Basic Information | |
---|---|
Family ID | F070030 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 123 |
Average Sequence Length | 43 residues |
Representative Sequence | MIHLASVILICAYCNSEIERRTELEAREALAEHQNYVQCMKNY |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 90.24 % |
% of genes near scaffold ends (potentially truncated) | 17.07 % |
% of genes from short scaffolds (< 2000 bps) | 65.85 % |
Associated GOLD sequencing projects | 78 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.64 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (56.098 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (30.081 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.537 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.171 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 28.17% β-sheet: 11.27% Coil/Unstructured: 60.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF06067 | DUF932 | 31.97 |
PF07659 | DUF1599 | 3.28 |
PF04545 | Sigma70_r4 | 3.28 |
PF02945 | Endonuclease_7 | 3.28 |
PF13641 | Glyco_tranf_2_3 | 2.46 |
PF13481 | AAA_25 | 1.64 |
PF13362 | Toprim_3 | 1.64 |
PF01807 | zf-CHC2 | 0.82 |
PF01476 | LysM | 0.82 |
PF09723 | Zn-ribbon_8 | 0.82 |
PF12705 | PDDEXK_1 | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002835|B570J40625_100276254 | All Organisms → Viruses → Predicted Viral | 1725 | Open in IMG/M |
3300002835|B570J40625_100430154 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
3300003393|JGI25909J50240_1122180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 513 | Open in IMG/M |
3300003413|JGI25922J50271_10000209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 17464 | Open in IMG/M |
3300003499|JGI25930J51415_1000154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 13883 | Open in IMG/M |
3300003499|JGI25930J51415_1007242 | All Organisms → Viruses → Predicted Viral | 2310 | Open in IMG/M |
3300003499|JGI25930J51415_1078481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 549 | Open in IMG/M |
3300004096|Ga0066177_10273027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 711 | Open in IMG/M |
3300004096|Ga0066177_10406875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 592 | Open in IMG/M |
3300004112|Ga0065166_10297085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 658 | Open in IMG/M |
3300004125|Ga0066182_10086330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 740 | Open in IMG/M |
3300004126|Ga0066179_10243787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 512 | Open in IMG/M |
3300004240|Ga0007787_10669688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 519 | Open in IMG/M |
3300004796|Ga0007763_11375480 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
3300004797|Ga0007764_11695622 | All Organisms → Viruses → Predicted Viral | 1925 | Open in IMG/M |
3300005418|Ga0068881_1517012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 732 | Open in IMG/M |
3300005528|Ga0068872_10495932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 656 | Open in IMG/M |
3300005581|Ga0049081_10098744 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
3300005583|Ga0049085_10090456 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
3300005662|Ga0078894_10061325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3221 | Open in IMG/M |
3300005662|Ga0078894_10078577 | All Organisms → Viruses → Predicted Viral | 2868 | Open in IMG/M |
