| Basic Information | |
|---|---|
| Family ID | F070070 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.44 % |
| % of genes near scaffold ends (potentially truncated) | 96.75 % |
| % of genes from short scaffolds (< 2000 bps) | 92.68 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.480 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (12.195 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.398 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.715 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 57.72 |
| PF12911 | OppC_N | 7.32 |
| PF04392 | ABC_sub_bind | 1.63 |
| PF08484 | Methyltransf_14 | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF00496 | SBP_bac_5 | 0.81 |
| PF01979 | Amidohydro_1 | 0.81 |
| PF06114 | Peptidase_M78 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.48 % |
| Unclassified | root | N/A | 32.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11380387 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101009876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 717 | Open in IMG/M |
| 3300003203|JGI25406J46586_10006243 | All Organisms → cellular organisms → Bacteria | 5500 | Open in IMG/M |
| 3300004479|Ga0062595_101433849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
| 3300005180|Ga0066685_10353861 | Not Available | 1019 | Open in IMG/M |
| 3300005331|Ga0070670_102066755 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
| 3300005335|Ga0070666_11230394 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| 3300005347|Ga0070668_100936224 | Not Available | 776 | Open in IMG/M |
| 3300005363|Ga0008090_15455990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300005366|Ga0070659_101737925 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 558 | Open in IMG/M |
| 3300005440|Ga0070705_100726786 | Not Available | 782 | Open in IMG/M |
| 3300005444|Ga0070694_100812890 | Not Available | 767 | Open in IMG/M |
| 3300005456|Ga0070678_101322094 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 671 | Open in IMG/M |
| 3300005471|Ga0070698_101289373 | Not Available | 680 | Open in IMG/M |
| 3300005471|Ga0070698_101462582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 634 | Open in IMG/M |
| 3300005518|Ga0070699_101874179 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 548 | Open in IMG/M |
| 3300005560|Ga0066670_10536625 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 716 | Open in IMG/M |
| 3300005576|Ga0066708_10923115 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300005578|Ga0068854_102048745 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300005617|Ga0068859_100373998 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300005718|Ga0068866_10617591 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 734 | Open in IMG/M |
| 3300005719|Ga0068861_101968375 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
| 3300005764|Ga0066903_100148216 | All Organisms → cellular organisms → Bacteria | 3362 | Open in IMG/M |
| 3300005844|Ga0068862_101107925 | Not Available | 787 | Open in IMG/M |
| 3300006028|Ga0070717_11807878 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
| 3300006031|Ga0066651_10240979 | Not Available | 959 | Open in IMG/M |
| 3300006049|Ga0075417_10266817 | Not Available | 824 | Open in IMG/M |
| 3300006058|Ga0075432_10273181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
| 3300006580|Ga0074049_12041557 | Not Available | 541 | Open in IMG/M |
| 3300006846|Ga0075430_100796669 | Not Available | 779 | Open in IMG/M |
| 3300006847|Ga0075431_101638209 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 601 | Open in IMG/M |
