NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070066

Metagenome / Metatranscriptome Family F070066

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070066
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 54 residues
Representative Sequence AGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR
Number of Associated Samples 101
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.63 %
% of genes near scaffold ends (potentially truncated) 98.37 %
% of genes from short scaffolds (< 2000 bps) 95.93 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.862 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(13.008 % of family members)
Environment Ontology (ENVO) Unclassified
(34.146 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(53.659 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.25%    β-sheet: 0.00%    Coil/Unstructured: 53.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF07584BatA 92.68
PF07690MFS_1 0.81
PF02608Bmp 0.81
PF00848Ring_hydroxyl_A 0.81
PF13779DUF4175 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG4638Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunitInorganic ion transport and metabolism [P] 1.63
COG1744Lipoprotein Med, regulator of KinD/Spo0A, PBP1-ABC superfamily, includes NupNSignal transduction mechanisms [T] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.86 %
UnclassifiedrootN/A21.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004643|Ga0062591_102991496All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005162|Ga0066814_10082892All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300005172|Ga0066683_10767811All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005332|Ga0066388_108228187All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300005332|Ga0066388_108280233All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005343|Ga0070687_100944350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300005353|Ga0070669_101892569All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300005354|Ga0070675_101748279All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300005356|Ga0070674_100355929All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1184Open in IMG/M
3300005364|Ga0070673_100362868All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1288Open in IMG/M
3300005436|Ga0070713_100246572Not Available1628Open in IMG/M
3300005439|Ga0070711_101099720Not Available685Open in IMG/M
3300005440|Ga0070705_101816866All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005440|Ga0070705_101936606All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005466|Ga0070685_11573585Not Available508Open in IMG/M
3300005468|Ga0070707_101685924Not Available601Open in IMG/M
3300005526|Ga0073909_10398869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300005530|Ga0070679_101350866Not Available659Open in IMG/M
3300005535|Ga0070684_100583499All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1039Open in IMG/M
3300005544|Ga0070686_100173183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1528Open in IMG/M
3300005545|Ga0070695_100692745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300005546|Ga0070696_100753535All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300005546|Ga0070696_101616016All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300005563|Ga0068855_101084122All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium838Open in IMG/M
3300005564|Ga0070664_100838292All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium861Open in IMG/M
