| Basic Information | |
|---|---|
| Family ID | F069960 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MSTLQTVVIVVSLALFAVGVHDLQLWLERWDHERHFND |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 72.36 % |
| % of genes near scaffold ends (potentially truncated) | 20.33 % |
| % of genes from short scaffolds (< 2000 bps) | 82.93 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.789 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.260 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.081 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.528 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF00561 | Abhydrolase_1 | 37.70 |
| PF12697 | Abhydrolase_6 | 9.02 |
| PF12146 | Hydrolase_4 | 8.20 |
| PF03600 | CitMHS | 2.46 |
| PF00550 | PP-binding | 1.64 |
| PF00109 | ketoacyl-synt | 1.64 |
| PF16197 | KAsynt_C_assoc | 1.64 |
| PF04542 | Sigma70_r2 | 1.64 |
| PF01738 | DLH | 1.64 |
| PF13822 | ACC_epsilon | 0.82 |
| PF01039 | Carboxyl_trans | 0.82 |
| PF00872 | Transposase_mut | 0.82 |
| PF01494 | FAD_binding_3 | 0.82 |
| PF00441 | Acyl-CoA_dh_1 | 0.82 |
| PF07690 | MFS_1 | 0.82 |
| PF00072 | Response_reg | 0.82 |
| PF13191 | AAA_16 | 0.82 |
| PF02652 | Lactate_perm | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.64 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.64 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.64 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.64 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.64 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.82 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.82 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.82 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 0.82 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 0.82 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.82 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.82 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.82 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.79 % |
| Unclassified | root | N/A | 38.21 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS401DBQ8J | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005548|Ga0070665_100636074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1080 | Open in IMG/M |
| 3300005548|Ga0070665_101371754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 716 | Open in IMG/M |
| 3300005563|Ga0068855_100701613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1083 | Open in IMG/M |
| 3300005577|Ga0068857_101486518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 660 | Open in IMG/M |
| 3300005718|Ga0068866_10003216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 6737 | Open in IMG/M |
| 3300005718|Ga0068866_10378013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 908 | Open in IMG/M |
| 3300005764|Ga0066903_102292572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1043 | Open in IMG/M |
| 3300005841|Ga0068863_100406201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1333 | Open in IMG/M |
| 3300005843|Ga0068860_101114571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 809 | Open in IMG/M |
| 3300005937|Ga0081455_10064530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 3066 | Open in IMG/M |