| 3300006914|Ga0075436_101173595 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 579 | Open in IMG/M |
| 3300006954|Ga0079219_10062406 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300006969|Ga0075419_10071843 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300009089|Ga0099828_10180995 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300009090|Ga0099827_10622271 | Not Available | 931 | Open in IMG/M |
| 3300009147|Ga0114129_12606022 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300009148|Ga0105243_11256963 | Not Available | 756 | Open in IMG/M |
| 3300009177|Ga0105248_12612621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300009792|Ga0126374_11401596 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300009810|Ga0105088_1031141 | Not Available | 862 | Open in IMG/M |
| 3300010043|Ga0126380_10949670 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 719 | Open in IMG/M |
| 3300010043|Ga0126380_11716509 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300010046|Ga0126384_11300075 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 674 | Open in IMG/M |
| 3300010046|Ga0126384_11704661 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
| 3300010047|Ga0126382_10684096 | Not Available | 858 | Open in IMG/M |
| 3300010047|Ga0126382_11603972 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300010159|Ga0099796_10550359 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300010335|Ga0134063_10301052 | Not Available | 771 | Open in IMG/M |
| 3300010360|Ga0126372_10293313 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300010360|Ga0126372_12476851 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010362|Ga0126377_10583154 | Not Available | 1161 | Open in IMG/M |
| 3300010362|Ga0126377_11807836 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 686 | Open in IMG/M |
| 3300010376|Ga0126381_100522369 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300010397|Ga0134124_10012470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6868 | Open in IMG/M |
| 3300010398|Ga0126383_10451539 | Not Available | 1335 | Open in IMG/M |
| 3300010399|Ga0134127_12270594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
| 3300010403|Ga0134123_11997563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 638 | Open in IMG/M |
| 3300012096|Ga0137389_10085582 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300012205|Ga0137362_10825967 | Not Available | 793 | Open in IMG/M |
| 3300012349|Ga0137387_11054409 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300012359|Ga0137385_11492656 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300012360|Ga0137375_10132085 | All Organisms → cellular organisms → Bacteria | 2473 | Open in IMG/M |
| 3300012362|Ga0137361_10588372 | Not Available | 1020 | Open in IMG/M |
| 3300012582|Ga0137358_10221977 | Not Available | 1288 | Open in IMG/M |
| 3300012917|Ga0137395_10046977 | All Organisms → cellular organisms → Bacteria | 2696 | Open in IMG/M |
| 3300012918|Ga0137396_11315540 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300012922|Ga0137394_10485005 | Not Available | 1050 | Open in IMG/M |
| 3300012930|Ga0137407_10695045 | Not Available | 958 | Open in IMG/M |
| 3300012957|Ga0164303_11231517 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300012971|Ga0126369_11828908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 696 | Open in IMG/M |
| 3300012987|Ga0164307_10579808 | Not Available | 861 | Open in IMG/M |
| 3300012988|Ga0164306_10705388 | Not Available | 802 | Open in IMG/M |