3300005713|Ga0066905_101988980All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300005764|Ga0066903_101306018All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300005764|Ga0066903_106126160All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005834|Ga0068851_10289117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium939Open in IMG/M
3300005836|Ga0074470_11371773All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes605Open in IMG/M
3300005843|Ga0068860_102128873All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005844|Ga0068862_101579014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium663Open in IMG/M
3300006034|Ga0066656_11041042All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300006046|Ga0066652_100022154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4390Open in IMG/M
3300006046|Ga0066652_100977508All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300006049|Ga0075417_10173336All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300006049|Ga0075417_10601243Not Available559Open in IMG/M
3300006604|Ga0074060_11454076All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300006796|Ga0066665_10471222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1033Open in IMG/M
3300006847|Ga0075431_101374301Not Available666Open in IMG/M
3300006871|Ga0075434_100159692All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2274Open in IMG/M
3300006871|Ga0075434_101077984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M
3300006871|Ga0075434_102434518Not Available525Open in IMG/M
3300006880|Ga0075429_101969910Not Available506Open in IMG/M
3300006903|Ga0075426_10781973All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300006903|Ga0075426_10781977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300006904|Ga0075424_100059396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3999Open in IMG/M
3300007076|Ga0075435_100395637Not Available1188Open in IMG/M
3300007076|Ga0075435_100459644All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1098Open in IMG/M
3300007076|Ga0075435_100482728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1070Open in IMG/M
3300007076|Ga0075435_101714040Not Available551Open in IMG/M
3300009012|Ga0066710_101212564All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1169Open in IMG/M
3300009098|Ga0105245_11026326All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium870Open in IMG/M
3300009137|Ga0066709_100982445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1235Open in IMG/M
3300009162|Ga0075423_10304769All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1669Open in IMG/M
3300009162|Ga0075423_11203532All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300009176|Ga0105242_12864138All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300009177|Ga0105248_10541896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1313Open in IMG/M
3300009177|Ga0105248_10955292All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium968Open in IMG/M
3300010329|Ga0134111_10495445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300010337|Ga0134062_10525802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300010366|Ga0126379_10273624All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1678Open in IMG/M
3300010400|Ga0134122_10600436All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1017Open in IMG/M
3300010400|Ga0134122_12001448All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300010403|Ga0134123_12230951All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium610Open in IMG/M
3300010403|Ga0134123_13474877All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300011106|Ga0151489_1088277Not Available572Open in IMG/M
3300011444|Ga0137463_1066547All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1349Open in IMG/M
3300012204|Ga0137374_10727924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium742Open in IMG/M
