NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069960

Metagenome / Metatranscriptome Family F069960

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069960
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 38 residues
Representative Sequence MSTLQTVVIVVSLALFAVGVHDLQLWLERWDHERHFND
Number of Associated Samples 97
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 72.36 %
% of genes near scaffold ends (potentially truncated) 20.33 %
% of genes from short scaffolds (< 2000 bps) 82.93 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.789 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(16.260 % of family members)
Environment Ontology (ENVO) Unclassified
(30.081 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.528 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 53.03%    β-sheet: 0.00%    Coil/Unstructured: 46.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF00561Abhydrolase_1 37.70
PF12697Abhydrolase_6 9.02
PF12146Hydrolase_4 8.20
PF03600CitMHS 2.46
PF00550PP-binding 1.64
PF00109ketoacyl-synt 1.64
PF16197KAsynt_C_assoc 1.64
PF04542Sigma70_r2 1.64
PF01738DLH 1.64
PF13822ACC_epsilon 0.82
PF01039Carboxyl_trans 0.82
PF00872Transposase_mut 0.82
PF01494FAD_binding_3 0.82
PF00441Acyl-CoA_dh_1 0.82
PF07690MFS_1 0.82
PF00072Response_reg 0.82
PF13191AAA_16 0.82
PF02652Lactate_perm 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.64
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.64
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.64
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.64
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.64
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.82
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.82
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.82
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.82
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.82
COG1620L-lactate permeaseEnergy production and conversion [C] 0.82
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.82
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.82
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.79 %
UnclassifiedrootN/A38.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573004|GZGWRS401DBQ8JAll Organisms → cellular organisms → Bacteria502Open in IMG/M
3300005548|Ga0070665_100636074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1080Open in IMG/M
3300005548|Ga0070665_101371754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales716Open in IMG/M
3300005563|Ga0068855_100701613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1083Open in IMG/M
3300005577|Ga0068857_101486518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales660Open in IMG/M
3300005718|Ga0068866_10003216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium6737Open in IMG/M
3300005718|Ga0068866_10378013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales908Open in IMG/M
3300005764|Ga0066903_102292572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1043Open in IMG/M
3300005841|Ga0068863_100406201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1333Open in IMG/M
3300005843|Ga0068860_101114571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales809Open in IMG/M
3300005937|Ga0081455_10064530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales3066Open in IMG/M
3300006755|Ga0079222_12512085Not Available517Open in IMG/M
3300009094|Ga0111539_10812589Not Available1088Open in IMG/M
