| Basic Information | |
|---|---|
| Family ID | F069955 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MKSLIVALLLAMQVQGVAPNISGFSIQGTTVNLNSFKGKKNVLVVFYRTQA |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 59.35 % |
| % of genes near scaffold ends (potentially truncated) | 24.39 % |
| % of genes from short scaffolds (< 2000 bps) | 78.86 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (27.642 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.715 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.350 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 18.99% β-sheet: 10.13% Coil/Unstructured: 70.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 41.46 |
| PF00111 | Fer2 | 10.57 |
| PF00849 | PseudoU_synth_2 | 8.94 |
| PF01479 | S4 | 7.32 |
| PF02578 | Cu-oxidase_4 | 7.32 |
| PF01135 | PCMT | 6.50 |
| PF05199 | GMC_oxred_C | 4.88 |
| PF02843 | GARS_C | 0.81 |
| PF13618 | Gluconate_2-dh3 | 0.81 |
| PF04892 | VanZ | 0.81 |
| PF02954 | HTH_8 | 0.81 |
| PF08534 | Redoxin | 0.81 |
| PF00669 | Flagellin_N | 0.81 |
| PF00512 | HisKA | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 8.94 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 8.94 |
| COG1496 | Copper oxidase (laccase) domain | Inorganic ion transport and metabolism [P] | 7.32 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 6.50 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 6.50 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 6.50 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 6.50 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 4.88 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.81 |
| COG1344 | Flagellin and related hook-associated protein FlgL | Cell motility [N] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12308061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300000956|JGI10216J12902_114397020 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300002558|JGI25385J37094_10001186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8115 | Open in IMG/M |
| 3300003324|soilH2_10165709 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300004281|Ga0066397_10073486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300004463|Ga0063356_104740771 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300004633|Ga0066395_10113103 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300005167|Ga0066672_10761567 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005172|Ga0066683_10001832 | All Organisms → cellular organisms → Bacteria | 8870 | Open in IMG/M |
| 3300005172|Ga0066683_10449760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300005180|Ga0066685_10271671 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300005186|Ga0066676_10389355 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005187|Ga0066675_10333565 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300005332|Ga0066388_100134551 | All Organisms → cellular organisms → Bacteria | 3024 | Open in IMG/M |
| 3300005332|Ga0066388_100205438 | All Organisms → cellular organisms → Bacteria | 2593 | Open in IMG/M |
| 3300005332|Ga0066388_100212803 | All Organisms → cellular organisms → Bacteria | 2559 | Open in IMG/M |
| 3300005446|Ga0066686_10069078 | All Organisms → cellular organisms → Bacteria | 2208 | Open in IMG/M |
| 3300005447|Ga0066689_10313676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
| 3300005450|Ga0066682_10481722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300005468|Ga0070707_100001590 | All Organisms → cellular organisms → Bacteria | 21987 | Open in IMG/M |
| 3300005468|Ga0070707_100072374 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300005468|Ga0070707_100893518 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300005471|Ga0070698_101262848 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300005536|Ga0070697_100257580 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
| 3300005554|Ga0066661_10412690 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005557|Ga0066704_10391735 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300005558|Ga0066698_10382330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| 3300005558|Ga0066698_10995443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 533 | Open in IMG/M |
| 3300005559|Ga0066700_10215048 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300005561|Ga0066699_10451590 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005568|Ga0066703_10377275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 851 | Open in IMG/M |
| 3300005569|Ga0066705_10015058 | All Organisms → cellular organisms → Bacteria | 3829 | Open in IMG/M |
| 3300005574|Ga0066694_10366489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 681 | Open in IMG/M |
| 3300005577|Ga0068857_101892749 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300005586|Ga0066691_10618542 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005587|Ga0066654_10085119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1492 | Open in IMG/M |
| 3300005598|Ga0066706_10353117 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300005764|Ga0066903_100250430 | All Organisms → cellular organisms → Bacteria | 2732 | Open in IMG/M |
| 3300005764|Ga0066903_103063716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
| 3300005937|Ga0081455_10414244 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300006031|Ga0066651_10817231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300006791|Ga0066653_10006113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3940 | Open in IMG/M |