| 3300013297|Ga0157378_10191268 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300013297|Ga0157378_11006293 | Not Available | 868 | Open in IMG/M |
| 3300014326|Ga0157380_10422450 | Not Available | 1272 | Open in IMG/M |
| 3300014745|Ga0157377_11116413 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
| 3300014881|Ga0180094_1137554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
| 3300015054|Ga0137420_1324983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2503 | Open in IMG/M |
| 3300015359|Ga0134085_10631829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300015372|Ga0132256_100973845 | Not Available | 964 | Open in IMG/M |
| 3300015372|Ga0132256_103918610 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 501 | Open in IMG/M |
| 3300015374|Ga0132255_100578132 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300016270|Ga0182036_10383538 | Not Available | 1091 | Open in IMG/M |
| 3300016319|Ga0182033_10335446 | Not Available | 1259 | Open in IMG/M |
| 3300016422|Ga0182039_12179536 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300017792|Ga0163161_10300016 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300017792|Ga0163161_11489885 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300017973|Ga0187780_11245112 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300018084|Ga0184629_10155875 | Not Available | 1160 | Open in IMG/M |
| 3300018482|Ga0066669_10742909 | Not Available | 866 | Open in IMG/M |
| 3300019887|Ga0193729_1073261 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300020002|Ga0193730_1083720 | Not Available | 900 | Open in IMG/M |
| 3300021560|Ga0126371_12150119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
| 3300025899|Ga0207642_10471987 | Not Available | 764 | Open in IMG/M |
| 3300026023|Ga0207677_10921321 | Not Available | 789 | Open in IMG/M |
| 3300026089|Ga0207648_10882454 | Not Available | 835 | Open in IMG/M |
| 3300026121|Ga0207683_11215459 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 698 | Open in IMG/M |
| 3300026297|Ga0209237_1022901 | All Organisms → cellular organisms → Bacteria | 3531 | Open in IMG/M |
| 3300026361|Ga0257176_1011978 | Not Available | 1158 | Open in IMG/M |
| 3300026523|Ga0209808_1101327 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300027654|Ga0209799_1025441 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300027681|Ga0208991_1206102 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300028380|Ga0268265_11138964 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 776 | Open in IMG/M |
| 3300028792|Ga0307504_10313407 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 594 | Open in IMG/M |
| 3300028809|Ga0247824_10448995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 753 | Open in IMG/M |
| 3300028878|Ga0307278_10135330 | Not Available | 1106 | Open in IMG/M |
| 3300031198|Ga0307500_10156965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300031547|Ga0310887_10058440 | All Organisms → cellular organisms → Bacteria | 1764 | Open in IMG/M |
| 3300031682|Ga0318560_10804219 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
| 3300031736|Ga0318501_10536137 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
| 3300031740|Ga0307468_101416443 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 639 | Open in IMG/M |
| 3300031771|Ga0318546_11241636 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| 3300031805|Ga0318497_10296687 | Not Available | 900 | Open in IMG/M |
| 3300031912|Ga0306921_10340243 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300031912|Ga0306921_12423073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → unclassified Terrabacteria group → Terrabacteria group bacterium ANGP1 | 547 | Open in IMG/M |