3300009098|Ga0105245_10444698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae1303Open in IMG/M
3300009098|Ga0105245_11217253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales801Open in IMG/M
3300009101|Ga0105247_10558529Not Available843Open in IMG/M
3300009148|Ga0105243_12827969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales526Open in IMG/M
3300009174|Ga0105241_10628677All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300009522|Ga0116218_1502531All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300009789|Ga0126307_10012738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6174Open in IMG/M
3300009789|Ga0126307_11742743Not Available506Open in IMG/M
3300010162|Ga0131853_10743937Not Available802Open in IMG/M
3300010339|Ga0074046_10231462Not Available1152Open in IMG/M
3300010339|Ga0074046_10447475Not Available776Open in IMG/M
3300010361|Ga0126378_12062783All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300010376|Ga0126381_102257674Not Available782Open in IMG/M
3300010379|Ga0136449_100230771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae3467Open in IMG/M
3300010400|Ga0134122_11179387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales765Open in IMG/M
3300011119|Ga0105246_10299085Not Available1298Open in IMG/M
3300012899|Ga0157299_10250204All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300012914|Ga0157297_10127516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae801Open in IMG/M
3300012951|Ga0164300_10140351Not Available1119Open in IMG/M
3300012951|Ga0164300_10447696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria724Open in IMG/M
3300012955|Ga0164298_10558877Not Available777Open in IMG/M
3300012958|Ga0164299_10368035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae911Open in IMG/M
3300012984|Ga0164309_10645239Not Available833Open in IMG/M
3300012984|Ga0164309_10712702Not Available798Open in IMG/M
3300012988|Ga0164306_11681361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae550Open in IMG/M
3300013297|Ga0157378_10038638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium4231Open in IMG/M
3300013297|Ga0157378_11000960Not Available870Open in IMG/M
3300013306|Ga0163162_10267904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia1840Open in IMG/M
3300013306|Ga0163162_11670655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae727Open in IMG/M
3300013308|Ga0157375_11651211Not Available758Open in IMG/M
3300014969|Ga0157376_10745427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales988Open in IMG/M
3300015373|Ga0132257_104065215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria532Open in IMG/M
3300016319|Ga0182033_10758270Not Available853Open in IMG/M
3300016319|Ga0182033_11637906Not Available582Open in IMG/M
3300016404|Ga0182037_10853880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae787Open in IMG/M
3300016445|Ga0182038_11813373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. MOTT36Y551Open in IMG/M
3300017792|Ga0163161_12034316Not Available511Open in IMG/M
3300017959|Ga0187779_10722431Not Available675Open in IMG/M
3300017970|Ga0187783_10219541All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1394Open in IMG/M
3300017973|Ga0187780_10016827All Organisms → cellular organisms → Bacteria5293Open in IMG/M
3300018064|Ga0187773_11035950All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae540Open in IMG/M