3300005662|Ga0078894_10493080 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
3300005662|Ga0078894_11059756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 694 | Open in IMG/M |
3300005805|Ga0079957_1091416 | All Organisms → Viruses → Predicted Viral | 1686 | Open in IMG/M |
3300006641|Ga0075471_10019660 | All Organisms → Viruses → Predicted Viral | 4018 | Open in IMG/M |
3300006641|Ga0075471_10175993 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
3300007973|Ga0105746_1052971 | All Organisms → Viruses → Predicted Viral | 1278 | Open in IMG/M |
3300008055|Ga0108970_10088352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 540 | Open in IMG/M |
3300008107|Ga0114340_1005235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 6928 | Open in IMG/M |
3300008107|Ga0114340_1015443 | All Organisms → Viruses → Predicted Viral | 3659 | Open in IMG/M |
3300008107|Ga0114340_1019017 | All Organisms → Viruses → Predicted Viral | 3257 | Open in IMG/M |
3300008107|Ga0114340_1047532 | All Organisms → Viruses → Predicted Viral | 1894 | Open in IMG/M |
3300008107|Ga0114340_1259175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 525 | Open in IMG/M |
3300008108|Ga0114341_10030630 | All Organisms → Viruses → Predicted Viral | 3680 | Open in IMG/M |
3300008110|Ga0114343_1073618 | All Organisms → Viruses → Predicted Viral | 1247 | Open in IMG/M |
3300008113|Ga0114346_1028522 | All Organisms → Viruses → Predicted Viral | 2936 | Open in IMG/M |
3300008113|Ga0114346_1185824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 847 | Open in IMG/M |
3300008114|Ga0114347_1094687 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
3300008114|Ga0114347_1135897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 900 | Open in IMG/M |
3300008114|Ga0114347_1183435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 715 | Open in IMG/M |
3300008116|Ga0114350_1033084 | All Organisms → Viruses → Predicted Viral | 2027 | Open in IMG/M |
3300008119|Ga0114354_1001573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 14204 | Open in IMG/M |
3300008120|Ga0114355_1039333 | All Organisms → Viruses → Predicted Viral | 2259 | Open in IMG/M |
3300008120|Ga0114355_1051804 | All Organisms → Viruses → Predicted Viral | 1862 | Open in IMG/M |
3300008262|Ga0114337_1026152 | All Organisms → Viruses → Predicted Viral | 3431 | Open in IMG/M |
3300008266|Ga0114363_1137113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 829 | Open in IMG/M |
3300009158|Ga0114977_10001458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 15554 | Open in IMG/M |
3300009159|Ga0114978_10863366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 507 | Open in IMG/M |
3300009163|Ga0114970_10419158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 741 | Open in IMG/M |
3300009164|Ga0114975_10673309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 548 | Open in IMG/M |
3300009181|Ga0114969_10000323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 40594 | Open in IMG/M |
3300010354|Ga0129333_10009584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 9148 | Open in IMG/M |
3300010354|Ga0129333_10756697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 831 | Open in IMG/M |
3300010370|Ga0129336_10137336 | All Organisms → Viruses → Predicted Viral | 1418 | Open in IMG/M |
3300011268|Ga0151620_1153514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 707 | Open in IMG/M |
