in IMG/M |
| (restricted) 3300013132|Ga0172372_10902624 | Not Available | 540 | Open in IMG/M |
| 3300013372|Ga0177922_10369817 | Not Available | 579 | Open in IMG/M |
| 3300014050|Ga0119952_1128390 | Not Available | 564 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10055174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3129 | Open in IMG/M |
| 3300014819|Ga0119954_1000059 | Not Available | 34219 | Open in IMG/M |
| 3300017723|Ga0181362_1056104 | Not Available | 814 | Open in IMG/M |
| 3300017788|Ga0169931_10392029 | Not Available | 1032 | Open in IMG/M |
| 3300017788|Ga0169931_10650143 | Not Available | 704 | Open in IMG/M |
| 3300020141|Ga0211732_1508290 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
| 3300020159|Ga0211734_10118188 | Not Available | 858 | Open in IMG/M |
| 3300020159|Ga0211734_10155896 | Not Available | 611 | Open in IMG/M |
| 3300020159|Ga0211734_10405226 | Not Available | 589 | Open in IMG/M |
| 3300020159|Ga0211734_10823314 | Not Available | 514 | Open in IMG/M |
| 3300020162|Ga0211735_10788086 | Not Available | 686 | Open in IMG/M |
| 3300020172|Ga0211729_10165264 | Not Available | 1509 | Open in IMG/M |
| 3300020506|Ga0208091_1025486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300020527|Ga0208232_1000001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 112505 | Open in IMG/M |
| 3300021961|Ga0222714_10113144 | All Organisms → Viruses → Predicted Viral | 1691 | Open in IMG/M |
| 3300021961|Ga0222714_10295157 | Not Available | 891 | Open in IMG/M |
| 3300022752|Ga0214917_10043523 | All Organisms → Viruses → Predicted Viral | 3141 | Open in IMG/M |
| 3300022752|Ga0214917_10089984 | Not Available | 1834 | Open in IMG/M |
| 3300022752|Ga0214917_10101863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1668 | Open in IMG/M |
| 3300022752|Ga0214917_10360622 | Not Available | 617 | Open in IMG/M |
| 3300023174|Ga0214921_10047696 | All Organisms → Viruses → Predicted Viral | 3826 | Open in IMG/M |
| 3300023174|Ga0214921_10055399 | All Organisms → Viruses → Predicted Viral | 3422 | Open in IMG/M |
| 3300023179|Ga0214923_10000206 | Not Available | 91654 | Open in IMG/M |
| 3300027114|Ga0208009_1057779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
| 3300027468|Ga0209247_1028262 | Not Available | 779 | Open in IMG/M |
| 3300027581|Ga0209651_1075712 | Not Available | 970 | Open in IMG/M |
| 3300027586|Ga0208966_1039789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1360 | Open in IMG/M |
| 3300027586|Ga0208966_1094853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella → unclassified Eikenella → Eikenella sp. HMSC061C02 | 821 | Open in IMG/M |
| 3300027608|Ga0208974_1056628 | Not Available | 1113 | Open in IMG/M |
| 3300027608|Ga0208974_1164375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300027649|Ga0208960_1050812 | All Organisms → Viruses → Predicted Viral | 1327 | Open in IMG/M |