3300018085|Ga0187772_10169908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1452Open in IMG/M
3300018089|Ga0187774_11019791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae579Open in IMG/M
3300018089|Ga0187774_11489583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae500Open in IMG/M
3300018090|Ga0187770_10333128All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300018466|Ga0190268_10173885Not Available1137Open in IMG/M
3300019356|Ga0173481_10078548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1214Open in IMG/M
3300020579|Ga0210407_10120361All Organisms → cellular organisms → Bacteria2008Open in IMG/M
3300020582|Ga0210395_10204194Not Available1482Open in IMG/M
3300020582|Ga0210395_10444268Not Available976Open in IMG/M
3300021170|Ga0210400_10116089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2132Open in IMG/M
3300021170|Ga0210400_10629401All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300021178|Ga0210408_10133633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1960Open in IMG/M
3300021372|Ga0213877_10045798Not Available1251Open in IMG/M
3300021401|Ga0210393_10026202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales4547Open in IMG/M
3300021401|Ga0210393_10026202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales4547Open in IMG/M
3300021401|Ga0210393_10516667All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium975Open in IMG/M
3300021403|Ga0210397_10398054All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1029Open in IMG/M
3300021404|Ga0210389_10036748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales3761Open in IMG/M
3300021405|Ga0210387_11248579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae644Open in IMG/M
3300021444|Ga0213878_10040552Not Available1793Open in IMG/M
3300021560|Ga0126371_12752615Not Available596Open in IMG/M
3300022722|Ga0242657_1100254Not Available712Open in IMG/M
3300025898|Ga0207692_10077573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1768Open in IMG/M
3300025899|Ga0207642_10158545Not Available1212Open in IMG/M
3300025899|Ga0207642_10180846All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1149Open in IMG/M
3300025906|Ga0207699_10033996All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales2887Open in IMG/M
3300025911|Ga0207654_10254700Not Available1178Open in IMG/M
3300025927|Ga0207687_10702289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae858Open in IMG/M
3300025937|Ga0207669_10121160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1776Open in IMG/M
3300025949|Ga0207667_10978079Not Available835Open in IMG/M
3300025961|Ga0207712_10272766Not Available1377Open in IMG/M
3300026023|Ga0207677_10284105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1360Open in IMG/M
3300026142|Ga0207698_11653473Not Available656Open in IMG/M
3300027701|Ga0209447_10009503Not Available2823Open in IMG/M
3300027894|Ga0209068_10729709Not Available581Open in IMG/M
3300027911|Ga0209698_11430805Not Available503Open in IMG/M
3300030520|Ga0311372_10145494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae4124Open in IMG/M
3300031184|Ga0307499_10093016Not Available814Open in IMG/M
3300031544|Ga0318534_10208487Not Available1128Open in IMG/M
3300031564|Ga0318573_10182690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium1108Open in IMG/M
3300031715|Ga0307476_10209801Not Available1416Open in IMG/M
3300031715|Ga0307476_10453947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae949Open in IMG/M