3300012013|Ga0153805_1059870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 645 | Open in IMG/M |
3300013004|Ga0164293_10005198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 11084 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10010183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 11509 | Open in IMG/M |
3300013372|Ga0177922_10552595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 702 | Open in IMG/M |
3300013372|Ga0177922_10748026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2914 | Open in IMG/M |
3300017785|Ga0181355_1220481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 737 | Open in IMG/M |
3300019784|Ga0181359_1009252 | All Organisms → Viruses → Predicted Viral | 3441 | Open in IMG/M |
3300019784|Ga0181359_1035327 | All Organisms → Viruses → Predicted Viral | 1935 | Open in IMG/M |
3300019784|Ga0181359_1044832 | All Organisms → Viruses → Predicted Viral | 1710 | Open in IMG/M |
3300019784|Ga0181359_1101797 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
3300019784|Ga0181359_1254733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 530 | Open in IMG/M |
3300020570|Ga0208465_1005079 | All Organisms → Viruses → Predicted Viral | 2091 | Open in IMG/M |
3300020570|Ga0208465_1019283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 904 | Open in IMG/M |
3300021962|Ga0222713_10093068 | All Organisms → Viruses → Predicted Viral | 2176 | Open in IMG/M |
3300021963|Ga0222712_10165091 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
3300021963|Ga0222712_10411731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 819 | Open in IMG/M |
3300022179|Ga0181353_1000231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 11014 | Open in IMG/M |
3300022179|Ga0181353_1029645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1449 | Open in IMG/M |
3300022752|Ga0214917_10003273 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 18885 | Open in IMG/M |
3300022752|Ga0214917_10062111 | All Organisms → Viruses → Predicted Viral | 2420 | Open in IMG/M |
3300023184|Ga0214919_10321986 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
3300024531|Ga0255228_1027933 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
3300024554|Ga0255242_1128955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 527 | Open in IMG/M |
3300026425|Ga0256300_1067987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 514 | Open in IMG/M |
3300026565|Ga0256311_1055559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 894 | Open in IMG/M |
3300027121|Ga0255074_1052123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 507 | Open in IMG/M |
3300027133|Ga0255070_1015888 | All Organisms → Viruses → Predicted Viral | 1277 | Open in IMG/M |
3300027529|Ga0255077_1007989 | All Organisms → Viruses → Predicted Viral | 1880 | Open in IMG/M |
3300027679|Ga0209769_1049870 | All Organisms → Viruses → Predicted Viral | 1413 | Open in IMG/M |
3300027697|Ga0209033_1003239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 8604 | Open in IMG/M |
3300027697|Ga0209033_1013148 | All Organisms → Viruses → Predicted Viral | 3592 | Open in IMG/M |
3300027733|Ga0209297_1113352 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
3300027734|Ga0209087_1000165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 41734 | Open in IMG/M |
3300027754|Ga0209596_1000084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 82688 | Open in IMG/M |