| 3300006755|Ga0079222_12512085 | Not Available | 517 | Open in IMG/M |
| 3300009094|Ga0111539_10812589 | Not Available | 1088 | Open in IMG/M |
| 3300009098|Ga0105245_10444698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae | 1303 | Open in IMG/M |
| 3300009098|Ga0105245_11217253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 801 | Open in IMG/M |
| 3300009101|Ga0105247_10558529 | Not Available | 843 | Open in IMG/M |
| 3300009148|Ga0105243_12827969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 526 | Open in IMG/M |
| 3300009174|Ga0105241_10628677 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300009522|Ga0116218_1502531 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009789|Ga0126307_10012738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6174 | Open in IMG/M |
| 3300009789|Ga0126307_11742743 | Not Available | 506 | Open in IMG/M |
| 3300010162|Ga0131853_10743937 | Not Available | 802 | Open in IMG/M |
| 3300010339|Ga0074046_10231462 | Not Available | 1152 | Open in IMG/M |
| 3300010339|Ga0074046_10447475 | Not Available | 776 | Open in IMG/M |
| 3300010361|Ga0126378_12062783 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300010376|Ga0126381_102257674 | Not Available | 782 | Open in IMG/M |
| 3300010379|Ga0136449_100230771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 3467 | Open in IMG/M |
| 3300010400|Ga0134122_11179387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 765 | Open in IMG/M |
| 3300011119|Ga0105246_10299085 | Not Available | 1298 | Open in IMG/M |
| 3300012899|Ga0157299_10250204 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012914|Ga0157297_10127516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 801 | Open in IMG/M |
| 3300012951|Ga0164300_10140351 | Not Available | 1119 | Open in IMG/M |
| 3300012951|Ga0164300_10447696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 724 | Open in IMG/M |
| 3300012955|Ga0164298_10558877 | Not Available | 777 | Open in IMG/M |
| 3300012958|Ga0164299_10368035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 911 | Open in IMG/M |
| 3300012984|Ga0164309_10645239 | Not Available | 833 | Open in IMG/M |
| 3300012984|Ga0164309_10712702 | Not Available | 798 | Open in IMG/M |
| 3300012988|Ga0164306_11681361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae | 550 | Open in IMG/M |
| 3300013297|Ga0157378_10038638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 4231 | Open in IMG/M |
| 3300013297|Ga0157378_11000960 | Not Available | 870 | Open in IMG/M |
| 3300013306|Ga0163162_10267904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 1840 | Open in IMG/M |
| 3300013306|Ga0163162_11670655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae | 727 | Open in IMG/M |
| 3300013308|Ga0157375_11651211 | Not Available | 758 | Open in IMG/M |
| 3300014969|Ga0157376_10745427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 988 | Open in IMG/M |
| 3300015373|Ga0132257_104065215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 532 | Open in IMG/M |
| 3300016319|Ga0182033_10758270 | Not Available | 853 | Open in IMG/M |
| 3300016319|Ga0182033_11637906 | Not Available | 582 | Open in IMG/M |