3300031718|Ga0307474_10107877All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium2084Open in IMG/M
3300031718|Ga0307474_10278981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1284Open in IMG/M
3300031718|Ga0307474_10582325Not Available881Open in IMG/M
3300031718|Ga0307474_10778514Not Available756Open in IMG/M
3300031723|Ga0318493_10870875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300031754|Ga0307475_10469110Not Available1011Open in IMG/M
3300031777|Ga0318543_10528400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium529Open in IMG/M
3300031823|Ga0307478_10391449Not Available1150Open in IMG/M
3300031823|Ga0307478_10798030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium790Open in IMG/M
3300031890|Ga0306925_11750429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales597Open in IMG/M
3300031890|Ga0306925_11997363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium simiae complex → Mycobacterium simiae547Open in IMG/M
3300031910|Ga0306923_11229121Not Available799Open in IMG/M
3300031962|Ga0307479_10021169All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales6151Open in IMG/M
3300031981|Ga0318531_10344636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. MOTT36Y673Open in IMG/M
3300032013|Ga0310906_10491034Not Available829Open in IMG/M
3300032059|Ga0318533_10156576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1615Open in IMG/M
3300032160|Ga0311301_10424041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae2021Open in IMG/M
3300032160|Ga0311301_10464431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1898Open in IMG/M
3300032261|Ga0306920_100274789Not Available2512Open in IMG/M
3300032261|Ga0306920_100646711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1562Open in IMG/M
3300032770|Ga0335085_11308822Not Available764Open in IMG/M
3300032954|Ga0335083_10024440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. 1164966.36859Open in IMG/M
3300032955|Ga0335076_10000470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium37141Open in IMG/M
3300032955|Ga0335076_11750433Not Available511Open in IMG/M
3300033134|Ga0335073_10068438All Organisms → cellular organisms → Bacteria4678Open in IMG/M
3300033134|Ga0335073_11406368All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300033290|Ga0318519_10877050Not Available554Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil16.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.76%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil8.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.32%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland6.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.88%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.06%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.06%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.25%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.25%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.44%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.44%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.63%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.63%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil1.63%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.63%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.63%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.81%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010162Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)Host-AssociatedOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FG2_085504202189573004Grass SoilMSTLQIVVVLVSLALFAVGVHDLQLWLERWDHERHFND