| 3300006796|Ga0066665_10266625 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300006796|Ga0066665_10653095 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300006844|Ga0075428_102283631 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300006852|Ga0075433_10418031 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300006852|Ga0075433_11693807 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300006854|Ga0075425_100527883 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300006871|Ga0075434_100251869 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300006904|Ga0075424_100574552 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300007004|Ga0079218_12975562 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009012|Ga0066710_100809022 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300009012|Ga0066710_100924105 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300009012|Ga0066710_100973692 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300009137|Ga0066709_100634200 | All Organisms → cellular organisms → Bacteria | 1527 | Open in IMG/M |
| 3300009137|Ga0066709_101261007 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300009147|Ga0114129_10245203 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
| 3300009444|Ga0114945_10252187 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300009609|Ga0105347_1009547 | All Organisms → cellular organisms → Bacteria | 3356 | Open in IMG/M |
| 3300009811|Ga0105084_1090861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300010046|Ga0126384_10029650 | All Organisms → cellular organisms → Bacteria | 3624 | Open in IMG/M |
| 3300010114|Ga0127460_1118615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
| 3300010134|Ga0127484_1152118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300010141|Ga0127499_1006403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300010142|Ga0127483_1098472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300010304|Ga0134088_10000916 | All Organisms → cellular organisms → Bacteria | 10968 | Open in IMG/M |
| 3300010322|Ga0134084_10017780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1875 | Open in IMG/M |
| 3300010366|Ga0126379_11241824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300010397|Ga0134124_10084526 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
| 3300010398|Ga0126383_13226317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300011416|Ga0137422_1004388 | All Organisms → cellular organisms → Bacteria | 3141 | Open in IMG/M |
| 3300011420|Ga0137314_1015645 | All Organisms → cellular organisms → Bacteria | 1927 | Open in IMG/M |
| 3300012039|Ga0137421_1018308 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300012198|Ga0137364_10392018 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300012199|Ga0137383_10020029 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4616 | Open in IMG/M |
| 3300012205|Ga0137362_11209515 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012207|Ga0137381_10007101 | All Organisms → cellular organisms → Bacteria | 8355 | Open in IMG/M |
| 3300012207|Ga0137381_10048861 | All Organisms → cellular organisms → Bacteria | 3487 | Open in IMG/M |
| 3300012285|Ga0137370_10602819 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300012349|Ga0137387_10078197 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
| 3300012356|Ga0137371_10295325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
| 3300012922|Ga0137394_11117613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300012948|Ga0126375_11044792 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300014154|Ga0134075_10503425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300014878|Ga0180065_1134852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300015359|Ga0134085_10530902 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300015371|Ga0132258_10015101 | All Organisms → cellular organisms → Bacteria | 16489 | Open in IMG/M |
| 3300015371|Ga0132258_13406601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1092 | Open in IMG/M |
| 3300015372|Ga0132256_102182663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300017656|Ga0134112_10257966 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300017657|Ga0134074_1052455 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300017659|Ga0134083_10279826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
| 3300018082|Ga0184639_10650596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300018431|Ga0066655_10055697 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300018431|Ga0066655_10143437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300018431|Ga0066655_10227905 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300018433|Ga0066667_10009930 | All Organisms → cellular organisms → Bacteria | 4517 | Open in IMG/M |
| 3300018482|Ga0066669_10251867 | All Organisms → cellular organisms → Bacteria | 1397 | Open in IMG/M |
| 3300019233|Ga0184645_1042385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300022195|Ga0222625_1013922 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300022563|Ga0212128_10926937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300025159|Ga0209619_10570876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300025314|Ga0209323_10501289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 708 | Open in IMG/M |