| 3300032067|Ga0318524_10688566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 539 | Open in IMG/M |
| 3300032180|Ga0307471_102867087 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
| 3300032211|Ga0310896_10071949 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300033004|Ga0335084_11583021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 646 | Open in IMG/M |
| 3300033158|Ga0335077_10790161 | Not Available | 968 | Open in IMG/M |
| 3300033433|Ga0326726_10446852 | Not Available | 1231 | Open in IMG/M |
| 3300033550|Ga0247829_11188141 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 632 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.25% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.44% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.63% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_113803871 | 3300000890 | Soil | IAQLALDEALTVPLVDELSVWAYRTGVQGVKYNFNAYPVLGDATLRK* |
| JGIcombinedJ26739_1010098762 | 3300002245 | Forest Soil | IAAERLALDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDAIIRR* |
| JGI25406J46586_100062431 | 3300003203 | Tabebuia Heterophylla Rhizosphere | LAIAHQALDEALTVPLVDELSVWAFRSGVQAVKYNFTAFPILGDATLRR* |
| Ga0062595_1014338492 | 3300004479 | Soil | VQITRLLLDDAASVPLVDELAVWAYRSTVQGTKYNFNAYPVLSDAHIVRR* |
| Ga0066685_103538612 | 3300005180 | Soil | ALDEALTVPLVDELAVWAFRANVQGVKYNFNAYPVLSDATTRR* |
| Ga0070670_1020667552 | 3300005331 | Switchgrass Rhizosphere | LALDEALTVPLVDELSVWAYQAGVQGIKYNFNAYPILGDATLRK* |
| Ga0070666_112303941 | 3300005335 | Switchgrass Rhizosphere | EALTVPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK* |
| Ga0070668_1009362241 | 3300005347 | Switchgrass Rhizosphere | LDEALTVPLVDELAVWAFRTPVQGVKYNFNAYPVLSDTMIRR* |
| Ga0008090_154559902 | 3300005363 | Tropical Rainforest Soil | EKLAVDEALTVPLLDDLSVWAYRANVRGAKYNFNAYPVLSDVTIRR* |
| Ga0070659_1017379252 | 3300005366 | Corn Rhizosphere | ALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVILRK* |
| Ga0070705_1007267861 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | IEKLALDEALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVILRK* |
| Ga0070694_1008128902 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ALDEALTVPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK* |
| Ga0070678_1013220942 | 3300005456 | Miscanthus Rhizosphere | LAAEKLALDEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR* |
| Ga0070698_1012893731 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LDEALTVPLLDELSVWAFRAAVRGVKYNFATYPVLSDAAIQK* |
| Ga0070698_1014625822 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LDEALTVPLLDELSVWAFRAAVRGVKYNFATYPVLSDAAIR* |
| Ga0070699_1018741791 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR* |
| Ga0066670_105366251 | 3300005560 | Soil | IEKLAIEEALTVPLLDDLSVWAYRANVQGTKYNFNAYPVLSDVTIRR* |
| Ga0066708_109231152 | 3300005576 | Soil | IEQMVLDEALTVPLVDELSVWAFRANIRGVKYNFATYPVLSDAAIQK* |
| Ga0068854_1020487451 | 3300005578 | Corn Rhizosphere | AIEKLALDEALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDAILRK* |
| Ga0068859_1003739981 | 3300005617 | Switchgrass Rhizosphere | LVDDLSVWAFRANVQGTKYNFNAYPVLSDVTLRK* |
| Ga0068866_106175911 | 3300005718 | Miscanthus Rhizosphere | IYLAIEKLALDEALTVPLVDELAVWAFRTPVQGVKYNFNAYPVLSDTMIRR* |
| Ga0068861_1019683752 | 3300005719 | Switchgrass Rhizosphere | EDALTVPLVDDLAVWAFRAGVQRVKYNFNAYPLLSDTTISK* |
| Ga0066903_1001482165 | 3300005764 | Tropical Forest Soil | VIDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR* |