Ga0070665_10063607423300005548Switchgrass RhizosphereMSTFQTVVTVVFLALFAIGVHDLQFWLERWDHERRFHE*
Ga0070665_10137175423300005548Switchgrass RhizosphereMSTPQAIVIVVSLALFAVGVHDLQLWLERWDHERHFND*
Ga0068855_10070161323300005563Corn RhizosphereMSTLPTVVVLVSLALFAVGVHDLQLWLERWDHERHFND*
Ga0068857_10148651823300005577Corn RhizosphereMSTLQTVVIVVSLALFAVGVHDLQLWLERWDHERHFND*
Ga0068866_1000321673300005718Miscanthus RhizosphereMSTIPAVVMVLSLALFAIGLHDLQLWLERWDHERHFND*
Ga0068866_1037801323300005718Miscanthus RhizosphereMSTPQAVVIVVSLALFAVGVHDLQLWLERWDHERHFND*
Ga0066903_10229257223300005764Tropical Forest SoilMSTFQTVVILVSLVLFAFGLFDLQSWLERWDHARHFND*
Ga0068863_10040620133300005841Switchgrass RhizosphereMSTLQTVVIVVSLALFAVGVHDLQLWLERWDHDRHFND*
Ga0068860_10111457123300005843Switchgrass RhizosphereMSTFQNVVIVVSLALFAVGVHDLQLWLERWDHERHFND*
Ga0081455_1006453033300005937Tabebuia Heterophylla RhizosphereMTTLQTVVIVISLVLFALGVHDLQVWLERWDHERHFND*
Ga0079222_1251208523300006755Agricultural SoilMSTLQAVVIVVSLALFAVGVHDLQLWLERWDHERHFND*
Ga0111539_1081258923300009094Populus RhizosphereMSTVQSVVIAVSLAFFGVSLHDLQLWLERWDHRRHFND*
Ga0105245_1044469843300009098Miscanthus RhizosphereMSILPTVVIVASLALFAVGVHDLQLWLERWDYERHLND*
Ga0105245_1121725313300009098Miscanthus RhizosphereMSAVQTVFTVVLLALFAVGVHDLQLWLERWDHERHFND*
Ga0105247_1055852923300009101Switchgrass RhizosphereMSVLPTVVIVASLALFAVGVHDLQLWLERWNHARHFND*
Ga0105243_1282796913300009148Miscanthus RhizosphereTMSTIPAVVMVLSLALFAIGLHDLQLWLERWDHERHFND*
Ga0105241_1062867723300009174Corn RhizosphereLQTVVIVVSLALFAVGVHDLQLWLERWDHDRHFND*
Ga0116218_150253113300009522Peatlands SoilMSALQNVVIVVSLALFAVGVHDLQLWLERWDHRRHFND*
Ga0126307_1001273833300009789Serpentine SoilMSTLQKVVIAVSLALFAVGVYDLQLWLERWDHGRHIND*
Ga0126307_1174274323300009789Serpentine SoilMSTVQTVVIVVSLALVAVGVHDLQLWFERWDHERHFND*
Ga0131853_1074393733300010162Termite GutSTFQTVVILVSLVLFGFGVYDLQSWLEGWDRERHFND*
Ga0074046_1023146223300010339Bog Forest SoilVSIFQSVVILMSLALFAVGVHDLQSWLERWDHRRHFND*
Ga0074046_1044747523300010339Bog Forest SoilMSTLQIVVMVVSLALLGVGVHDLQWWLERWDHERHFSD*
Ga0126378_1206278323300010361Tropical Forest SoilMSTFQTVVILVSLVLFAFGLYDPQSWLERWDHARHFND*
Ga0126381_10225767413300010376Tropical Forest SoilMSTFQTVVILVSLVLFAFGLYDLQSWLERWDHARHFND*
Ga0136449_10023077143300010379Peatlands SoilMSALQNVVVVVSLALFAVGVHDLQLWLERWDHRRHFND*
Ga0134122_1117938723300010400Terrestrial SoilMSILPTVVIVASLALFAVGVHDLQLWLERWDHERHFND*
Ga0105246_1029908523300011119Miscanthus RhizosphereMTIQAIVLVVSLALFAAGVHDLQSWLERWDHERHFDD*
Ga0157299_1025020423300012899SoilMSTVQSVVIAVSLAFFGVSVHDLQLWLERWDHRRHFND*
Ga0157297_1012751623300012914SoilMSTVQSVVIAVSLAFFGVSVHDLQLWLERWDHERHFND*
Ga0164300_1014035113300012951SoilMSTFQNVVIVVSLALFAVGVHDLQLWLERWDHERRFND*
Ga0164300_1044769623300012951SoilMSTLPAVVIAVSLALFALGMHDLQSWLERWDHARHCND*
Ga0164298_1055887713300012955SoilQTVVTVVSLALFALGMHDLQSWLERWDDARHCND*
Ga0164299_1036803523300012958SoilMSTFQNVVIVVSLALFAVGVNDLQLWLGRWDHERHFND*
Ga0164309_1064523923300012984SoilMSTFQNVVIVVSLALFAAGVHDLQSWLERWDHERHFDD*
Ga0164309_1071270213300012984SoilMSTLPAVVIAVSLALFALGMHDLQSWLERWDHARHFND*
Ga0164306_1168136123300012988SoilVITIQAIVLVVSLALFAAGVHDLQSWLERWDHERHFDD*
Ga0157378_1003863863300013297Miscanthus RhizosphereMSTIPAVVMVLSLALFAIGLHDMQLWLESWDKERHF