| 3300027679|Ga0209769_1156691 | Not Available | 719 | Open in IMG/M |
| 3300027689|Ga0209551_1091791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
| 3300027720|Ga0209617_10281203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1096843 | All Organisms → Viruses → Predicted Viral | 1436 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1094267 | All Organisms → Viruses → Predicted Viral | 1350 | Open in IMG/M |
| 3300027733|Ga0209297_1132243 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300027736|Ga0209190_1024175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3355 | Open in IMG/M |
| 3300027736|Ga0209190_1243241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300027759|Ga0209296_1000248 | Not Available | 46506 | Open in IMG/M |
| 3300027770|Ga0209086_10074412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1810 | Open in IMG/M |
| 3300027797|Ga0209107_10499366 | Not Available | 540 | Open in IMG/M |
| 3300027798|Ga0209353_10206729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Neisseriales → Neisseriaceae → Eikenella → unclassified Eikenella → Eikenella sp. HMSC061C02 | 858 | Open in IMG/M |
| (restricted) 3300027970|Ga0247837_1191718 | Not Available | 858 | Open in IMG/M |
| 3300027971|Ga0209401_1082094 | All Organisms → Viruses → Predicted Viral | 1368 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1132932 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300028025|Ga0247723_1011638 | All Organisms → Viruses → Predicted Viral | 3356 | Open in IMG/M |
| (restricted) 3300028114|Ga0247835_1104251 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300029930|Ga0119944_1027833 | Not Available | 740 | Open in IMG/M |
| 3300031758|Ga0315907_10098368 | All Organisms → Viruses → Predicted Viral | 2509 | Open in IMG/M |
| 3300031857|Ga0315909_10877733 | Not Available | 556 | Open in IMG/M |
| 3300032116|Ga0315903_10423429 | All Organisms → Viruses → Predicted Viral | 1076 | Open in IMG/M |
| 3300034062|Ga0334995_0652454 | Not Available | 601 | Open in IMG/M |
| 3300034071|Ga0335028_0298249 | Not Available | 956 | Open in IMG/M |
| 3300034082|Ga0335020_0084597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1627 | Open in IMG/M |
| 3300034101|Ga0335027_0030082 | All Organisms → Viruses → Predicted Viral | 4540 | Open in IMG/M |
| 3300034104|Ga0335031_0771747 | Not Available | 542 | Open in IMG/M |
| 3300034112|Ga0335066_0517869 | Not Available | 630 | Open in IMG/M |
| 3300034116|Ga0335068_0052373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2387 | Open in IMG/M |
| 3300034116|Ga0335068_0447112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300034168|Ga0335061_0172423 | All Organisms → Viruses → Predicted Viral | 1148 | Open in IMG/M |