3300012358|Ga0137368_10501764All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium782Open in IMG/M
3300012485|Ga0157325_1005785All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M
3300012899|Ga0157299_10046708Not Available954Open in IMG/M
3300012899|Ga0157299_10296602Not Available533Open in IMG/M
3300012918|Ga0137396_10991642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300012922|Ga0137394_11374021All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300012925|Ga0137419_10784650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300013308|Ga0157375_12531236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300014326|Ga0157380_12461268Not Available586Open in IMG/M
3300015054|Ga0137420_1299770All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1673Open in IMG/M
3300015199|Ga0167647_1128495All Organisms → cellular organisms → Bacteria → Proteobacteria583Open in IMG/M
3300015371|Ga0132258_13649431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1051Open in IMG/M
3300015371|Ga0132258_13856333All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1020Open in IMG/M
3300015374|Ga0132255_103981226Not Available627Open in IMG/M
3300015374|Ga0132255_105060110Not Available558Open in IMG/M
3300016371|Ga0182034_10787587All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium813Open in IMG/M
3300018067|Ga0184611_1080330All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300021078|Ga0210381_10175017All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium739Open in IMG/M
3300021344|Ga0193719_10446688Not Available527Open in IMG/M
3300025315|Ga0207697_10345468All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300025928|Ga0207700_11424381All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300025930|Ga0207701_11681671Not Available508Open in IMG/M
3300025938|Ga0207704_10231354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1375Open in IMG/M
3300025960|Ga0207651_11718255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium565Open in IMG/M
3300025961|Ga0207712_11575306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium589Open in IMG/M
3300025981|Ga0207640_11240708All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300026095|Ga0207676_10799621Not Available920Open in IMG/M
3300026118|Ga0207675_102388029All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300026220|Ga0209855_1019054All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1221Open in IMG/M
3300028381|Ga0268264_10031980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4316Open in IMG/M
3300028381|Ga0268264_11930447All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300028587|Ga0247828_10336855All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium846Open in IMG/M
3300028589|Ga0247818_10865724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300028768|Ga0307280_10193245All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium717Open in IMG/M
3300028792|Ga0307504_10104375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium907Open in IMG/M
3300028792|Ga0307504_10117815All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300028878|Ga0307278_10427627All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium581Open in IMG/M
3300031716|Ga0310813_12317007All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300031740|Ga0307468_101576847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300031771|Ga0318546_11025634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium580Open in IMG/M
3300031908|Ga0310900_11384269Not Available590Open in IMG/M
3300032013|Ga0310906_10885380Not Available636Open in IMG/M
3300032075|Ga0310890_10193927All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1387Open in IMG/M