3300027754|Ga0209596_1000084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 82688 | Open in IMG/M |
3300027769|Ga0209770_10225897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 732 | Open in IMG/M |
3300027785|Ga0209246_10316836 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 597 | Open in IMG/M |
3300027804|Ga0209358_10000335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 41429 | Open in IMG/M |
3300027804|Ga0209358_10185064 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
3300027804|Ga0209358_10330165 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 740 | Open in IMG/M |
3300027816|Ga0209990_10007446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 7111 | Open in IMG/M |
3300027816|Ga0209990_10279144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 753 | Open in IMG/M |
3300027974|Ga0209299_1002535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 9734 | Open in IMG/M |
3300028025|Ga0247723_1000370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 31153 | Open in IMG/M |
3300028025|Ga0247723_1038306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1447 | Open in IMG/M |
3300028394|Ga0304730_1000679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 28467 | Open in IMG/M |
3300029697|Ga0256301_1079922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 564 | Open in IMG/M |
3300029699|Ga0255233_1036735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 966 | Open in IMG/M |
3300029930|Ga0119944_1028220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 733 | Open in IMG/M |
3300031758|Ga0315907_10282947 | All Organisms → Viruses → Predicted Viral | 1366 | Open in IMG/M |
3300031758|Ga0315907_10855670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 672 | Open in IMG/M |
3300031784|Ga0315899_10073894 | All Organisms → Viruses → Predicted Viral | 3532 | Open in IMG/M |
3300031784|Ga0315899_10269215 | All Organisms → Viruses → Predicted Viral | 1694 | Open in IMG/M |
3300031784|Ga0315899_10385371 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
3300031786|Ga0315908_10002990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 12254 | Open in IMG/M |
3300031857|Ga0315909_10149817 | All Organisms → Viruses → Predicted Viral | 1923 | Open in IMG/M |
3300031857|Ga0315909_10929101 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 533 | Open in IMG/M |
3300031951|Ga0315904_10505582 | All Organisms → Viruses → Predicted Viral | 1064 | Open in IMG/M |
3300031963|Ga0315901_10146125 | All Organisms → Viruses → Predicted Viral | 2116 | Open in IMG/M |
3300031963|Ga0315901_10777149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 698 | Open in IMG/M |
3300032093|Ga0315902_10128879 | All Organisms → Viruses → Predicted Viral | 2678 | Open in IMG/M |
3300033993|Ga0334994_0094945 | All Organisms → Viruses → Predicted Viral | 1762 | Open in IMG/M |
3300033994|Ga0334996_0101742 | All Organisms → Viruses → Predicted Viral | 1673 | Open in IMG/M |
3300033996|Ga0334979_0088968 | All Organisms → Viruses → Predicted Viral | 1939 | Open in IMG/M |
3300034012|Ga0334986_0217060 | All Organisms → Viruses → Predicted Viral | 1059 | Open in IMG/M |
3300034122|Ga0335060_0690977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 504 | Open in IMG/M |
3300034283|Ga0335007_0013086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 6592 | Open in IMG/M |