| 3300034283|Ga0335007_0491283 | Not Available | 739 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 26.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 14.63% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 13.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.88% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.44% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.63% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.63% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.81% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.81% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.81% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.81% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.81% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.81% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027468 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028114 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_13.5m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200104943 | 2199352005 | Freshwater | MEFYADLEYISLYVNNLYPNGIAIELPTWLLVGTIALVWSIRQWKK |
| B570J40625_10000010921 | 3300002835 | Freshwater | MEFYADLDYISFYINNLYPNGVAIEIPTWLIVGTISFIYSIKLIRKDR* |
| B570J40625_10000032084 | 3300002835 | Freshwater | MEFYADLEYISLYVNNLYPNGIAIELPTWLLVGTIALVWSIRQWKK* |
| B570J40625_1014212111 | 3300002835 | Freshwater | VEFYADLEYVSLYINNLYPNGVAIEIPTWLLFGTIAFIWSVKQWKK* |
| JGI25908J49247_100901162 | 3300003277 | Freshwater Lake | VEFYADLEYISLYVNNLYPNGIAIELPTWLFFGTIALVWSVRQWRK* |
| JGI25910J50241_100133756 | 3300003388 | Freshwater Lake | MEFYIDLDYVSLYVDNLYPNGIGIDIPTWVLFGTIALIYSIKLIRRDK* |
| JGI25910J50241_100746874 | 3300003388 | Freshwater Lake | VEFYADLEYISLYVSNLYPSGIAIEIPTWLLVGTIALVWSVRQWRK* |
| JGI25909J50240_10727832 | 3300003393 | Freshwater Lake | MEFYIDLDYVSLYVDNLYPNGIGIDXPTWVLFGTIALXYSIKLIRRDK* |
| JGI25907J50239_10814213 | 3300003394 | Freshwater Lake | VEFYADLEYISLYVSNLYPSGIAIEIPTWLLVGTIALVWSVRQWKK* |
| JGI25911J50253_100769783 | 3300003411 | Freshwater Lake | VEFYADLEYISLYVNNLYPNGIAIELPTWLLVGTIALVWSVRQWRK* |
| Ga0070374_104769103 | 3300005517 | Freshwater Lake | VEFYADLDYISLYVNNLYPNGIAIELPTWLFFGTIALVWSVRQWRK* |
| Ga0049081_100153442 | 3300005581 | Freshwater Lentic | VEFYADLDYISFYINNLYPNGVAIEIPTWLLFGTVAFIWSVKQWKK* |
| Ga0049081_100739475 | 3300005581 | Freshwater Lentic | MEFYADLEYISLYVSNLYPSGIAIEIPTWLLVGTVALVWSVRQWKK* |
| Ga0049081_101027592 | 3300005581 | Freshwater Lentic | VEFYADLDYISFYINNLYPNGVAIEIPTWLLFGTIAFIWSVKQWKK* |
| Ga0049080_101715682 | 3300005582 | Freshwater Lentic | MEFYIDLDYVSLYVDNLYPNGIGIDIPTWVLFGTIALVYSIKLIRRDK* |
| Ga0049080_102770941 | 3300005582 | Freshwater Lentic | VEFYADLDYISFYINNLYPSGVAIEIPTWLLFGSIAFIYSIRLLRKDK* |
| Ga0049082_100576423 | 3300005584 | Freshwater Lentic | MEFYADLDYISFYINNLYPSGVAIEIPTWLLFGTIAFIWSVKQWKK* |