| 3300016404|Ga0182037_10853880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae | 787 | Open in IMG/M |
| 3300016445|Ga0182038_11813373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. MOTT36Y | 551 | Open in IMG/M |
| 3300017792|Ga0163161_12034316 | Not Available | 511 | Open in IMG/M |
| 3300017959|Ga0187779_10722431 | Not Available | 675 | Open in IMG/M |
| 3300017970|Ga0187783_10219541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1394 | Open in IMG/M |
| 3300017973|Ga0187780_10016827 | All Organisms → cellular organisms → Bacteria | 5293 | Open in IMG/M |
| 3300018064|Ga0187773_11035950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 540 | Open in IMG/M |
| 3300018085|Ga0187772_10169908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1452 | Open in IMG/M |
| 3300018089|Ga0187774_11019791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae | 579 | Open in IMG/M |
| 3300018089|Ga0187774_11489583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae | 500 | Open in IMG/M |
| 3300018090|Ga0187770_10333128 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300018466|Ga0190268_10173885 | Not Available | 1137 | Open in IMG/M |
| 3300019356|Ga0173481_10078548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1214 | Open in IMG/M |
| 3300020579|Ga0210407_10120361 | All Organisms → cellular organisms → Bacteria | 2008 | Open in IMG/M |
| 3300020582|Ga0210395_10204194 | Not Available | 1482 | Open in IMG/M |
| 3300020582|Ga0210395_10444268 | Not Available | 976 | Open in IMG/M |
| 3300021170|Ga0210400_10116089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2132 | Open in IMG/M |
| 3300021170|Ga0210400_10629401 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300021178|Ga0210408_10133633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1960 | Open in IMG/M |
| 3300021372|Ga0213877_10045798 | Not Available | 1251 | Open in IMG/M |
| 3300021401|Ga0210393_10026202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 4547 | Open in IMG/M |
| 3300021401|Ga0210393_10026202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 4547 | Open in IMG/M |
| 3300021401|Ga0210393_10516667 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 975 | Open in IMG/M |
| 3300021403|Ga0210397_10398054 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1029 | Open in IMG/M |
| 3300021404|Ga0210389_10036748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 3761 | Open in IMG/M |
| 3300021405|Ga0210387_11248579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 644 | Open in IMG/M |
| 3300021444|Ga0213878_10040552 | Not Available | 1793 | Open in IMG/M |
| 3300021560|Ga0126371_12752615 | Not Available | 596 | Open in IMG/M |
| 3300022722|Ga0242657_1100254 | Not Available | 712 | Open in IMG/M |
| 3300025898|Ga0207692_10077573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1768 | Open in IMG/M |
| 3300025899|Ga0207642_10158545 | Not Available | 1212 | Open in IMG/M |
| 3300025899|Ga0207642_10180846 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1149 | Open in IMG/M |
| 3300025906|Ga0207699_10033996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2887 | Open in IMG/M |