Ga0157378_1100096023300013297Miscanthus RhizosphereMSTPQAVVIVVSRALFAVGVHDLQLWLERWDHERHFND*
Ga0163162_1026790443300013306Switchgrass RhizosphereMSTIPAVVMILSLALFAIGLHDLQLWLERWDHERHFND*
Ga0163162_1167065513300013306Switchgrass RhizosphereMSVLPTVVIVASLALFAVGVHDLQLWLERWDYERHLND*
Ga0157375_1165121123300013308Miscanthus RhizosphereMSTLQSVVTGVLLALFAVGVHDLQLWLERWNHARHFND*
Ga0157376_1074542723300014969Miscanthus RhizosphereMSTLQSVVTGVLLALFAVGVHDLQLWLERWDHERHFND*
Ga0132257_10406521523300015373Arabidopsis RhizosphereMSAVQTVVTVVLLALFAVGLYDLQLWLERWDHERHFND*
Ga0182033_1075827023300016319SoilLSTIQTVVIVVSLALFAVGVYDLQLWLERWDHERHFND
Ga0182033_1163790623300016319SoilLQTVVMLVSLALFAVDVHDLQSWLERWHHERHFND
Ga0182037_1085388023300016404SoilMSTLQAVVIVVSLALFGFGVHDLQLWLERWDHERHFND
Ga0182038_1181337323300016445SoilMSTLLAVVIAVSRALFPVGVHDLQLLLERWDYGRHFND
Ga0163161_1203431623300017792Switchgrass RhizosphereMSTPQAIVIVVSLALFAVGVHDLQLWLERWDHERHFND
Ga0187779_1072243123300017959Tropical PeatlandMPMSTFQTVVILVSLVLFAFGVYDLQSWLERWDHERHFND
Ga0187783_1021954123300017970Tropical PeatlandMSIFQAVVIVVSLALFGVGLHDLQVWLERWDHGRHFND
Ga0187780_1001682733300017973Tropical PeatlandMSTFQTVVILVSLVLFAFGVYDLQSWLERWDHERHFND
Ga0187773_1103595013300018064Tropical PeatlandSTFQTVVILVSLVLFAFGVYDLQSWLERWDHERHFND
Ga0187772_1016990823300018085Tropical PeatlandMSTFQTVVILVSLALFAFGMYDLQSWLERWDHKRHFND
Ga0187774_1101979123300018089Tropical PeatlandMSTLQIVVIVVSLALFGVGVHDLQLWLERWDHGRHFND
Ga0187774_1148958323300018089Tropical PeatlandMSTLQTVVTVVSLALFAVGVHDLQVWLERWDHERHCND
Ga0187770_1033312823300018090Tropical PeatlandMSTVQIVVTVVSLALFGFGVHDLQLWLERWDHGRHFND
Ga0190268_1017388523300018466SoilMSTLPTVVTVVFLALFAVGVHDLQLRLERWDRERRFND
Ga0173481_1007854823300019356SoilMSTVQSVVIAVSLAFFGVSVHDLQLWLERWDHRRHFND
Ga0210407_1012036133300020579SoilMSTLQTVVTVVSLALFGVGVHDLQLWLERWDHARHFND
Ga0210395_1020419413300020582SoilMSTLQTVVMLVSLALFAVGMHDLQLWLERWHHERHFND
Ga0210395_1044426813300020582SoilMSTLQNVVILLSLALSAVGVYNLQLWLERWDHERHFND
Ga0210400_1011608923300021170SoilMSTLQNVVILVSLALSAVGVYNLQLWLERWDHERHFND
Ga0210400_1062940123300021170SoilMSTLQNVVVLLSLALFAVGVHNLQLWLERWDHERHFND
Ga0210408_1013363323300021178SoilMAHEMEPTMSTLQTVVVLVSLALSAVGVHNLQLWLERWDRERHFND
Ga0213877_1004579823300021372Bulk SoilMSTLQAVVIVVSLALFAVGVHDLQLWLERWDHARHFND
Ga0210393_1002620213300021401SoilMRGPRNRPTMSTLQNVVILVPPALSAVGVHNLQLWLEHCDHERHF
Ga0210393_1002620233300021401SoilMAREMEPTMSTLQNVVILVPLALSAVGVHNLQLWLEHCDHERHFND
Ga0210393_1051666723300021401SoilMSALQNVVIVMSLALLGVGVHDVQLWLERWDRRRHFND
Ga0210397_1039805423300021403SoilMSTLQNVVVLLSLAWFAVGVHNLQLWLERWDHERHFND
Ga0210389_1003674843300021404SoilVSTFQNVVIVLSLALFAVGVHDLRLWLERWDRERHFND
Ga0210387_1124857923300021405SoilMSTLQNVVVVMSLALLGVGVHDLQWWLERWDHRRHFND
Ga0213878_1004055223300021444Bulk SoilMSTLQAVVIVVSLALFAVGVHDLQSWLERRDYERHLND
Ga0126371_1275261523300021560Tropical Forest SoilFQTVVTLVSLVLFGFGLFDLQSWLERWDHARHFND
Ga0242657_110025413300022722SoilMSTLQNVVVLVSLALSAVGVHNLQLWLEGWDHQRHFND
Ga0207692_1007757333300025898Corn, Switchgrass And Miscanthus RhizosphereMSTIPAVVMVLSLALFAIGLHDLQLWLERWDHERHFND
Ga0207642_1015854513300025899Miscanthus RhizosphereMSTPQAVVIVVSLALFAVGVHDLQLWLERWDHERHFND
Ga0207642_1018084623300025899Miscanthus RhizosphereMSTFQNVVIVVSLALFAVGVHDLQLWLERWDHERHFND
Ga0207699_1003399633300025906Corn, Switchgrass And Miscanthus RhizosphereMSTLQTVVIVVSLALFAVGVHDLQLWLERWDHERHFND
Ga0207654_1025470023300025911Corn RhizosphereMSTIPAVVMILSLALFAIGLHDLQLWLERWDHERHFND