3300032122|Ga0310895_10093307Not Available1211Open in IMG/M
3300032163|Ga0315281_10059032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4615Open in IMG/M
3300032174|Ga0307470_11275772Not Available600Open in IMG/M
3300032205|Ga0307472_100999339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300032205|Ga0307472_102629955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium513Open in IMG/M
3300032256|Ga0315271_10625096All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300032401|Ga0315275_12797073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300032893|Ga0335069_11220789Not Available822Open in IMG/M
3300033004|Ga0335084_12390542Not Available509Open in IMG/M
3300033412|Ga0310810_11203358All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium613Open in IMG/M
3300033475|Ga0310811_10628706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1067Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.06%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.25%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.25%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.44%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.44%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.63%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.63%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.63%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.63%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.81%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.81%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.81%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.81%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006604Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011106Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012485Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610Host-AssociatedOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015199Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026220Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062591_10299149623300004643SoilSLAVDAAAARRDYTDAVTAFLESWRRRAGAEGFQYSLMVTDVPADRALRNFLAARQTPQNR*
Ga0066814_1008289213300005162SoilLARRDYTDAMAAFLERWHSRAGAEGFQYSLIITDTPPARALRQFLLARVAR*
Ga0066683_1076781113300005172SoilGARLAINTVIARREYKDGVAAFLERVRTLAVAEGFQYSLVVTDTPPDRALRNFLLARQG*
Ga0066388_10822818723300005332Tropical Forest SoilSVAAFLERVRGLAVTEGFQYSLVVTSTPPDRALRNFLLARRG*
Ga0066388_10828023313300005332Tropical Forest SoilEFPYRRDFEFADLETGRSVSVNAGIARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0070687_10094435023300005343Switchgrass RhizosphereAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0070669_10189256913300005353Switchgrass RhizosphereVTAFLEQWRSRAAAEGFQYSLIVTDVPPQRALRNFLLARR*
Ga0070675_10174827923300005354Miscanthus RhizosphereVEFTDLETGRRLAINAGLARRDYKDAMAAFLEKWRSRAAAEGFQYSLIVTDTPPQRALRNFLLARR*
Ga0070674_10035592923300005356Miscanthus RhizosphereDAVAAFLEQWRSRAAAEGFQYSLIVTDVPPQRALRNFLLARR*
Ga0070673_10036286813300005364Switchgrass RhizosphereSAGLARRDYKEAVAAFLERWHSRAGAEGFQYSLIVTDTPPDRALRNFLLARTR*
Ga0070713_10024657213300005436Corn, Switchgrass And Miscanthus RhizosphereKDAIAAFLERCRARAASEGFQYLLVVTDTPPERALRNFLVRRTSA*
Ga0070711_10109972013300005439Corn, Switchgrass And Miscanthus RhizosphereARAAYKDAIAAFLERCRARAASEGFQYLLAVTDTPPERALRNFLVRRTSA*
Ga0070705_10181686623300005440Corn, Switchgrass And Miscanthus RhizosphereRRLAINGGLARRDYKDAVAAFLERSRMRAGAEGFQYSLIVTDTPPDRALRNFLLARQG*
Ga0070705_10193660623300005440Corn, Switchgrass And Miscanthus RhizosphereAVNAGLARRDYTDSVAAFLERCRRRAGAEGFQYSLIVTDTPPGRGLRNFLLARRR*