| 3300025911|Ga0207654_10254700 | Not Available | 1178 | Open in IMG/M |
| 3300025927|Ga0207687_10702289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae | 858 | Open in IMG/M |
| 3300025937|Ga0207669_10121160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1776 | Open in IMG/M |
| 3300025949|Ga0207667_10978079 | Not Available | 835 | Open in IMG/M |
| 3300025961|Ga0207712_10272766 | Not Available | 1377 | Open in IMG/M |
| 3300026023|Ga0207677_10284105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1360 | Open in IMG/M |
| 3300026142|Ga0207698_11653473 | Not Available | 656 | Open in IMG/M |
| 3300027701|Ga0209447_10009503 | Not Available | 2823 | Open in IMG/M |
| 3300027894|Ga0209068_10729709 | Not Available | 581 | Open in IMG/M |
| 3300027911|Ga0209698_11430805 | Not Available | 503 | Open in IMG/M |
| 3300030520|Ga0311372_10145494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 4124 | Open in IMG/M |
| 3300031184|Ga0307499_10093016 | Not Available | 814 | Open in IMG/M |
| 3300031544|Ga0318534_10208487 | Not Available | 1128 | Open in IMG/M |
| 3300031564|Ga0318573_10182690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 1108 | Open in IMG/M |
| 3300031715|Ga0307476_10209801 | Not Available | 1416 | Open in IMG/M |
| 3300031715|Ga0307476_10453947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae | 949 | Open in IMG/M |
| 3300031718|Ga0307474_10107877 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 2084 | Open in IMG/M |
| 3300031718|Ga0307474_10278981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1284 | Open in IMG/M |
| 3300031718|Ga0307474_10582325 | Not Available | 881 | Open in IMG/M |
| 3300031718|Ga0307474_10778514 | Not Available | 756 | Open in IMG/M |
| 3300031723|Ga0318493_10870875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300031754|Ga0307475_10469110 | Not Available | 1011 | Open in IMG/M |
| 3300031777|Ga0318543_10528400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 529 | Open in IMG/M |
| 3300031823|Ga0307478_10391449 | Not Available | 1150 | Open in IMG/M |
| 3300031823|Ga0307478_10798030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 790 | Open in IMG/M |
| 3300031890|Ga0306925_11750429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 597 | Open in IMG/M |
| 3300031890|Ga0306925_11997363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae | 547 | Open in IMG/M |
| 3300031910|Ga0306923_11229121 | Not Available | 799 | Open in IMG/M |
| 3300031962|Ga0307479_10021169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 6151 | Open in IMG/M |
| 3300031981|Ga0318531_10344636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. MOTT36Y | 673 | Open in IMG/M |
| 3300032013|Ga0310906_10491034 | Not Available | 829 | Open in IMG/M |
| 3300032059|Ga0318533_10156576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1615 | Open in IMG/M |
| 3300032160|Ga0311301_10424041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 2021 | Open in IMG/M |
| 3300032160|Ga0311301_10464431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1898 | Open in IMG/M |
| 3300032261|Ga0306920_100274789 | Not Available | 2512 | Open in IMG/M |
| 3300032261|Ga0306920_100646711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1562 | Open in IMG/M |