| Ga0049082_100659273 | 3300005584 | Freshwater Lentic | MEFYIDLEYVSLYVDNLYPNGIGIDIPTWILFGTIALVYSIKLIRRDK* |
| Ga0049082_102356051 | 3300005584 | Freshwater Lentic | VEFYADLEYISLYVSNLYPSGIAIEIPTWLLVGTVALVWSVRQWRK* |
| Ga0049082_102790503 | 3300005584 | Freshwater Lentic | MEFYADLDYISLYVNNLYPNGIAIELPTWLFFGTIALVWS |
| Ga0049082_102996422 | 3300005584 | Freshwater Lentic | MEFYADLDYISLYINNLYPNGVAIEIPTWLLVGTIAFAYSIRLIRRDK* |
| Ga0049084_101853662 | 3300005585 | Freshwater Lentic | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGTIALAWSIRQWKN* |
| Ga0079957_10708036 | 3300005805 | Lake | MEFYLDLEYLALYVNNLYPNGVAIEIPTWLLVSTIGLIYSIRLIRRDK* |
| Ga0079957_13213881 | 3300005805 | Lake | MEFYADLEYIAFYINNLYPNGVAIELPTWLLVSTIGLVYSIRLIRKER* |
| Ga0070744_102284461 | 3300006484 | Estuarine | MEFYADLDYISFYINNLYPNGVAIEIPTWLLFGTVAFI |
| Ga0079301_11478964 | 3300006639 | Deep Subsurface | VEFYLDLDYLALYINNLYPTGVAIEIPTWLIVATIGLVYSIRIIRKEK* |
| Ga0105746_12591243 | 3300007973 | Estuary Water | VEFYANLDYISFYINNLYPNGVAIEIPTWLLFGTIAFIWSVKQWKK* |
| Ga0114340_101582611 | 3300008107 | Freshwater, Plankton | MEFYLDLDYLSFYVNNLYPSGIAIEIPTWVIVGTICLTYSIKLLRRDK* |
| Ga0114341_100377139 | 3300008108 | Freshwater, Plankton | MEFYLDLDYLSFYVNNLYPSGIAIEIPTWVIVGTISFIYSIKLLRRDR* |
| Ga0114347_11150514 | 3300008114 | Freshwater, Plankton | ADLDYISFYINNLYPNGVAIEIPTWLLFGTIAFIWSVKQWKK* |
| Ga0114350_11910003 | 3300008116 | Freshwater, Plankton | VEFYADLDYISFYINNLYPNGVAIEIPTWLLFGTVAF |
| Ga0114350_11927453 | 3300008116 | Freshwater, Plankton | MEFYADLDYISFYINNLYPSGVAIEIPTWLLIGTIALVYSIRL |
| Ga0114841_10848241 | 3300008259 | Freshwater, Plankton | MEFYADLDYISFYINNLYPSGVAIEIPTWLLIGTIALVYSIRLIRNDK* |
| Ga0114973_100779644 | 3300009068 | Freshwater Lake | VEFYADLDYISFYINNLYPSGVAIEIPTWLLVGSILFIYSIKLIKKDR* |
| Ga0114973_101856863 | 3300009068 | Freshwater Lake | MEFYADLDYISFYINNLYPNGVAIEIPTWLLIGTIALVYSIRLIRKDK* |
| Ga0114973_103303053 | 3300009068 | Freshwater Lake | MEFYADLDYISFYINNLYPNGVAIEIPTWLLIGTITLVYSIRLIRKD |
| Ga0114980_102720173 | 3300009152 | Freshwater Lake | MEFYADLDYISFYINNLYPNGVAIEIPTWLLVGSIAFIYSIKLIRNDK* |
| Ga0114968_100397543 | 3300009155 | Freshwater Lake | MEFYADLDYISFYINNLYPSGVAIEIPTWLLIGSIAFIYSIKLIRKDK* |
| Ga0114978_1000009082 | 3300009159 | Freshwater Lake | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGTISLVYSIRLIRNDK* |
| Ga0114966_107790293 | 3300009161 | Freshwater Lake | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGTIALVYSIRLIRKDK* |
| Ga0114966_108065601 | 3300009161 | Freshwater Lake | VEFYADLDYISFYINNLYPSGVAIEIPTWLLVGSIAFIYSIKLIRNDK* |
| Ga0114974_101856792 | 3300009183 | Freshwater Lake | VEFYADLDYISFYVNNLYPNGVAIEIPTWLLVGSIAFIYSIKLIRNDK* |
| Ga0114972_103603401 | 3300009187 | Freshwater Lake | VEFYADLDYISFYINNLYPNGVAIEIPTWLLVGTIALVYSIRLIRKDK* |