| Ga0068862_1011079251 | 3300005844 | Switchgrass Rhizosphere | LDEALTVPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK* |
| Ga0070717_118078782 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDAIVRR* |
| Ga0066651_102409792 | 3300006031 | Soil | SIAQLALDEALTAPLVDELSVWAFRAGVQGVRYNFNAYPSLADATLRR* |
| Ga0075417_102668172 | 3300006049 | Populus Rhizosphere | LALDEALTVPLVDELSVWAFRSGVQAVKYNFNAFPILGDATLRR* |
| Ga0075432_102731811 | 3300006058 | Populus Rhizosphere | VPLVDELSVWAFRSGVQAVKYNFNAFPILGDATLRR* |
| Ga0074049_120415571 | 3300006580 | Soil | LVDELSVWAFRAGVQGVKYNFNAYPLLSDTTLRR* |
| Ga0075430_1007966692 | 3300006846 | Populus Rhizosphere | LAIDEALTVPLVDELSVWAFRAGVQGVKYNFNAYPILGDATLRK* |
| Ga0075431_1016382091 | 3300006847 | Populus Rhizosphere | LLLDDAASVPLVDELAVWAYRSSVQGTKYNFNAYPVLSDAHIVRR* |
| Ga0075436_1011735951 | 3300006914 | Populus Rhizosphere | YVSIEQFAIEEALAVPLVDELSVWAYRSGVQGVKYNFNAYPILGDATLRK* |
| Ga0079219_100624061 | 3300006954 | Agricultural Soil | DEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR* |
| Ga0075419_100718431 | 3300006969 | Populus Rhizosphere | LALDEALTVPLVDELSVWAFRSGVQAVKYNFTALPILGDATLRR* |
| Ga0099828_101809953 | 3300009089 | Vadose Zone Soil | EALTVPLVDELAVWAFRANVQGVKYNFNAYPLLSDATTRR* |
| Ga0099827_106222711 | 3300009090 | Vadose Zone Soil | TVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR* |
| Ga0114129_126060221 | 3300009147 | Populus Rhizosphere | TIYRDVQKLVLDDAMAAPLVDDLAVWAFRANVQGTKYNFNAYPVLSDAFIKQ* |
| Ga0105243_112569631 | 3300009148 | Miscanthus Rhizosphere | VYLAIEKLAVDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDTMIRR* |
| Ga0105248_126126212 | 3300009177 | Switchgrass Rhizosphere | EALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVILRK* |
| Ga0126374_114015962 | 3300009792 | Tropical Forest Soil | ASVPLVDELAVWAYRSNVQGTKYNFNAYPVLSDAYLVRR* |
| Ga0105088_10311411 | 3300009810 | Groundwater Sand | DEALAVPLIDELSVWAFRATVQGVKYNFNAYPILSDTTVRR* |
| Ga0126380_109496702 | 3300010043 | Tropical Forest Soil | ALTVPLVDELSVWAFRSNVTGIVYNFNAYPVLSDTTIKR* |
| Ga0126380_117165092 | 3300010043 | Tropical Forest Soil | EALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRK* |
| Ga0126384_113000751 | 3300010046 | Tropical Forest Soil | TVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK* |
| Ga0126384_117046612 | 3300010046 | Tropical Forest Soil | VPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK* |
| Ga0126382_106840962 | 3300010047 | Tropical Forest Soil | EDALTVPLVDELAVWAFRAGVQKVKYNFNTYPVLSDAVIKK* |
| Ga0126382_116039722 | 3300010047 | Tropical Forest Soil | PLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRK* |
| Ga0099796_105503591 | 3300010159 | Vadose Zone Soil | ALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR* |
| Ga0134063_103010521 | 3300010335 | Grasslands Soil | LALDEALTVPLVDELAVWAFRANVQGVKYNFNAYPVLSDATTRR* |
| Ga0126372_102933131 | 3300010360 | Tropical Forest Soil | IEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK* |
| Ga0126372_124768512 | 3300010360 | Tropical Forest Soil | QLTRLLLDDAASVPLVDELAVWAYRSNVQGTKYNFNAYPVLSDVHIVRR* |
| Ga0126377_105831543 | 3300010362 | Tropical Forest Soil | DALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRT* |
| Ga0126377_118078362 | 3300010362 | Tropical Forest Soil | TVPLVDELSVWAFRAGVQGVKYNFNAYPILGDATLRK* |
| Ga0126381_1005223693 | 3300010376 | Tropical Forest Soil | SIEQFAIEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK* |
| Ga0134124_100124701 | 3300010397 | Terrestrial Soil | TVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR* |
| Ga0126383_104515392 | 3300010398 | Tropical Forest Soil | ALDEALTVPLVDELSVWAFRSNVQGVKYNFNAYPVMSDATIRR* |