| 3300032770|Ga0335085_11308822 | Not Available | 764 | Open in IMG/M |
| 3300032954|Ga0335083_10024440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 1164966.3 | 6859 | Open in IMG/M |
| 3300032955|Ga0335076_10000470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 37141 | Open in IMG/M |
| 3300032955|Ga0335076_11750433 | Not Available | 511 | Open in IMG/M |
| 3300033134|Ga0335073_10068438 | All Organisms → cellular organisms → Bacteria | 4678 | Open in IMG/M |
| 3300033134|Ga0335073_11406368 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300033290|Ga0318519_10877050 | Not Available | 554 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 8.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.32% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.06% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.06% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.25% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.25% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.44% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.63% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_08550420 | 2189573004 | Grass Soil | MSTLQIVVVLVSLALFAVGVHDLQLWLERWDHERHFND |
| Ga0070665_1006360742 | 3300005548 | Switchgrass Rhizosphere | MSTFQTVVTVVFLALFAIGVHDLQFWLERWDHERRFHE* |
| Ga0070665_1013717542 | 3300005548 | Switchgrass Rhizosphere | MSTPQAIVIVVSLALFAVGVHDLQLWLERWDHERHFND* |
| Ga0068855_1007016132 | 3300005563 | Corn Rhizosphere | MSTLPTVVVLVSLALFAVGVHDLQLWLERWDHERHFND* |
| Ga0068857_1014865182 | 3300005577 | Corn Rhizosphere | MSTLQTVVIVVSLALFAVGVHDLQLWLERWDHERHFND* |
| Ga0068866_100032167 | 3300005718 | Miscanthus Rhizosphere | MSTIPAVVMVLSLALFAIGLHDLQLWLERWDHERHFND* |
| Ga0068866_103780132 | 3300005718 | Miscanthus Rhizosphere | MSTPQAVVIVVSLALFAVGVHDLQLWLERWDHERHFND* |
| Ga0066903_1022925722 | 3300005764 | Tropical Forest Soil | MSTFQTVVILVSLVLFAFGLFDLQSWLERWDHARHFND* |
| Ga0068863_1004062013 | 3300005841 | Switchgrass Rhizosphere | MSTLQTVVIVVSLALFAVGVHDLQLWLERWDHDRHFND* |
| Ga0068860_1011145712 | 3300005843 | Switchgrass Rhizosphere | MSTFQNVVIVVSLALFAVGVHDLQLWLERWDHERHFND* |
| Ga0081455_100645303 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTTLQTVVIVISLVLFALGVHDLQVWLERWDHERHFND* |
| Ga0079222_125120852 | 3300006755 | Agricultural Soil | MSTLQAVVIVVSLALFAVGVHDLQLWLERWDHERHFND* |
| Ga0111539_108125892 | 3300009094 | Populus Rhizosphere | MSTVQSVVIAVSLAFFGVSLHDLQLWLERWDHRRHFND* |
| Ga0105245_104446984 | 3300009098 | Miscanthus Rhizosphere | MSILPTVVIVASLALFAVGVHDLQLWLERWDYERHLND* |
| Ga0105245_112172531 | 3300009098 | Miscanthus Rhizosphere | MSAVQTVFTVVLLALFAVGVHDLQLWLERWDHERHFND* |
| Ga0105247_105585292 | 3300009101 | Switchgrass Rhizosphere | MSVLPTVVIVASLALFAVGVHDLQLWLERWNHARHFND* |
| Ga0105243_128279691 | 3300009148 | Miscanthus Rhizosphere | TMSTIPAVVMVLSLALFAIGLHDLQLWLERWDHERHFND* |
| Ga0105241_106286772 | 3300009174 | Corn Rhizosphere | LQTVVIVVSLALFAVGVHDLQLWLERWDHDRHFND* |
| Ga0116218_15025311 | 3300009522 | Peatlands Soil | MSALQNVVIVVSLALFAVGVHDLQLWLERWDHRRHFND* |
| Ga0126307_100127383 | 3300009789 | Serpentine Soil | MSTLQKVVIAVSLALFAVGVYDLQLWLERWDHGRHIND* |