| Ga0129333_100626119 | 3300010354 | Freshwater To Marine Saline Gradient | MEFYLDLDYLSFYVDNLYPNGIAIEIPTWVIVGTISLIYSIRLLKKDK* |
| Ga0133913_114282385 | 3300010885 | Freshwater Lake | DYISFYINNLYPSGVAIEIPTWLLVGSILFIYSIKLIKKDR* |
| Ga0139557_10133093 | 3300011010 | Freshwater | MEFYADLDYISLYINNLYPNGVAIEIPTWLLVGTIAFAYSIRLIRRDND* |
| Ga0139557_10190282 | 3300011010 | Freshwater | MEFYADLDYVSFYINNLYPNGVAIEIPTWLLFGTIALVWSIRQWKN* |
| Ga0151516_1005728 | 3300011116 | Freshwater | MELTIDLEYFALYISNLYPSGIAIEIPTWLLFGGISLAWSIRQWRK* |
| Ga0119951_100534612 | 3300012000 | Freshwater | MEFYANLDYISFYINNLYPSGVAIEIPTWLLVGSIGLIWSIRQWKK* |
| Ga0153801_10215161 | 3300012017 | Freshwater | EFYADLDYISFYINNLYPSGVAIEIPTWLLVGTIALVYSIRLIRKDK* |
| Ga0157610_12624753 | 3300012725 | Freshwater | MEFYADLDYISFYINNLYPNGVAIEIPTWLIVATIGLVYSIRIIRKEK* |
| Ga0138287_12196023 | 3300012772 | Freshwater Lake | MEFYADLDYISFYINNLYPNGVAIEIPTWLLIGSIAFIYSIKLIRKDK* |
| Ga0164293_100832771 | 3300013004 | Freshwater | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGSIAFIYSIRLLRKDK* |
| (restricted) Ga0172367_100533487 | 3300013126 | Freshwater | MEFYLDLDYLSFYINNLYPNGVAIEIPTWLLVGAIGLWYSVKVIKKGR* |
| (restricted) Ga0172367_101504803 | 3300013126 | Freshwater | MEFYLDLEYLSLYINNLYPNGIAIEIPTWVIVATIGLWFSVRVIRKTR* |
| (restricted) Ga0172367_105874952 | 3300013126 | Freshwater | MEFYADFEYVSFYINNIYPNGLAIEIPTWFLVGAIGLIYSIRLIRKEK* |
| (restricted) Ga0172373_107190731 | 3300013131 | Freshwater | MEFYLDLDYLSFYINNLYPNGVAIEIPTWVIVATIGLWFSVRVIRKTR* |
| (restricted) Ga0172372_101861302 | 3300013132 | Freshwater | MEFYLDLEYLSLYVNNLYPNGIAIEIPTWVIVATIGLWYSVRVIKKGR* |
| (restricted) Ga0172372_109026241 | 3300013132 | Freshwater | MEFYLDLEYLSLYINNLYPNGIAIEIPTWVIVATIGLW |
| Ga0177922_103698171 | 3300013372 | Freshwater | MEFYADLEYISLYVNNLYPNGIAIELPTWLLVGTVALVWSIRQWRK* |
| Ga0119952_11283901 | 3300014050 | Freshwater | MEFYANLDYISFYINNLYPSGVAIEIPTWLLVGTIALVWSIRQWKK* |
| (restricted) Ga0172376_100551748 | 3300014720 | Freshwater | MEFYLDLEYLSLYINNLYPNGIAIEIPTWVIVATIGLWYSVRVIRKTR* |
| Ga0119954_100005936 | 3300014819 | Freshwater | MEFYADLEYIAFYINNLYPNGVAIELPTWLLVATIGLIYSIRVMRKYK* |
| Ga0181362_10561042 | 3300017723 | Freshwater Lake | MEFYADLEYISLYVNNLYPNGIAIELPTWLFFGTIALVWSVRQWRK |
| Ga0169931_103920292 | 3300017788 | Freshwater | MEFYLDLDYLSFYINNLYPNGVAIEIPTWLLVGAIGLWYSVKVIKKGR |
| Ga0169931_106501432 | 3300017788 | Freshwater | MELYLDLDYLSFYINNLYPNGVAIEIPTWLLVGAIGLWYSVRVIKKGR |
| Ga0211732_15082904 | 3300020141 | Freshwater | VEFYADLEYISLYVSNLYPSGIAIEIPTWLLVGTIALVWSVRQWKKYQ |
| Ga0211734_101181883 | 3300020159 | Freshwater | VEFYADLDYISFYINNLYPSGVAIEIPTWLLFGTIAFIWSVKQWK |
| Ga0211734_101558963 | 3300020159 | Freshwater | MEFYIDLDYVSLYIDNLYPNGVGIDIPTWLLFGTIALVYSIKLIKRDK |
| Ga0211734_104052261 | 3300020159 | Freshwater | VEFYADLDYISFYINNLYPSGVAIEIPTWLLVGTIALVYSIRLIRKDK |