Ga0070685_1157358513300005466Switchgrass RhizosphereAGLARRGYRDAMAAFLERWHARAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0070707_10168592423300005468Corn, Switchgrass And Miscanthus RhizosphereGFARREYKDGVASFLERCRVRASSQGFRYSLVLTDTPPHRTLRNFLLARR*
Ga0073909_1039886913300005526Surface SoilNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0070679_10135086613300005530Corn RhizosphereAFLERWRSRAAAEGFQYSLIVTDTPPAHALRNFLLRRQMAS*
Ga0070684_10058349913300005535Corn RhizosphereVAAFLERWHSRAGAEGFQYSLIVTDTPPDRALRNFLLARKR*
Ga0070686_10017318313300005544Switchgrass RhizosphereRTLAINAGLARRQYTDAMAAFLERWHSRAGAEGFQYSLIVTDTPPERALRNFLLARKV*
Ga0070695_10069274523300005545Corn, Switchgrass And Miscanthus RhizosphereDAVAAFLERWRRRAAAEGFQYSLVVTDVPPQRALRNVLLARVHP*
Ga0070696_10075353513300005546Corn, Switchgrass And Miscanthus RhizosphereGLARRDYTDSVAAFLERCRRRAGAEGFQYSLIVTDTPPGRGLRNFLLARRR*
Ga0070696_10161601613300005546Corn, Switchgrass And Miscanthus RhizosphereRHYKDAIAAFLERWRSRAAAEGFHYSLIVTDTPPARALRNFILSRPR*
Ga0068855_10108412213300005563Corn RhizosphereEYKDAIAAFLERWHGRAGAEGFHYSLVVTDTPPERALRNFLLARS*
Ga0070664_10083829223300005564Corn RhizosphereLESGRTLAVSAGLARRDYKDAVAAFLERWHGRAGAEGFQYSLIVTDTPPDRALRSFLLARKR*
Ga0066905_10198898023300005713Tropical Forest SoilAFLERTRMHAGAEGFQYSLVVTDAPPDHALRNFLLARRGART*
Ga0066903_10130601823300005764Tropical Forest SoilETGRALAINASMARRSYTDAMASFLERWHGRAGAEGFHYSLIVTDTPPARALRQFLLARVAR*
Ga0066903_10612616023300005764Tropical Forest SoilFLESMRSRAVTEGFQYSLVLTDTPPDRALRQFLLARQR*
Ga0068851_1028911723300005834Corn RhizosphereRQYTDAMAAFLERWHSRAGAEGFQYSLIVTDTPPERALRNFLLARRR*
Ga0074470_1137177323300005836Sediment (Intertidal)GRLGRVGAARVDDDVESGRTVAVNAATARREYRDRIAAFLERWRTSAGAEGFQYSLVVTDTPPDRALRNFLLMRSA*
Ga0068860_10212887313300005843Switchgrass RhizosphereRRDLEFADLETGRTLAVNAGLARRDYTDAIAAFLERWHGRAGSEGFHYSLVITDTPPARVLRNFLLARS*
Ga0068862_10157901413300005844Switchgrass RhizosphereEYKDAFAGFLERWHSRAGAEGFQYSLIVTDTPPDRALRNFLLARTR*
Ga0066656_1104104223300006034SoilPYRRDLELTDLETGRRLAINGGLARRGYKDAVAAFLERWRSRAGAEGFQYSLIVTDTPPDRALRHFLLARKG*
Ga0066652_10002215413300006046SoilAFLERCRRRAGAEGFQNSLIVTDTPPAHGLRNFLLARQR*
Ga0066652_10097750823300006046SoilDELELPYRRDLELTDLETGRRLAINGGLARRGYKDAVAAFLERWRSRAGAEGFQYSLIVTDTPPDRALRHFLLARKG*
Ga0075417_1017333613300006049Populus RhizosphereLETGQRLAINAGLARRDYKDAVAAFLERSRMRAAAEGFQYSLVVTDTPPDRALRNFLFARSQSKRSQG*
Ga0075417_1060124313300006049Populus RhizosphereGLARRDYTDAVTAFLERCRRRAGAEGFQYSLIVTDTFPGRGLRNFLLARRR*
Ga0074060_1145407613300006604SoilLEFADLETGRTLAINAGLARRDYKDAVAAFLERWHARAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0066665_1047122213300006796SoilEYKDGVAAFLERVRTLAVAEGFQYSLVVTDTPPDRALRNFLLARQG*
Ga0075431_10137430113300006847Populus RhizosphereIVVNADAARRDYTDVVSAFVERCRKRATAEGIQYSLVVTDTPPVRTLRSFLLARS*
Ga0075434_10015969233300006871Populus RhizosphereFLERCRMRAGSEGFQYALVMTDTPPDRALRSFLLARG*
Ga0075434_10107798413300006871Populus RhizosphereTVSVNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0075434_10243451813300006871Populus RhizosphereAVAAFLERWRTRAGSEAFQYSLVITDTPPDAALRKFLLSRQEK*
Ga0075429_10196991023300006880Populus RhizosphereDAARRDYTDVVSAFVERCRKRATAEGIQYSLVVTDTPPDRTLRSFLLARS*
Ga0075426_1078197313300006903Populus RhizosphereSVNAGLARRDYTDAVAAFLERMRGRAVAEGFQYSLIVTDTPPGRALRSFLLSRQG*
Ga0075426_1078197713300006903Populus RhizosphereSVNAGLARRDYTDAVAAFLERMRGRAVAEGFQYSLIVTDTAPGRALRSFLLSRQG*
Ga0075424_10005939613300006904Populus RhizosphereETGRRLAINAGLARREYKDAIAAFLERWRSRAVAEGFQYSLIVTDTPPDRALRNFLLSRRR*
Ga0075435_10039563713300007076Populus RhizosphereADLETGGIVAVNGREARRSYLDAVAAFLERWRTRAGSEAFQYSLVITDTPPDAALRKFLLSRQEK*
Ga0075435_10045964423300007076Populus RhizosphereVSVNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0075435_10048272813300007076Populus RhizosphereARREYKDALAAFLERWRTLAGREGIRYSLVVTDTPPERALRSFLLSRRATH*