| Ga0126307_117427432 | 3300009789 | Serpentine Soil | MSTVQTVVIVVSLALVAVGVHDLQLWFERWDHERHFND* |
| Ga0131853_107439373 | 3300010162 | Termite Gut | STFQTVVILVSLVLFGFGVYDLQSWLEGWDRERHFND* |
| Ga0074046_102314622 | 3300010339 | Bog Forest Soil | VSIFQSVVILMSLALFAVGVHDLQSWLERWDHRRHFND* |
| Ga0074046_104474752 | 3300010339 | Bog Forest Soil | MSTLQIVVMVVSLALLGVGVHDLQWWLERWDHERHFSD* |
| Ga0126378_120627832 | 3300010361 | Tropical Forest Soil | MSTFQTVVILVSLVLFAFGLYDPQSWLERWDHARHFND* |
| Ga0126381_1022576741 | 3300010376 | Tropical Forest Soil | MSTFQTVVILVSLVLFAFGLYDLQSWLERWDHARHFND* |
| Ga0136449_1002307714 | 3300010379 | Peatlands Soil | MSALQNVVVVVSLALFAVGVHDLQLWLERWDHRRHFND* |
| Ga0134122_111793872 | 3300010400 | Terrestrial Soil | MSILPTVVIVASLALFAVGVHDLQLWLERWDHERHFND* |
| Ga0105246_102990852 | 3300011119 | Miscanthus Rhizosphere | MTIQAIVLVVSLALFAAGVHDLQSWLERWDHERHFDD* |
| Ga0157299_102502042 | 3300012899 | Soil | MSTVQSVVIAVSLAFFGVSVHDLQLWLERWDHRRHFND* |
| Ga0157297_101275162 | 3300012914 | Soil | MSTVQSVVIAVSLAFFGVSVHDLQLWLERWDHERHFND* |
| Ga0164300_101403511 | 3300012951 | Soil | MSTFQNVVIVVSLALFAVGVHDLQLWLERWDHERRFND* |
| Ga0164300_104476962 | 3300012951 | Soil | MSTLPAVVIAVSLALFALGMHDLQSWLERWDHARHCND* |
| Ga0164298_105588771 | 3300012955 | Soil | QTVVTVVSLALFALGMHDLQSWLERWDDARHCND* |
| Ga0164299_103680352 | 3300012958 | Soil | MSTFQNVVIVVSLALFAVGVNDLQLWLGRWDHERHFND* |
| Ga0164309_106452392 | 3300012984 | Soil | MSTFQNVVIVVSLALFAAGVHDLQSWLERWDHERHFDD* |
| Ga0164309_107127021 | 3300012984 | Soil | MSTLPAVVIAVSLALFALGMHDLQSWLERWDHARHFND* |
| Ga0164306_116813612 | 3300012988 | Soil | VITIQAIVLVVSLALFAAGVHDLQSWLERWDHERHFDD* |
| Ga0157378_100386386 | 3300013297 | Miscanthus Rhizosphere | MSTIPAVVMVLSLALFAIGLHDMQLWLESWDKERHF |
| Ga0157378_110009602 | 3300013297 | Miscanthus Rhizosphere | MSTPQAVVIVVSRALFAVGVHDLQLWLERWDHERHFND* |
| Ga0163162_102679044 | 3300013306 | Switchgrass Rhizosphere | MSTIPAVVMILSLALFAIGLHDLQLWLERWDHERHFND* |
| Ga0163162_116706551 | 3300013306 | Switchgrass Rhizosphere | MSVLPTVVIVASLALFAVGVHDLQLWLERWDYERHLND* |
| Ga0157375_116512112 | 3300013308 | Miscanthus Rhizosphere | MSTLQSVVTGVLLALFAVGVHDLQLWLERWNHARHFND* |
| Ga0157376_107454272 | 3300014969 | Miscanthus Rhizosphere | MSTLQSVVTGVLLALFAVGVHDLQLWLERWDHERHFND* |
| Ga0132257_1040652152 | 3300015373 | Arabidopsis Rhizosphere | MSAVQTVVTVVLLALFAVGLYDLQLWLERWDHERHFND* |
| Ga0182033_107582702 | 3300016319 | Soil | LSTIQTVVIVVSLALFAVGVYDLQLWLERWDHERHFND |
| Ga0182033_116379062 | 3300016319 | Soil | LQTVVMLVSLALFAVDVHDLQSWLERWHHERHFND |
| Ga0182037_108538802 | 3300016404 | Soil | MSTLQAVVIVVSLALFGFGVHDLQLWLERWDHERHFND |
| Ga0182038_118133732 | 3300016445 | Soil | MSTLLAVVIAVSRALFPVGVHDLQLLLERWDYGRHFND |
| Ga0163161_120343162 | 3300017792 | Switchgrass Rhizosphere | MSTPQAIVIVVSLALFAVGVHDLQLWLERWDHERHFND |
| Ga0187779_107224312 | 3300017959 | Tropical Peatland | MPMSTFQTVVILVSLVLFAFGVYDLQSWLERWDHERHFND |
| Ga0187783_102195412 | 3300017970 | Tropical Peatland | MSIFQAVVIVVSLALFGVGLHDLQVWLERWDHGRHFND |
| Ga0187780_100168273 | 3300017973 | Tropical Peatland | MSTFQTVVILVSLVLFAFGVYDLQSWLERWDHERHFND |
| Ga0187773_110359501 | 3300018064 | Tropical Peatland | STFQTVVILVSLVLFAFGVYDLQSWLERWDHERHFND |