| Ga0211734_108233143 | 3300020159 | Freshwater | VEFYADLDYISFYINNLYPSGVAIEIPTWLLFGTIAFIWSVKQW |
| Ga0211735_107880861 | 3300020162 | Freshwater | MEFYADLEYISLYVSNLYPNGIAIEIPTWLLVGTIALV |
| Ga0211729_101652643 | 3300020172 | Freshwater | MEFYADLEYVSFYINNLYPSGVAIEIPTWLLFGTIAFIWSVRQWKK |
| Ga0208091_10254861 | 3300020506 | Freshwater | IMEFYADLDYISFYINNLYPSGVAIEIPTWLLVGTIALVYSIRLIRKDK |
| Ga0208232_1000001126 | 3300020527 | Freshwater | MEFYADLDYISFYINNLYPNGVAIEIPTWLIVGTISFIYSIKLIRKDR |
| Ga0222714_101131444 | 3300021961 | Estuarine Water | MEFYLDLDYLSFYVNNLYPSGIAIEIPTWVIVGTISFIYSIKLLRRDR |
| Ga0222714_102951573 | 3300021961 | Estuarine Water | MELTIDLEYFALYISNLYPSGIAIEIPTWLLFGGISLAWSIRQWRK |
| Ga0214917_100435235 | 3300022752 | Freshwater | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGSIAFIYSIKLIRNDK |
| Ga0214917_100899843 | 3300022752 | Freshwater | MEFYAGLEYVSLYINNLYPNGVAIEIPTWLLVGTIGLIYSIRLMRKDK |
| Ga0214917_101018634 | 3300022752 | Freshwater | MEFYADLEYIAFYINNLYPNGVAIELPTWLLVATIGLIYSIRVMRKYK |
| Ga0214917_103606221 | 3300022752 | Freshwater | MEFYLDLDYLSFYVNNLYPSGIAIEIPTWVIVGTISFIYSI |
| Ga0214921_100476966 | 3300023174 | Freshwater | VEFYADLDYISFYINNLYPSGVTIELPTWLLVGSVLFIYSIKLIKKDK |
| Ga0214921_100553996 | 3300023174 | Freshwater | MEFYANLDYISFYINNLYPSGVAIEIPTWLLVGSIGLIWSIRQWKK |
| Ga0214923_100002062 | 3300023179 | Freshwater | MEFYAGLEYVSLYINNLYPNGVAIEIPTWLLVGTIGLIYSIKLMRKDK |
| Ga0208009_10577791 | 3300027114 | Deep Subsurface | VEFYLDLDYLALYINNLYPTGVAIEIPTWLIVATIGLVYSIRIIRKEK |
| Ga0209247_10282624 | 3300027468 | Freshwater Lake | MEFYIDLDYVSLYVDNLYPNGIGIDIPTWVLFGTIALIYSIKLIRRDK |
| Ga0209651_10757121 | 3300027581 | Freshwater Lake | MEFYIDLDYVSLYVDNLYPNGIGIDIPTWVLFGTIALVYSIRLIRKDK |
| Ga0208966_10397893 | 3300027586 | Freshwater Lentic | MEFYADLDYISFYINNLYPSGVAIEIPTWLLFGTIAFIWSVKQWKK |
| Ga0208966_10948531 | 3300027586 | Freshwater Lentic | MEFYIDLDYVSLYVDNLYPNGIGIDIPTWLLFGTIALVYSIKLIRRDK |
| Ga0208974_10566281 | 3300027608 | Freshwater Lentic | VEFYADLDYISFYINNLYPNGVAIEIPTWLLFGTVAFIWSVKQWKK |
| Ga0208974_11643753 | 3300027608 | Freshwater Lentic | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGTIAL |
| Ga0208960_10508124 | 3300027649 | Freshwater Lentic | VEFYADLEYISLYVSNLYPSGIAIEIPTWLLVGTVALVWSVRQW |
| Ga0209769_11566911 | 3300027679 | Freshwater Lake | MEFYIDLDYVSLYVDNLYPNGIGIDIPTWVLFGTIALIYSIK |
| Ga0209551_10917913 | 3300027689 | Freshwater Lake | MEFYADLEYISLYVSNLYPSGIAIEIPTWLLVGTIALVYSIRLIRKDK |
| Ga0209617_102812031 | 3300027720 | Freshwater And Sediment | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGTIA |
| (restricted) Ga0247836_10968433 | 3300027728 | Freshwater | MEFYADLEYVSLYINNLYPNGVAIEIPTWLLFGTIAFIWSVRQWKK |
| (restricted) Ga0247833_10942672 | 3300027730 | Freshwater | MEFYADLEYISLYVNNLYPNGIAIELPTWLFFGTIALVWSVRQWKK |