| Ga0134127_122705942 | 3300010399 | Terrestrial Soil | LTVPLVDELSVWAYRTGVQGIKYNFNAYPILGDATLRK* |
| Ga0134123_119975631 | 3300010403 | Terrestrial Soil | TRLALDEALTVPLVDELSVWAYQAGVQGIKYNFNAYPILGDATLRK* |
| Ga0137389_100855821 | 3300012096 | Vadose Zone Soil | LTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR* |
| Ga0137362_108259672 | 3300012205 | Vadose Zone Soil | IYLSIEQMALDEALTVPLLDELSVWAFRATVSGVKYNFATYPVLSDAAIQK* |
| Ga0137387_110544091 | 3300012349 | Vadose Zone Soil | LTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR* |
| Ga0137385_114926561 | 3300012359 | Vadose Zone Soil | IEKFALEEALTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR* |
| Ga0137375_101320854 | 3300012360 | Vadose Zone Soil | SIAQLALDEALTVPLVDELSVWAFRSGVQAVKYNFNAYPILGDATLRK* |
| Ga0137361_105883721 | 3300012362 | Vadose Zone Soil | LTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR* |
| Ga0137358_102219773 | 3300012582 | Vadose Zone Soil | VPLVDELAVWAFRANVQGVKYNFNAYPVLSDATTRR* |
| Ga0137395_100469775 | 3300012917 | Vadose Zone Soil | TVPLVDELAVWAFRAGVQRVKYNFNAYPVLSDAVIVKK* |
| Ga0137396_113155402 | 3300012918 | Vadose Zone Soil | LYLAIEKFALEEALTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR* |
| Ga0137394_104850051 | 3300012922 | Vadose Zone Soil | AIEKLALDEALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVVLRK* |
| Ga0137407_106950452 | 3300012930 | Vadose Zone Soil | YLSIAQLALDEALTVPLVDELSVWAFRAGVQGVRYNFNAYPSLADATLRR* |
| Ga0164303_112315172 | 3300012957 | Soil | IYVAVEKLALDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR* |
| Ga0126369_118289082 | 3300012971 | Tropical Forest Soil | YLAIEKLALDDALAVPLVDELSVWAFRSTVTGTVYNFNAYPVLSDTTIKR* |
| Ga0164307_105798082 | 3300012987 | Soil | YLAAEKLALDEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR* |
| Ga0164306_107053882 | 3300012988 | Soil | KLALDEALPVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR* |
| Ga0157378_101912683 | 3300013297 | Miscanthus Rhizosphere | VPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK* |
| Ga0157378_110062932 | 3300013297 | Miscanthus Rhizosphere | LTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR* |
| Ga0157380_104224503 | 3300014326 | Switchgrass Rhizosphere | KLALDEALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVTLRK* |
| Ga0157377_111164131 | 3300014745 | Miscanthus Rhizosphere | QALTVPLVDDLSVWAFRANVQGTKYNFNAYPVLSDVILRK* |
| Ga0180094_11375542 | 3300014881 | Soil | DQALTVPLVDKLSVWAFRASVQRITYNFNAYPLLSDVTVRR* |
| Ga0137420_13249838 | 3300015054 | Vadose Zone Soil | VPLVDELSVWAFRSNVGGVKYNFNAYPVLSDAVIRK* |
| Ga0134085_106318292 | 3300015359 | Grasslands Soil | QMALDEALTVPLLDELSVWAFRAGVRGVKYNFATYPVLSDAAIQK* |
| Ga0132256_1009738451 | 3300015372 | Arabidopsis Rhizosphere | KLALDDALTVPLVDELSVWAFRSTVTGVSYNFNAYPVLSDATIKR* |
| Ga0132256_1039186102 | 3300015372 | Arabidopsis Rhizosphere | SIIRLALDEALTVPLVDELSVWAYQAGVQGIKYNFNAYPILGDATLRK* |
| Ga0132255_1005781323 | 3300015374 | Arabidopsis Rhizosphere | VPLVDELAVWAYRSTVQGTKYNFNAYPVLSDAHIVRR* |
| Ga0182036_103835382 | 3300016270 | Soil | EQLAIEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK |
| Ga0182033_103354462 | 3300016319 | Soil | VEIGPGLGALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRK |
| Ga0182039_121795361 | 3300016422 | Soil | IEKLAVDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR |
| Ga0163161_103000163 | 3300017792 | Switchgrass Rhizosphere | PLVDELSVWAFRSGVQGVKYNFNAYPILGDAALRK |
| Ga0163161_114898852 | 3300017792 | Switchgrass Rhizosphere | IEKLALEDALTVPLVDDLAVWAFRAGVQRVKYNFNAYPLLSDTTISK |