| Ga0187772_101699082 | 3300018085 | Tropical Peatland | MSTFQTVVILVSLALFAFGMYDLQSWLERWDHKRHFND |
| Ga0187774_110197912 | 3300018089 | Tropical Peatland | MSTLQIVVIVVSLALFGVGVHDLQLWLERWDHGRHFND |
| Ga0187774_114895832 | 3300018089 | Tropical Peatland | MSTLQTVVTVVSLALFAVGVHDLQVWLERWDHERHCND |
| Ga0187770_103331282 | 3300018090 | Tropical Peatland | MSTVQIVVTVVSLALFGFGVHDLQLWLERWDHGRHFND |
| Ga0190268_101738852 | 3300018466 | Soil | MSTLPTVVTVVFLALFAVGVHDLQLRLERWDRERRFND |
| Ga0173481_100785482 | 3300019356 | Soil | MSTVQSVVIAVSLAFFGVSVHDLQLWLERWDHRRHFND |
| Ga0210407_101203613 | 3300020579 | Soil | MSTLQTVVTVVSLALFGVGVHDLQLWLERWDHARHFND |
| Ga0210395_102041941 | 3300020582 | Soil | MSTLQTVVMLVSLALFAVGMHDLQLWLERWHHERHFND |
| Ga0210395_104442681 | 3300020582 | Soil | MSTLQNVVILLSLALSAVGVYNLQLWLERWDHERHFND |
| Ga0210400_101160892 | 3300021170 | Soil | MSTLQNVVILVSLALSAVGVYNLQLWLERWDHERHFND |
| Ga0210400_106294012 | 3300021170 | Soil | MSTLQNVVVLLSLALFAVGVHNLQLWLERWDHERHFND |
| Ga0210408_101336332 | 3300021178 | Soil | MAHEMEPTMSTLQTVVVLVSLALSAVGVHNLQLWLERWDRERHFND |
| Ga0213877_100457982 | 3300021372 | Bulk Soil | MSTLQAVVIVVSLALFAVGVHDLQLWLERWDHARHFND |
| Ga0210393_100262021 | 3300021401 | Soil | MRGPRNRPTMSTLQNVVILVPPALSAVGVHNLQLWLEHCDHERHF |
| Ga0210393_100262023 | 3300021401 | Soil | MAREMEPTMSTLQNVVILVPLALSAVGVHNLQLWLEHCDHERHFND |
| Ga0210393_105166672 | 3300021401 | Soil | MSALQNVVIVMSLALLGVGVHDVQLWLERWDRRRHFND |
| Ga0210397_103980542 | 3300021403 | Soil | MSTLQNVVVLLSLAWFAVGVHNLQLWLERWDHERHFND |
| Ga0210389_100367484 | 3300021404 | Soil | VSTFQNVVIVLSLALFAVGVHDLRLWLERWDRERHFND |
| Ga0210387_112485792 | 3300021405 | Soil | MSTLQNVVVVMSLALLGVGVHDLQWWLERWDHRRHFND |
| Ga0213878_100405522 | 3300021444 | Bulk Soil | MSTLQAVVIVVSLALFAVGVHDLQSWLERRDYERHLND |
| Ga0126371_127526152 | 3300021560 | Tropical Forest Soil | FQTVVTLVSLVLFGFGLFDLQSWLERWDHARHFND |
| Ga0242657_11002541 | 3300022722 | Soil | MSTLQNVVVLVSLALSAVGVHNLQLWLEGWDHQRHFND |
| Ga0207692_100775733 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTIPAVVMVLSLALFAIGLHDLQLWLERWDHERHFND |
| Ga0207642_101585451 | 3300025899 | Miscanthus Rhizosphere | MSTPQAVVIVVSLALFAVGVHDLQLWLERWDHERHFND |
| Ga0207642_101808462 | 3300025899 | Miscanthus Rhizosphere | MSTFQNVVIVVSLALFAVGVHDLQLWLERWDHERHFND |
| Ga0207699_100339963 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTLQTVVIVVSLALFAVGVHDLQLWLERWDHERHFND |
| Ga0207654_102547002 | 3300025911 | Corn Rhizosphere | MSTIPAVVMILSLALFAIGLHDLQLWLERWDHERHFND |
| Ga0207687_107022892 | 3300025927 | Miscanthus Rhizosphere | MSILPTVVIVASLALFAVGVHDLQLWLERWDYERHLND |
| Ga0207669_101211602 | 3300025937 | Miscanthus Rhizosphere | MSTIPAVVMVLSVALFAIGLHDLQLWLERWDRERHFND |
| Ga0207667_109780792 | 3300025949 | Corn Rhizosphere | MSTPQAVVIVVSLALFAVGVHDLQLWLERWDHERH |
| Ga0207712_102727662 | 3300025961 | Switchgrass Rhizosphere | MSAVQTVFTVVLLALFAVGVHDLQLWLERWDHERHFND |
| Ga0207677_102841052 | 3300026023 | Miscanthus Rhizosphere | MSTLPTVVTVAFLALFAVGVHDLQLWLERWDHERHFND |
| Ga0207698_116534732 | 3300026142 | Corn Rhizosphere | GPAMSTPQAVVIVVSLALFAVGVHDLQLWLERWDHERHFND |
| Ga0209447_100095033 | 3300027701 | Bog Forest Soil | MSTLQNVVILVSLALSAVGVHNLQLWLERWDHERHFND |