| Ga0209297_11322433 | 3300027733 | Freshwater Lake | MEFYADLDYISFYINNLYPNGVAIEIPTWLLVGSIAFIYSIKLIRNDK |
| Ga0209190_10241756 | 3300027736 | Freshwater Lake | MEFYADLDYISFYINNLYPSGVAIEIPTWLLIGSIAFIYSIKLIRKDK |
| Ga0209190_12432411 | 3300027736 | Freshwater Lake | VEFYADLDYISFYINNLYPNGVAIEIPTWLLVGTIALVYSIRLIRKDK |
| Ga0209296_100024854 | 3300027759 | Freshwater Lake | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGTISLVYSIRLIRNDK |
| Ga0209086_100744121 | 3300027770 | Freshwater Lake | VEFYADLDYISFYINNLYPSGVAIEIPTWLLVGSIAFIYSIKLIRNDK |
| Ga0209107_104993663 | 3300027797 | Freshwater And Sediment | MEFYADLDYISFYINNLYPSGVAIEVPTWLLIGTIALVWSIR |
| Ga0209353_102067294 | 3300027798 | Freshwater Lake | VSLYVDNLYPNGIGIDIPTWVLFGTIALVYSIKLIRRDK |
| (restricted) Ga0247837_11917181 | 3300027970 | Freshwater | MEFYADLEYINFYVNNLYPSGIAIEIPTWLLFGTIAFIWSVRQWKK |
| Ga0209401_10820943 | 3300027971 | Freshwater Lake | MEFYADLDYISFYINNLYPNGVAIEIPTWLLIGTIALVYSIRLIRKDK |
| (restricted) Ga0247834_11329321 | 3300027977 | Freshwater | MEFYADLEYVSLYINNLYPNGVAIEIPTWLLFGTIAFIWSVRQ |
| Ga0247723_10116387 | 3300028025 | Deep Subsurface Sediment | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGSIAFIYSIRLLRKDK |
| (restricted) Ga0247835_11042513 | 3300028114 | Freshwater | MEFYADLEYVSLYINNLYPNGVAIEIPTWLLFGTIAFIWSVKQWKK |
| Ga0119944_10278334 | 3300029930 | Aquatic | VEFYADLDYISFYINNLYPSGVAIEIPTWLIVATVGLIYSIRIIRKEK |
| Ga0315907_1009836811 | 3300031758 | Freshwater | RLGGLRVMEFYLDLDYLSFYVDNLYPNGIAIEIPTWVIVATISLIYSIRLLKKDK |
| Ga0315909_108777331 | 3300031857 | Freshwater | MEFYLDLDYLSFYVNNLYPSGIAIEIPTWVIVGTICLTYSIKLL |
| Ga0315903_104234294 | 3300032116 | Freshwater | MEFYLDLDYLSFYVNNLYPSGIAIEIPTWVIVGTICLTYSIKLLRRDR |
| Ga0334995_0652454_147_293 | 3300034062 | Freshwater | MEFYLDLEYLALYVNNLYPSGIAIEIPTWVLVTTIGLIYSIKLIRKEK |
| Ga0335028_0298249_94_240 | 3300034071 | Freshwater | MEFYLDLDYLSFYVNNLYPSGIAIEIPTWVIVGTICLTYSIKLLRRDK |
| Ga0335020_0084597_1341_1481 | 3300034082 | Freshwater | MEFYADLEYISLYVSNLYPSGIAIEIPTWLLVGTIALVWSIRQWKK |
| Ga0335027_0030082_1002_1148 | 3300034101 | Freshwater | MEFYLDLEYISLYVSNLYPNGIAIEIPTWIIVGGIALTYSIRLLRRDK |
| Ga0335031_0771747_402_542 | 3300034104 | Freshwater | FYLDLEYISLYVSNLYPNGIAIEIPTWIIVGGIALTYSIRLLRRDK |
| Ga0335066_0517869_521_628 | 3300034112 | Freshwater | MEFYADLEYISFYVSNLYPSGIAIEIPTWVLVGTIS |
| Ga0335068_0052373_406_552 | 3300034116 | Freshwater | MEFYADLDYISFYINNLYPSGVAIEIPTWLLVGSIALVYSIRLIRNDK |
| Ga0335068_0447112_471_608 | 3300034116 | Freshwater | EFYANLDYISFYINNLYPNGVAIEIPTWLLFGTIAFIWSVKQWKK |
| Ga0335061_0172423_2_118 | 3300034168 | Freshwater | MEFYADLEYISFYVSNLYPSGIAIEIPTWVLVGTISLWY |
| Ga0335007_0491283_20_166 | 3300034283 | Freshwater | MEFYLDLEYLALYVNNLYPSGIAIEIPTWVLVTTIGLIYSIRLIRKEK |
| ⦗Top⦘ |