3300034283|Ga0335007_0119283 | All Organisms → Viruses → Predicted Viral | 1927 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 30.08% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 14.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.76% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.76% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.94% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.32% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.25% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.44% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.44% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.63% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.63% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.63% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.81% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.81% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.81% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.81% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004797 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005418 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024554 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026565 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J40625_1002762544 | 3300002835 | Freshwater | MIHLASVTLICAYCNAEIERRTEREAQDALLHHQQYVQCMKNY* |
B570J40625_1004301544 | 3300002835 | Freshwater | MIHITSVILLCAYCNAEIERRTEDEARQALAEHQTYVQCMKGY* |
JGI25909J50240_11221802 | 3300003393 | Freshwater Lake | MTIHLASVILICAYCNAEIERRTEEEARQGLAEHHTYVQCMKGY* |
JGI25922J50271_1000020910 | 3300003413 | Freshwater Lake | MIYLASVCLICSYCNAEIERRTEREAREALAWHQKYVQCMKEY* |
JGI25930J51415_100015419 | 3300003499 | Freshwater Lake | MIIQESVTLVCEYCNAEIERHTNLEAREALAEHQNYVQCIKGY* |
JGI25930J51415_10072425 | 3300003499 | Freshwater Lake | MIHXXSVILLCAYCNAEIERRTEDEARQALAEHQTYVQCMKGY* |
JGI25930J51415_10784811 | 3300003499 | Freshwater Lake | MTIHLASVILICAYCNAEIERRTESEAREGLAEHQTYVQCMKGY* |
Ga0066177_102730271 | 3300004096 | Freshwater Lake | MIHLASVILICAYCNSEIERTTELEAREALQYHQQYVQCMK |
Ga0066177_104068751 | 3300004096 | Freshwater Lake | MTIHLASVILICAYCNSEIERTTELAAREALAEHQNYVQCMKNY* |
Ga0065166_102970852 | 3300004112 | Freshwater Lake | MIHIDSVTIICDYCNAEIERRSSREALEALAQHQQYVQCIKNY* |
Ga0066182_100863301 | 3300004125 | Freshwater Lake | MIHLASVVLICAYCNSEIERTTELEAREALQYHQQYVQCMKNY* |
Ga0066179_102437872 | 3300004126 | Freshwater Lake | MTIHLASVILICAYCNSEIERTTELAAREALQYHQQYVQCMKNY* |
Ga0007787_106696881 | 3300004240 | Freshwater Lake | MIHLTSVVLICSYCNAEIERRTEREAQEALALHQNYVQCIKNY* |
Ga0007763_113754803 | 3300004796 | Freshwater Lake | MIHLTSVILLCAYCNAEIERRTEDEARQALAEHQTYVQCMKGY* |
Ga0007764_116956224 | 3300004797 | Freshwater Lake | MIHIASVILLCAYCNAEIERRTEDEARQALAEHQTYVQCMKGY* |
Ga0068881_15170122 | 3300005418 | Freshwater Lake | MIHLTSVILICGYCNAEIERHTEDEAREALAVHQKYVQCMKEY* |
Ga0068872_104959323 | 3300005528 | Freshwater Lake | MIYLASVCLICSYCNAEIERVTEREAQEALAWHQKYVQCMKEY* |
Ga0049081_100987442 | 3300005581 | Freshwater Lentic | MIHVTSVILLCAYCNAEIERRTEDEARQALAEHQTYVQCMKGY* |
Ga0049085_100904562 | 3300005583 | Freshwater Lentic | MTIHLASVILICAYCNSEIERTTELGAREALAEHQNYVQCMKNY* |
Ga0078894_100613253 | 3300005662 | Freshwater Lake | MIHLTSVILICSYCNAEIERRTEREARDALMIHQKYVQCMKEY* |
Ga0078894_100785775 | 3300005662 | Freshwater Lake | MESKGGSMIHIESVVLLCAYCNSEIERRTELEAREALAEHQNYVQCMKNY* |