Ga0207687_1070228923300025927Miscanthus RhizosphereMSILPTVVIVASLALFAVGVHDLQLWLERWDYERHLND
Ga0207669_1012116023300025937Miscanthus RhizosphereMSTIPAVVMVLSVALFAIGLHDLQLWLERWDRERHFND
Ga0207667_1097807923300025949Corn RhizosphereMSTPQAVVIVVSLALFAVGVHDLQLWLERWDHERH
Ga0207712_1027276623300025961Switchgrass RhizosphereMSAVQTVFTVVLLALFAVGVHDLQLWLERWDHERHFND
Ga0207677_1028410523300026023Miscanthus RhizosphereMSTLPTVVTVAFLALFAVGVHDLQLWLERWDHERHFND
Ga0207698_1165347323300026142Corn RhizosphereGPAMSTPQAVVIVVSLALFAVGVHDLQLWLERWDHERHFND
Ga0209447_1000950333300027701Bog Forest SoilMSTLQNVVILVSLALSAVGVHNLQLWLERWDHERHFND
Ga0209068_1072970923300027894WatershedsLQNVVVVMSLALLGVGVHDLQWWLERWDHRRHFND
Ga0209698_1143080523300027911WatershedsPTMSTLQNVVVVMSLALLGVGVHDLQWWLERWDHRRHFND
Ga0311372_1014549443300030520PalsaMSALQTVVTAVSLAFFGVGMHDLQAWLERRDHERHFND
Ga0307499_1009301623300031184SoilMSTLQNVVIVVLLALFAVGVYDLQLWLERWDHERHFND
Ga0318534_1020848723300031544SoilMPMSTFQSVVIAVSLALFAFGVYDLQLRLERWDHERHFND
Ga0318573_1018269023300031564SoilMSTLLAVVIAVSLALFAVGVHDLQLWLEGWDYGRHFND
Ga0307476_1020980123300031715Hardwood Forest SoilMSTLQNVVIVVSLALFAVGVHDLQLWLERWDHRRHFND
Ga0307476_1045394733300031715Hardwood Forest SoilMSTLQAVVIVVSLASFAVGVHDLQLWLERWDHERHFND
Ga0307474_1010787713300031718Hardwood Forest SoilMSILLAVVIVVSLALFGVGVHDLQLWLERWDYGRRFND
Ga0307474_1027898123300031718Hardwood Forest SoilMSTLQNVVILVSLALSAVGVHNLQLWLERWDHQRHFND
Ga0307474_1058232513300031718Hardwood Forest SoilVPRNGPAVSTFQNVVMLLSLALFAAGVYNLQLWLERWDHERHRHD
Ga0307474_1077851423300031718Hardwood Forest SoilMSTLQNVVILASLALSAVGVHNLQLWLERWDHERHFND
Ga0318493_1087087513300031723SoilTMSTLLAVVIAVSLALFAVGVHDLQLWLEGWDYGRHFND
Ga0307475_1046911033300031754Hardwood Forest SoilMSTLQNVVILASLALSAVGVHNLQLWLERWDHDRHFND
Ga0318543_1052840023300031777SoilMSTLQNVVIFVSLALFAFGVHDLQLWLERWHHERHFND
Ga0307478_1039144923300031823Hardwood Forest SoilGPIMSTLQNVVILASLALSAVGVHNLQLWLERWDHERHFND
Ga0307478_1079803023300031823Hardwood Forest SoilMSTLQAVVMVVSLALFGVGVHDLQMWLERWDHGRHCND
Ga0306925_1175042923300031890SoilMSTLQAVVIVVSLALFAVGVYDLQLWLERWDHERHFND
Ga0306925_1199736313300031890SoilMSTLQNVVIFVSLALFAVGVHDLQLWLERWDYRRHCND
Ga0306923_1122912123300031910SoilMSAFENVVMVVSLAFFAVGMHDLQLWLERRDYERHFND
Ga0307479_1002116993300031962Hardwood Forest SoilVSTLQAVVIVVSLALFALGVHDLQLWLERWDQERHFND
Ga0318531_1034463613300031981SoilLLAVVIAVSLALFAVGVHDLQLWLEGWDYGRHFND
Ga0310906_1049103423300032013SoilNGPTVSTIQAVMMVVSLALFAVGVHDLQLWLERWDHERHFND
Ga0318533_1015657623300032059SoilMSTFQSVVIAVSLALFAFGVYDLQLRLERWDHERHFND
Ga0311301_1042404133300032160Peatlands SoilMSALQNVVVVVSLALFAVGVHDLQLWLERWDHRRHFND
Ga0311301_1046443143300032160Peatlands SoilMSALQNVVIVVSLALFAVGVHDLQLWLERWDHRRHFND
Ga0306920_10027478923300032261SoilLSTIQTVVIVVSLALFGFGVHDLQLWLERWDHERHFND
Ga0306920_10064671143300032261SoilMSTLQNVVIFVSLALFAFGVHDLQLWLERWDYRRHCND
Ga0335085_1130882213300032770SoilMSILQNVVMVVSLALFAVGLHDLQLWLERWDHRRHFND
Ga0335083_1002444073300032954SoilVSIFQSVVILVTLALSAVGVHNLQLGLESWDHERHFND
Ga0335076_10000470293300032955SoilMSTLLAVVIAVSLALFAVGMHDLQLWLERWDCGRHFND
Ga0335076_1175043323300032955SoilSTLQAVVIVLSLALFGVGVHDLQLWLERWDHGRHFND
Ga0335073_1006843823300033134SoilMSTFQIVIAVVSLAVFSFGVYDLQAWLERWDHERHFND
Ga0335073_1140636823300033134SoilMSTFQTVVILVSLALFAFGMYDLQSWLERWDHERHFN
Ga0318519_1087705013300033290SoilMSTLQTVVTLVSLALFAVGMHDLQSGLERWDYERHLND


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.