| Ga0187780_112451122 | 3300017973 | Tropical Peatland | AVEKLALDQALTVPLVDELALWAYRAPVQGVKYNFNAYPVLSDATIRR |
| Ga0184629_101558751 | 3300018084 | Groundwater Sediment | QLALDEALTVPLVDELSVWAFRSGVQGVKFNFNAYPILGDATLRK |
| Ga0066669_107429091 | 3300018482 | Grasslands Soil | VYLAIGKLAIAEALTVPLLDDLSVWADRANVQGAKYNFNAYPVLSDVTIRR |
| Ga0193729_10732613 | 3300019887 | Soil | LAVEKLALDEALTVPLVDELAVWAFRAPVQGVKYNFNAYPVLSDATIRR |
| Ga0193730_10837202 | 3300020002 | Soil | KLALEEALTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR |
| Ga0126371_121501192 | 3300021560 | Tropical Forest Soil | ALTVPLLDDLSVWVYRANVQGAKYNFNAYPVLSDVTIRK |
| Ga0207642_104719871 | 3300025899 | Miscanthus Rhizosphere | KLALDEALTVPLVDELAVWAFRTPVQGVKYNFNAYPVLSDTMIRR |
| Ga0207677_109213211 | 3300026023 | Miscanthus Rhizosphere | EKLAVDEALTVPLRDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR |
| Ga0207648_108824542 | 3300026089 | Miscanthus Rhizosphere | LAVDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR |
| Ga0207683_112154592 | 3300026121 | Miscanthus Rhizosphere | LAAEKLALDEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR |
| Ga0209237_10229015 | 3300026297 | Grasslands Soil | EMALDEALTVPLLDELSVWAFRAAVRGVKYNFATYPVLSDTAIQK |
| Ga0257176_10119783 | 3300026361 | Soil | TVPLVDELAVWAFRANVQGVKYNFNAYPVLSDATTRR |
| Ga0209808_11013273 | 3300026523 | Soil | VPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR |
| Ga0209799_10254411 | 3300027654 | Tropical Forest Soil | EQLAIEDALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK |
| Ga0208991_12061021 | 3300027681 | Forest Soil | AIEKFALEEALTVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR |
| Ga0268265_111389641 | 3300028380 | Switchgrass Rhizosphere | LLDEAASVPLVDELAVWAYRSSVQGTKYNFNAYPVLSDAHLVRR |
| Ga0307504_103134071 | 3300028792 | Soil | IVQLALDEALTVPLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK |
| Ga0247824_104489951 | 3300028809 | Soil | YLAAEKLALDEALTVPLVDELAVWAFRATVQGVKYNFNAYPVLSDATIRR |
| Ga0307278_101353301 | 3300028878 | Soil | LALDEALTVPLVDELSVWAFRSGVQAVKYNFNAYPILGDATLRK |
| Ga0307500_101569652 | 3300031198 | Soil | TVPLVDELSVWAFRGGVQGVKYNFNAYPVLGDATLRK |
| Ga0310887_100584403 | 3300031547 | Soil | TLEEALTVPLLDDLSVWAFRANVQGAKYNFNAYPVLSDVTIRK |
| Ga0318560_108042192 | 3300031682 | Soil | IEQLAIEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK |
| Ga0318501_105361371 | 3300031736 | Soil | IYVSIEQLAIEEALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK |
| Ga0307468_1014164432 | 3300031740 | Hardwood Forest Soil | TVPLVDELAVWAFRTGVQGVKYNFNAYPVLSDTTIRR |
| Ga0318546_112416361 | 3300031771 | Soil | ASVPLVDELAVWAFRSGVEGTKYNFNAYPVMSDAFIRK |
| Ga0318497_102966872 | 3300031805 | Soil | LAIEDALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRK |
| Ga0306921_103402431 | 3300031912 | Soil | IYLAIEKLAVDEALTVPLLDDLSVWAYRANVQGAKYNFNAYPVLSDVTIRR |
| Ga0306921_124230731 | 3300031912 | Soil | VPLFDELAVYVSRSTVQGTKYNYSAYPVLSDVSMQK |
| Ga0318524_106885661 | 3300032067 | Soil | LSKLLLDDAASVPLVDELAVWAFRSGVEGTKYNFNAYPVMSDAFIRK |
| Ga0307471_1028670871 | 3300032180 | Hardwood Forest Soil | EALTVPLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK |
| Ga0310896_100719491 | 3300032211 | Soil | PLVDELSVWAFRSGVQGVKYNFNAYPVLGDATLRK |
| Ga0335084_115830212 | 3300033004 | Soil | DEALTVPLVDELSVWAFRANVQGVKYNFNAYPVMSDAAIRR |
| Ga0335077_107901611 | 3300033158 | Soil | PLVDELSVWAFRSGVQGVKYNFNAYPILGDATLRK |
| Ga0326726_104468521 | 3300033433 | Peat Soil | IEKLALDEALTVPLVDELSVWAFRATVQGVKYNFNAYPVLSDAALRR |
| Ga0247829_111881412 | 3300033550 | Soil | DAASVPLVDELAVWAYRSSVQGTKYNFNAYPVLSDAHIVRR |
| ⦗Top⦘ |