Ga0078894_104930802 | 3300005662 | Freshwater Lake | MIYLASVCLICSYCNAEIERRSEREAQEALAWHQKYVQCMKEY* |
Ga0078894_110597562 | 3300005662 | Freshwater Lake | MIHLTSVVLICSYCNAEIERRTEREAREALMIHQKYVQCMKEY* |
Ga0079957_10914164 | 3300005805 | Lake | MTIHLASVILICAYCNAEIERRTESEAREALAEHQTYVQCMKGY* |
Ga0075471_100196608 | 3300006641 | Aqueous | MIHIESVTIICDYCNAEIERPTVREAHEALLHHQKYVQCIKNY* |
Ga0075471_101759934 | 3300006641 | Aqueous | MIHLTSVILICSYCNAEIERHTEDEAREALMIHQKYVQCMKEY* |
Ga0105746_10529714 | 3300007973 | Estuary Water | MIHLVSVVLICAYCNSEIERRTELEAREALAEHQNYVQCMKNY* |
Ga0108970_100883522 | 3300008055 | Estuary | MIHIDSVTLICSYCNAEIERRTEREAEDALMHHQQYIQCMKEY* |
Ga0114340_100523513 | 3300008107 | Freshwater, Plankton | MIYLTSVTLICSYCNAEIERRTEREAQEALAYHQKYVQCMKNY* |
Ga0114340_10154434 | 3300008107 | Freshwater, Plankton | MIVQTSVTLICTYCNAEIERRTEREAREALAEHEKYVQCMKNY* |
Ga0114340_10190174 | 3300008107 | Freshwater, Plankton | MIHLTSVTLICPYCNAEIERRTEQEAKDELAYHQNYIQCMKNY* |
Ga0114340_10475324 | 3300008107 | Freshwater, Plankton | MIHLASVILICSYCNAEIERTTERDARDALMIHQKYVQCMKEY* |
Ga0114340_12591752 | 3300008107 | Freshwater, Plankton | MIHLASVTIICDYCNAEIERRTSREALEALMIHQKYVQCMKEY* |
Ga0114341_1003063010 | 3300008108 | Freshwater, Plankton | MIYLSSVILICPYCNAEIERRTEREAEEALAYHQNYVQCMKNY* |
Ga0114343_10736183 | 3300008110 | Freshwater, Plankton | MTIHLASVCLICAYCNAEIERRTEVEAREALAQHQNYVQCMKNY* |
Ga0114346_10285227 | 3300008113 | Freshwater, Plankton | MIHLASVILICSYCNAEIERRTEREARDALMIHQKYVQCMKEY* |
Ga0114346_11858242 | 3300008113 | Freshwater, Plankton | MIHLTSVILICGYCNAEIERHTKLEAREALAEHQNYVQCIKGY* |
Ga0114347_10946874 | 3300008114 | Freshwater, Plankton | MIHLTSVILICGYCNAEIERRTEDEAREALAVHQNYVKCMKEY* |
Ga0114347_11358974 | 3300008114 | Freshwater, Plankton | MIHLTSVILICAYCNAEIERHTEDEAREALAVHQKYVQCMKEY* |
Ga0114347_11834351 | 3300008114 | Freshwater, Plankton | MIIQESVILVCEYCNAEIERHTKLEAREALAEHQNYVQCIKGY* |
Ga0114350_10330842 | 3300008116 | Freshwater, Plankton | MIHLTSVILLCSYCNAEIERRTEDEARQALAEHQKYVQCVKGY* |
Ga0114354_100157325 | 3300008119 | Freshwater, Plankton | MIHIASVTIICDYCNAEIERRTSREALEALAQHQNYVQCIKNTDG* |
Ga0114355_10393331 | 3300008120 | Freshwater, Plankton | MIYLASVCLICSYCNAEIERRSEREAQEALAWHQKYV |
Ga0114355_10518045 | 3300008120 | Freshwater, Plankton | MIHIASVTIICDYCNAEIERRTSREALEALAQHQNYVQCIKNY* |
Ga0114337_10261528 | 3300008262 | Freshwater, Plankton | MIHLTSVVLICPFCNAEIERRTEREAEEALAYHQNYIQCMKNY* |
Ga0114363_11371132 | 3300008266 | Freshwater, Plankton | MIHLTSVILICSYCNAEIERRTEDEAREALAVHQNYVKCMKEY* |
Ga0114977_1000145819 | 3300009158 | Freshwater Lake | MIHLASVVLICAYCNSEIERTTELAAREALAEHQQYVQCIKNY* |
Ga0114978_108633662 | 3300009159 | Freshwater Lake | MTIHLASVILICAYCNSEIERTTELAAREALAEHQTYVQCMKNY* |
Ga0114970_104191582 | 3300009163 | Freshwater Lake | MTIHLASVILICAYCNSEIERRTELEAREALAEHQNYVQCMKNY* |
Ga0114975_106733092 | 3300009164 | Freshwater Lake | MIHLASVVLICAYCNSEIERTTELEAREALLHHQQYVQCMKNY* |
Ga0114969_1000032340 | 3300009181 | Freshwater Lake | MIHIASVVLICAYCNAEIERRTELEATEALAHHQQYVQCIKNY* |
Ga0129333_100095846 | 3300010354 | Freshwater To Marine Saline Gradient | MIIQTSVTLICAYCNAEIERRTEIEAREALAQHQNYVQCMKEY* |
Ga0129333_107566974 | 3300010354 | Freshwater To Marine Saline Gradient | MIHLTSVILICSYCNAEIERRTENEAREALAEHQTYVQCMKGY* |
Ga0129336_101373364 | 3300010370 | Freshwater To Marine Saline Gradient | MIHLTSVILICSFCNAEIERHTEDEAREALAIHQKYVQCMKEY* |