Ga0075435_10171404013300007076Populus RhizosphereWRRRAGAEGFQYSLMVTDVPANRALRNFLAARQTPQNR*
Ga0066710_10121256423300009012Grasslands SoilDLETGSRVAVNADLVRRQYTDSVAAFLERMRSRAVGKGFQYSLIVTDTPPGLALRSFLLSRQG
Ga0105245_1102632613300009098Miscanthus RhizosphereRDFEFADLETGRSVSVNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0066709_10098244523300009137Grasslands SoilEYKDGVAAFLERMRTLAVAEGFQYSLVVTDTPPDRALRNFLLARQG*
Ga0075423_1030476913300009162Populus RhizosphereRDYKDAVAAFLERTRVRAVAEGFQYSLVVTDTPPDRALRSFLLARQQARP*
Ga0075423_1120353223300009162Populus RhizosphereLERSRLRAAAEGFQYVLVVTDTPPDRALRNFLLARSRSPRSQG*
Ga0105242_1286413823300009176Miscanthus RhizosphereFLERWHGRAGAEAFQYSLIVTDTPPERALRNFLLARRR*
Ga0105248_1054189613300009177Switchgrass RhizosphereSLARRSYTDAMASFLERWHSRAGAEGFHYSLIVTDTPPARALRQFLLARVTR*
Ga0105248_1095529223300009177Switchgrass RhizosphereRRQYTDAMAAFLERWRSRAGAEGFQYSLIVTDTPPERALRNVLLARKM*
Ga0134111_1049544513300010329Grasslands SoilLTDLETGRRLAINGGLARRGYKDAVAAFLKRWRSRAGAEGFQYSLIVTDTPPDRALRHFLLARKG*
Ga0134062_1052580213300010337Grasslands SoilDLELTDLETGRRLAINGGLARRGYKDAVAAFLERWRSRAGAEGFQYSLIVTDTPPDRALRHFLLARKG*
Ga0126379_1027362413300010366Tropical Forest SoilAGLARRGYRDAVARFLERTRANAAAQGFQYSLVVTDTPPDHALRNFLVARRGART*
Ga0134122_1060043623300010400Terrestrial SoilMAAFLERWHSRAGAEGFQYSLIVTDTPPERALRNFLLARKV*
Ga0134122_1200144813300010400Terrestrial SoilTLAVNAGLARREYTDAMAAFLERWHSRAGAEGFQYSLIVTDTPPERALRNFLLARVK*
Ga0134123_1223095113300010403Terrestrial SoilAVAAFLERWRSRAGAEGFQYSLVVTDTAPERSLRNFLLARQR*
Ga0134123_1347487713300010403Terrestrial SoilTRMHAGAEGFQYSLIVTDTAPDHALRNFLLARRGART*
Ga0151489_108827713300011106SoilRDFEFADLETGRTVSVNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0137463_106654723300011444SoilVNAASARREYKDGVAAFLERWRSRAGAEGFQYSLIVTDTPPDRALRAFLLAR*
Ga0137374_1072792423300012204Vadose Zone SoilGRTLAVNAALARREYTDGVTAFLERCRRRAAVNGFQYSLIVTDTPPERALRQFLLGRKR*
Ga0137368_1050176423300012358Vadose Zone SoilDLETGRSIAMNAQLARRDYTDAVAAFLEHCRRRSGAEGFQYSLIVTDTPPERALRQFLLGRKR*
Ga0157325_100578513300012485Arabidopsis RhizosphereSVSVNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR*
Ga0157299_1004670813300012899SoilAAARRDYTDAVTAFLESWRRRAGAEGFQYSLMVTDVPADRALRNFLAARQTPQNR*
Ga0157299_1029660223300012899SoilMSGGTDVVSAFVERCRKRATAEGIQYSLVVTDTPPERTLRNFLLARRTRT*
Ga0137396_1099164223300012918Vadose Zone SoilREYKDAIAAFLERWRSRAVAEGFQYSLIVTDTPPDRALRNFLLSRTR*
Ga0137394_1137402113300012922Vadose Zone SoilNAGLARREYKDAVAAFLERMRGRAVAEGFQYSLIVTDTPPGRALRNFLLARQR*
Ga0137419_1078465023300012925Vadose Zone SoilGRRLAINAGLARREYKDAIAAFLERWRSRAAAEGFQYSLIVTDTPPDRALRNFLLSRTR*
Ga0157375_1253123613300013308Miscanthus RhizosphereAMAAFLKRWHSRAGAEGFQYSLIVTDTPPERALRNVLLARKM*
Ga0157380_1246126813300014326Switchgrass RhizosphereESWRRRAGAEGFQYSLMVTDVPPDRALRNFLAARQTTPNR*
Ga0137420_129977023300015054Vadose Zone SoilELPYRRDLEFTDLETGRRLAINAGLARREYKDAIAAFLERWRSRAAAEGFQYSLIVTDTPPDRALRNFLLSRTR*
Ga0167647_112849523300015199Glacier Forefield SoilLERWHGRAGAGGFQYSLIVTDTPPQRALRNVLLARS*
Ga0132258_1364943123300015371Arabidopsis RhizosphereAAFLERTRMHAGFEGFQYSLIVTDTAPDQALRTFLLARRGART*
Ga0132258_1385633313300015371Arabidopsis RhizosphereNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIITDTPPAHGLRNFLLARQR*
Ga0132255_10398122623300015374Arabidopsis RhizosphereVAAFLERCRRRAGAEGFQYSLIITDTPPAHGLRNFLLARQR*
Ga0132255_10506011013300015374Arabidopsis RhizosphereRRSYLDAVAAFLERWRTRAGSEAFQYSLVITDTPPDAALRKFLLSRPEK*
Ga0182034_1078758723300016371SoilINASLARRSYTDAMASFLERWHGRAGAEGFHYSLIVTDTPPARALRQFLLARVAR
Ga0184611_108033013300018067Groundwater SedimentNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR
Ga0210381_1017501723300021078Groundwater SedimentADLETGRSIAVNAGLARRDYTDAVAAFLERCRRRAGAEGFQYSLIVTDTSPARGLRNFLLARRR