| Ga0209068_107297092 | 3300027894 | Watersheds | LQNVVVVMSLALLGVGVHDLQWWLERWDHRRHFND |
| Ga0209698_114308052 | 3300027911 | Watersheds | PTMSTLQNVVVVMSLALLGVGVHDLQWWLERWDHRRHFND |
| Ga0311372_101454944 | 3300030520 | Palsa | MSALQTVVTAVSLAFFGVGMHDLQAWLERRDHERHFND |
| Ga0307499_100930162 | 3300031184 | Soil | MSTLQNVVIVVLLALFAVGVYDLQLWLERWDHERHFND |
| Ga0318534_102084872 | 3300031544 | Soil | MPMSTFQSVVIAVSLALFAFGVYDLQLRLERWDHERHFND |
| Ga0318573_101826902 | 3300031564 | Soil | MSTLLAVVIAVSLALFAVGVHDLQLWLEGWDYGRHFND |
| Ga0307476_102098012 | 3300031715 | Hardwood Forest Soil | MSTLQNVVIVVSLALFAVGVHDLQLWLERWDHRRHFND |
| Ga0307476_104539473 | 3300031715 | Hardwood Forest Soil | MSTLQAVVIVVSLASFAVGVHDLQLWLERWDHERHFND |
| Ga0307474_101078771 | 3300031718 | Hardwood Forest Soil | MSILLAVVIVVSLALFGVGVHDLQLWLERWDYGRRFND |
| Ga0307474_102789812 | 3300031718 | Hardwood Forest Soil | MSTLQNVVILVSLALSAVGVHNLQLWLERWDHQRHFND |
| Ga0307474_105823251 | 3300031718 | Hardwood Forest Soil | VPRNGPAVSTFQNVVMLLSLALFAAGVYNLQLWLERWDHERHRHD |
| Ga0307474_107785142 | 3300031718 | Hardwood Forest Soil | MSTLQNVVILASLALSAVGVHNLQLWLERWDHERHFND |
| Ga0318493_108708751 | 3300031723 | Soil | TMSTLLAVVIAVSLALFAVGVHDLQLWLEGWDYGRHFND |
| Ga0307475_104691103 | 3300031754 | Hardwood Forest Soil | MSTLQNVVILASLALSAVGVHNLQLWLERWDHDRHFND |
| Ga0318543_105284002 | 3300031777 | Soil | MSTLQNVVIFVSLALFAFGVHDLQLWLERWHHERHFND |
| Ga0307478_103914492 | 3300031823 | Hardwood Forest Soil | GPIMSTLQNVVILASLALSAVGVHNLQLWLERWDHERHFND |
| Ga0307478_107980302 | 3300031823 | Hardwood Forest Soil | MSTLQAVVMVVSLALFGVGVHDLQMWLERWDHGRHCND |
| Ga0306925_117504292 | 3300031890 | Soil | MSTLQAVVIVVSLALFAVGVYDLQLWLERWDHERHFND |
| Ga0306925_119973631 | 3300031890 | Soil | MSTLQNVVIFVSLALFAVGVHDLQLWLERWDYRRHCND |
| Ga0306923_112291212 | 3300031910 | Soil | MSAFENVVMVVSLAFFAVGMHDLQLWLERRDYERHFND |
| Ga0307479_100211699 | 3300031962 | Hardwood Forest Soil | VSTLQAVVIVVSLALFALGVHDLQLWLERWDQERHFND |
| Ga0318531_103446361 | 3300031981 | Soil | LLAVVIAVSLALFAVGVHDLQLWLEGWDYGRHFND |
| Ga0310906_104910342 | 3300032013 | Soil | NGPTVSTIQAVMMVVSLALFAVGVHDLQLWLERWDHERHFND |
| Ga0318533_101565762 | 3300032059 | Soil | MSTFQSVVIAVSLALFAFGVYDLQLRLERWDHERHFND |
| Ga0311301_104240413 | 3300032160 | Peatlands Soil | MSALQNVVVVVSLALFAVGVHDLQLWLERWDHRRHFND |
| Ga0311301_104644314 | 3300032160 | Peatlands Soil | MSALQNVVIVVSLALFAVGVHDLQLWLERWDHRRHFND |
| Ga0306920_1002747892 | 3300032261 | Soil | LSTIQTVVIVVSLALFGFGVHDLQLWLERWDHERHFND |
| Ga0306920_1006467114 | 3300032261 | Soil | MSTLQNVVIFVSLALFAFGVHDLQLWLERWDYRRHCND |
| Ga0335085_113088221 | 3300032770 | Soil | MSILQNVVMVVSLALFAVGLHDLQLWLERWDHRRHFND |
| Ga0335083_100244407 | 3300032954 | Soil | VSIFQSVVILVTLALSAVGVHNLQLGLESWDHERHFND |
| Ga0335076_1000047029 | 3300032955 | Soil | MSTLLAVVIAVSLALFAVGMHDLQLWLERWDCGRHFND |
| Ga0335076_117504332 | 3300032955 | Soil | STLQAVVIVLSLALFGVGVHDLQLWLERWDHGRHFND |
| Ga0335073_100684382 | 3300033134 | Soil | MSTFQIVIAVVSLAVFSFGVYDLQAWLERWDHERHFND |
| Ga0335073_114063682 | 3300033134 | Soil | MSTFQTVVILVSLALFAFGMYDLQSWLERWDHERHFN |
| Ga0318519_108770501 | 3300033290 | Soil | MSTLQTVVTLVSLALFAVGMHDLQSGLERWDYERHLND |
| ⦗Top⦘ |