Ga0151620_11535144 | 3300011268 | Freshwater | MIHIASVILLCAYCNAEIERRTEDEARQALAEHQTYVQCM |
Ga0153805_10598701 | 3300012013 | Surface Ice | MTIHLASVILICAYCNAEIERRTESEAREGLAEHQTYV |
Ga0164293_100051988 | 3300013004 | Freshwater | MIHIDSVTIICDYCNAEIERRTSREALEALAQHQNYVQCIKNY* |
(restricted) Ga0172373_100101832 | 3300013131 | Freshwater | MIHLTSVILICGYCNAEIERRTESEAREALAIHQNYVKCMKEY* |
Ga0177922_105525954 | 3300013372 | Freshwater | LCAYCNAEIERRTEDEARQALAEHQTYVQCMKGY* |
Ga0177922_107480262 | 3300013372 | Freshwater | MTIHLASVILICAYCNAEIERWTESEAREGLAEHQTYVQCMKGY* |
Ga0181355_12204811 | 3300017785 | Freshwater Lake | MIHLASVILICAYCNSEIERTTELAAREALAEHQNYVQCMKN |
Ga0181359_10092527 | 3300019784 | Freshwater Lake | MTIHLASVILICAYCNAEIERRTEEEARQGLAEHHTYVQCMKGY |
Ga0181359_10353274 | 3300019784 | Freshwater Lake | MIHLASVVLICAYCNSEIERTTELEAREALQYHQQYVQCMKNY |
Ga0181359_10448321 | 3300019784 | Freshwater Lake | MTIHLASVILICAYCNAEIERRTESEAREGLAEHHTYVL |
Ga0181359_11017973 | 3300019784 | Freshwater Lake | MIHIASVILLCAYCNAEIERRTEDEARQALAEHQTYVQCMKGY |
Ga0181359_12547333 | 3300019784 | Freshwater Lake | MTIHLASVILICAYCNSEIERTTELAAREALAEHQNYVQCMKNY |
Ga0208465_10050794 | 3300020570 | Freshwater | MIHITSVILLCAYCNAEIERRTEDEARQALAEHQTYVQCMKGY |
Ga0208465_10192834 | 3300020570 | Freshwater | MTIHLASVILICAYCNAEIERRTESEAREGLAEHQTYVQCMKGY |
Ga0222713_100930684 | 3300021962 | Estuarine Water | MIHIESVILICDYCNAEIERPKVREALEALAHHQKYVQCIKNY |
Ga0222712_101650914 | 3300021963 | Estuarine Water | MIHLASVILICAYCNSEIERRTELEAREALAEHQNYVQCMKNY |
Ga0222712_104117312 | 3300021963 | Estuarine Water | MIHLTSVILICSFCNAEIERRTEQEAREALAVHQKYVQCMKEY |
Ga0181353_100023120 | 3300022179 | Freshwater Lake | MTIHLASVILICAYCNAEIERRTESEAREGLAEHHTYVQCMKGY |
Ga0181353_10296451 | 3300022179 | Freshwater Lake | ESVTLVCEYCNAEIERHTNLEAREALAEHQNYVQCIKGY |
Ga0214917_1000327332 | 3300022752 | Freshwater | MRNVLQRTQGKEGSMIIQASVTLVCEYCNAEIERHTNLEAREALAEHQNYVQCIKGY |
Ga0214917_100621114 | 3300022752 | Freshwater | MIYLTSVTLICSYCNAEIERRTEREAQEALAYHQKYVQCMKNY |
Ga0214919_103219864 | 3300023184 | Freshwater | MIVQTSVTLICSYCNAEIERRTEREARDALMIHQKYVQCMKEY |
Ga0255228_10279332 | 3300024531 | Freshwater | MTIHLGSVSLICAYCNAEIERRTEEEARQGLAEHHTYVQCMKGY |
Ga0255242_11289553 | 3300024554 | Freshwater | IHLASVILICAYCNAEIERRTEEEARQGLAEHHTYVQCMKGY |
Ga0256300_10679873 | 3300026425 | Freshwater | MTIHLASVILICAYCNAEIERRTEEEARQGLAEHHTYVQCM |
Ga0256311_10555594 | 3300026565 | Freshwater | VILICAYCNAEIERRTEEEARQGLAEHHTYVQCMKGY |
Ga0255074_10521232 | 3300027121 | Freshwater | MIHIDSVTLICSYCNAEIERRTEREAEDALMHHQQYIQCMKEY |
Ga0255070_10158883 | 3300027133 | Freshwater | MIHIDSVTLICSYCNAEIERRTEREAEDALMHHQQYIQ |
Ga0255077_10079894 | 3300027529 | Freshwater | MIHIDSVTLICSYCNAEIERRTKREAEDALMHHQQYIQCMKNY |
Ga0209769_10498704 | 3300027679 | Freshwater Lake | MTIHLASVILICAYCNSEIERTTELAAREALQYHQQYV |
Ga0209033_100323915 | 3300027697 | Freshwater Lake | MIYLASVCLICSYCNAEIERRTEREAREALAWHQKYVQCMKEY |
Ga0209033_10131484 | 3300027697 | Freshwater Lake | MIHLTSVILLCAYCNAEIERRTEDEARQALAEHQTYVQCMKGY |
Ga0209297_11133524 | 3300027733 | Freshwater Lake | MIHLASVVLICAYCNSEIERTTELAAREALAEHQQYVQCIKNY |
Ga0209087_100016544 | 3300027734 | Freshwater Lake | MASKGGSMIHLASVVLICAYCNSEIERTTELAAREALAEHQQYVQCIKNY |
Ga0209596_1000084114 | 3300027754 | Freshwater Lake | MIHLVSVVLICAYCNSEIERRTELEAREALAEHQNYVQCMKNY |