Ga0193719_1044668823300021344SoilDRASGFEFPYRRDLEFADLETGRSIAVNAGLARRDYTDAVAAFLERCRRRAGAEGFQYSLIVTDTSPARGLRNFLLARRR
Ga0207697_1034546813300025315Corn, Switchgrass And Miscanthus RhizosphereMSKLPAEFADLETGRSVSVNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR
Ga0207700_1142438113300025928Corn, Switchgrass And Miscanthus RhizosphereYGRDLEFADLETGRALAINASLARRSYTDAMASFLERWHSRAGAEGFHYSLIVTDTPPARALRQFLLARVTR
Ga0207701_1168167113300025930Corn, Switchgrass And Miscanthus RhizosphereGLARREYTDAIAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR
Ga0207704_1023135423300025938Miscanthus RhizosphereRRSYTDAMASFLERWHSRAGAEGFHYSLIVTDTPPARALRQFLLARVTR
Ga0207651_1171825523300025960Switchgrass RhizosphereSIARRSYTDAMASFLERWHSRAGAEGFHYSLIVTDTPPARALRQFLLARVTR
Ga0207712_1157530623300025961Switchgrass RhizosphereGRTLAVSAGLARRDYKDAVAVFLERWHSRAGAEGFQYSLIVTDTPPDRALRNFLLARTR
Ga0207640_1124070823300025981Corn RhizosphereINAGLARREYTDAVAAFLERWHARAGAEGFQYSLIVTDTPPERALRNFLLAR
Ga0207676_1079962123300026095Switchgrass RhizosphereFVDLENGESLAVDAAAARRDYTDAVTAFLESWRRRAGAEGFQYSLMVTDVPADRALRNFLAARQTPQNR
Ga0207675_10238802913300026118Switchgrass RhizosphereDLETGQRLAINAGLARHDYKENVASFLERWRSRAGAEGFQYSLIVTDTPPARALRNFLLAQPR
Ga0209855_101905423300026220Permafrost SoilSLAIDARLARRDYKDAVAAFLERWHSRAGAEGFQYSLIVTDTPPDRALRNFLLARGT
Ga0268264_1003198043300028381Switchgrass RhizosphereFEFADLETGRSVSVNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR
Ga0268264_1193044723300028381Switchgrass RhizosphereAIAAFLERWHGRAGSEGFQYSLVITDTPPARALRNFLLARS
Ga0247828_1033685513300028587SoilVEFTDLETGRRLAINAGLARRDYKDAVAAFLEKWRSRAAVEGFQYSLIVTDMPPQRALRNFLLARR
Ga0247818_1086572413300028589SoilLARRDYKDAVAAFLEKWRSRAAVEGFQYSLIVTDMPPQRALRNFLLARR
Ga0307280_1019324523300028768SoilARGDYKDAVAAFLERWRSRAGAEGFQYSLIVTDTPPERSLRNFLLARHR
Ga0307504_1010437513300028792SoilTDLETGRRLAINAGLARREYKDAVAAFLERWRSRAGAEGFQYSLIVTDTPPDRALRHFLLARS
Ga0307504_1011781513300028792SoilDLEFADLESGRLVSVNAGLARREYTDAVAAFLERCRRRAGAEGFQYSLIVTDTAPAHGLRNFLLARQR
Ga0307278_1042762713300028878SoilARLDYKDAVAAFLERWRSRAGAEGFQYSLIVTDTPPERSLRNFLLARRR
Ga0310813_1231700723300031716SoilLESGRTLAVSAGLARREYKDAFAGFLERWHSRAGAEGFQYSLIVTDTPPDRALRNFLLARTR
Ga0307468_10157684723300031740Hardwood Forest SoilDRVTAFLEQWRSRAAAEGFQYSLIVTDVPPQRALRNFLLARR
Ga0318546_1102563413300031771SoilSYTDAMASFLERWHGRAGAEGFHYSLIVTDTPPARALRQFLLARVAR
Ga0310900_1138426923300031908SoilRRDYTDVVSAFVERCRKRATAEGIQYSLVVTDTPPERTLRSFLLARS
Ga0310906_1088538013300032013SoilRTGVTAFLERCRMRAGSEGFQYSLVVTDTPPARALRGILLARPA
Ga0310890_1019392723300032075SoilYRRDVEFTDLETGRRLAINAGLARRDYKDAVAAFLEKWRSRAAVEGFQYSLIVTDMPPQRALRNFLLARR
Ga0310895_1009330713300032122SoilDYTDAVTAFLESWRRRAGAEGFQYSLMVTDVPPDRALRNFLVARQTPQNR
Ga0315281_1005903213300032163SedimentNASLVRREYQDAVAAFLERWRSRAGAEGFQYSLIVTDTPPDRALRNFLLARVTR
Ga0307470_1127577223300032174Hardwood Forest SoilMDATWSSAINAGLARREYKDAVAAFLERMRGRAVAEGFQYSLIVTDTPPDRALRNFLLARQR
Ga0307472_10099933923300032205Hardwood Forest SoilTDAVAAFLERWRSRAGAEGFQYSLIVTDTPPAHGLRNFLLARQR
Ga0307472_10262995513300032205Hardwood Forest SoilLARRDYTDAVAAFLERMRGRAVAEGFQYSLIVTDTPPGRALRSFLLSRQG
Ga0315271_1062509613300032256SedimentTAFLERWRSRAGAEGFQYSLIFTDTPPARALRSFLLARVTR
Ga0315275_1279707323300032401SedimentAVTAFLERWRSRAGAEGFQYSLIFTDTPPARALRSFLLARVTR
Ga0335069_1122078923300032893SoilTRSVSAALARQAYRDGLAAFLERWRVRASAEGFDYSLLITDTPPDRALRTFLLRRSLG
Ga0335084_1239054213300033004SoilFLERWRSRAGREGMQYVLVVTDTPPDRALRRFLLARA
Ga0310810_1120335813300033412SoilRDLEFTDLETGQSIALNAAFARDAYKNGVTEFFERCRMRAGAEGFQYALVVTDTPPARALRSILLARPA
Ga0310811_1062870623300033475SoilDYKEAVAAFLERWHSRAGAEGFQYSLIVTDTPPDRALRNFLLARKR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.