Ga0209596_100008441 | 3300027754 | Freshwater Lake | MGSEERSMIHIASVVLICAYCNAEIERRTELEATEALAHHQQYVQCIKNY |
Ga0209770_102258973 | 3300027769 | Freshwater Lake | MIHLTSVILICSYCNAEIERRTEREARDALMIHQKYVQCMKEY |
Ga0209246_103168361 | 3300027785 | Freshwater Lake | MTIHLASVILICAYCNSEIERTTELAAREALQYHQQYVQCMKNY |
Ga0209358_1000033547 | 3300027804 | Freshwater Lake | MRNVLQRTQGKEGNMIIQESVTLVCEYCNAEIERHTNLEAREALAEHQNYVQCIKGY |
Ga0209358_101850645 | 3300027804 | Freshwater Lake | MIHIASVVIICDYCNAEIERPTTREALEALAYHQRYV |
Ga0209358_103301651 | 3300027804 | Freshwater Lake | GSEERSMIHIDSVILICSYCNAEIERRTKREAEDALMHHQQYIQCMKNY |
Ga0209990_100074468 | 3300027816 | Freshwater Lake | MIHLTSVILICGYCNAEIERHTEDEAREALAVHQKYVQCMKEY |
Ga0209990_102791441 | 3300027816 | Freshwater Lake | MIHLTSVVLICPFCNAEIERRTEREAEEALAYHQNYIQCMKN |
Ga0209299_100253514 | 3300027974 | Freshwater Lake | MIYLASVCLICSYCNAEIERVTEREAQEALAWHQKYVQCMKEY |
Ga0247723_100037015 | 3300028025 | Deep Subsurface Sediment | MIIQTSVTLVCEYCNAEIERRTNLEAREALAEHQNYVQCLKGY |
Ga0247723_10383064 | 3300028025 | Deep Subsurface Sediment | MIHIASVVLICAYCNAEIERRTEVEAREALAQHQNYVKCMKEY |
Ga0304730_100067911 | 3300028394 | Freshwater Lake | MIHIASVVLICAYCNAEIERRTELEATEALAHHQQYVQCIKNY |
Ga0256301_10799223 | 3300029697 | Freshwater | MTIHLASVILICAYCNAEIERRTEEEARQGLAEHHTYVQCMKG |
Ga0255233_10367351 | 3300029699 | Freshwater | RKEGSMTIHLASVILICAYCNAEIERRTEEEARQGLAEHHTYVQCMKGY |
Ga0119944_10282202 | 3300029930 | Aquatic | MIHLTSVILICSYCNAEIERRTENEAREALAEHQTYVQCMKGY |
Ga0315907_102829474 | 3300031758 | Freshwater | MIHLTSVILLCSYCNAEIERRTEDEARQALAEHQKYVQCVKGY |
Ga0315907_108556702 | 3300031758 | Freshwater | MIHLTSVILICGYCNAEIERRTEDEAREALAVHQNYVKCMKEY |
Ga0315899_100738942 | 3300031784 | Freshwater | MIYLSSVILICPYCNAEIERRTEREAEEALAYHQNYVQCMKNY |
Ga0315899_102692154 | 3300031784 | Freshwater | MIHLTSVILICSYCNAEIERRTEREAQEALMIHQKYVQCMKEY |
Ga0315899_103853714 | 3300031784 | Freshwater | MIHLASVTIICDYCNAEIERRTSREALEALMIHQKYVQCMKEY |
Ga0315908_100029906 | 3300031786 | Freshwater | MIHIASVTIICDYCNAEIERRTSREALEALAQHQNYVQCIKNY |
Ga0315909_101498174 | 3300031857 | Freshwater | MIHLTSVILICSYCNAEIERRTEDEAREALAVHQNYVKCMKEY |
Ga0315909_109291011 | 3300031857 | Freshwater | GTQGKEGSMIHLTSVILICSYCNAEIERHTEDEAREALMIHQKYVQCMKEY |
Ga0315904_105055822 | 3300031951 | Freshwater | MIIQESVILVCEYCNAEIERHTKLEAREALAEHQNYVQCIKGY |
Ga0315901_101461252 | 3300031963 | Freshwater | MESKGGSMIYLASVCLICSYCNAEIERRTEREAREALAEHEKYVQCMKNY |
Ga0315901_107771491 | 3300031963 | Freshwater | MIHLTSVVLICSYCNAEIERRTEREAREALMIHQKYVQCMKEY |
Ga0315902_101288797 | 3300032093 | Freshwater | MIHLTSVVLICPFCNAEIERRTEREAEEALAYHQNYIQCMKNY |
Ga0334994_0094945_680_811 | 3300033993 | Freshwater | MIHLASVTLICAYCNAEIERRTEREAQDALLHHQQYVQCMKNY |
Ga0334996_0101742_529_660 | 3300033994 | Freshwater | MIYLASVILICSYCNSEIERRTETEAREALAEHQNYVQCVKNY |
Ga0334979_0088968_1432_1563 | 3300033996 | Freshwater | MIHIDSVTIICDYCNAEIERRTSREALEALAQHQNYVQCIKNY |
Ga0334986_0217060_749_880 | 3300034012 | Freshwater | MIVQTSVTLICTYCNAEIERRTEREAREALAEHENYVQCMKNY |
Ga0335060_0690977_1_117 | 3300034122 | Freshwater | MIHIASVILLCAYCNAEIERRTEDEARQALAEHQTYVQC |
Ga0335007_0013086_753_884 | 3300034283 | Freshwater | MIVQTSVTLICTYCNAEIERRTEREAQDALVHHQQYVQCMKNY |
Ga0335007_0119283_1262_1393 | 3300034283 | Freshwater | MIHIASVVIICDYCNAEIERRTSREALEALAQHQNYVQCIKNY |
⦗Top⦘ |