| 3300025322|Ga0209641_11070353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300025324|Ga0209640_10751661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300025922|Ga0207646_10145710 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
| 3300025922|Ga0207646_11858442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300026277|Ga0209350_1047853 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300026306|Ga0209468_1058441 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300026324|Ga0209470_1000465 | All Organisms → cellular organisms → Bacteria | 32289 | Open in IMG/M |
| 3300026324|Ga0209470_1381071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300026331|Ga0209267_1097210 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300026536|Ga0209058_1105536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1416 | Open in IMG/M |
| 3300026547|Ga0209156_10201698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300027324|Ga0209845_1044627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
| 3300027748|Ga0209689_1116872 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300027909|Ga0209382_10286067 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300027909|Ga0209382_11186540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300031740|Ga0307468_100217200 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300031910|Ga0306923_11870234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300031954|Ga0306926_11145379 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300032421|Ga0310812_10059430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1494 | Open in IMG/M |
| 3300033433|Ga0326726_10552826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.32% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.63% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.63% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010114 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010141 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022563 | OV2_combined assembly | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_123080612 | 3300000789 | Soil | MKSLVFALLLAFQVQGVAPNITGFSVQGETVNLNSXKGKXPVLVVFYRTQA* |
| JGI10216J12902_1143970201 | 3300000956 | Soil | MKSLVFALLLAFQVQGVAPNITGFSVQGETVNLNSLKGKKPVLVVFYRTQA* |
| JGI25385J37094_100011864 | 3300002558 | Grasslands Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKTVLVVFYRTQA* |
| soilH2_101657092 | 3300003324 | Sugarcane Root And Bulk Soil | MKSLILTLLLAFQGAALQSVAPNISGFSIQGSTVNLSSFKGKKPVLVVFYRTQA* |
| Ga0066397_100734862 | 3300004281 | Tropical Forest Soil | MKSLAFALLLAFQVQGVAPNITGFSVQGETVNLNSFKGKKPVLVVFYRTQA* |
| Ga0063356_1047407712 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKSVFAVLLLALQVQSVAPKIAGFSIQGTTVNLDQYKGKKNVLVVFYRTQA* |
| Ga0066395_101131031 | 3300004633 | Tropical Forest Soil | MKSLVFALLLAFQVQGVAPNITGFSVQGETVNLNSFKGKKPVLVVFYRTQA* |
| Ga0066672_107615671 | 3300005167 | Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTVNLNSFKGKKSVLVVFYRTQA* |
| Ga0066683_100018328 | 3300005172 | Soil | MKSLLLTVLLALQVQGVAPQITGFAIQGVTVNLNSYRGKKPVLVVFYRTQA* |
| Ga0066683_104497602 | 3300005172 | Soil | MKSLMVALLLAMQVQGVAPNISGFSIQGTTVNLNSFKGKKSVLVVFYRTQA* |
| Ga0066685_102716711 | 3300005180 | Soil | MNSLIVALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGNKSVLVVFYRTQA* |
| Ga0066676_103893552 | 3300005186 | Soil | VRSFVLTLLLALQIQGVAPQITGFAIQGVTVNLNSYKGKKNVLVVFYRTQA* |
| Ga0066675_103335651 | 3300005187 | Soil | PRLVGYAPMNSLIVALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGNKSVLVVFYRTQA* |
| Ga0066388_1001345515 | 3300005332 | Tropical Forest Soil | MRSLVFALLLAFQVQGVAPNITGFSVQGETVNLNSFKGKKPVLVVFYRTQA* |
| Ga0066388_1002054384 | 3300005332 | Tropical Forest Soil | MKSLVFALLLAFQAQGVAPNISGFSVQGTTVNLNSFKGKKPVLVVFYRTEA* |
| Ga0066388_1002128033 | 3300005332 | Tropical Forest Soil | MKSLVISIFLLFQAQGVAPNISGFSIQGTTVNLNSFKGKKPVLVVFYRTQA* |
| Ga0066686_100690783 | 3300005446 | Soil | MKSLIFALLLAFQVQGVAPNISGFSVQGTTVNLNSFKGKKPVLVVFYRTQA* |
| Ga0066689_103136762 | 3300005447 | Soil | MNSLTVALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGKKSVLVVFYRTEA* |
| Ga0066682_104817222 | 3300005450 | Soil | MKSLVFALLLGLQGVQVQEVAPNITGFSIQGTTVNLNLFKGKKPVLVVFYRTQA* |
| Ga0070707_10000159015 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSLIVALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGKKNVLVVFYRTQA* |
| Ga0070707_1000723744 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSLIIALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGKKAVLVVFYRTQA* |
| Ga0070707_1008935182 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSLILALLLAFQVEGAAPNISGFSVQGTTVNLSSFKGKKPVLVVFYRTQA* |
| Ga0070698_1012628481 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSLVFALLLAFQVQGVAPNISGFSVQGETVNLNSFKGKKPVLVVFYRTQA* |
| Ga0070697_1002575803 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSLIVALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGKKAVLVVFYRTQA* |
| Ga0066661_104126902 | 3300005554 | Soil | MNSLIIALLLVMQVQGVAPNIMGFSIQGTTVNLNSFKGNKSVLVVFYRTQA* |
| Ga0066704_103917352 | 3300005557 | Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGMTINLNSFKGKKTVLVVFYRTQA* |
| Ga0066698_103823301 | 3300005558 | Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTVNLNSFKGKKNVLVVFYRTQA* |
| Ga0066698_109954431 | 3300005558 | Soil | VKSFLLTVLLALQVQGVAPQITGFAIQGVTVNLNSYKGKKSVLVVFYRTQA* |
| Ga0066700_102150483 | 3300005559 | Soil | MNSLIVALLLVMQVQGVAPNIMGFSIQGTTVNLNSFKGNKSVLVVFYRTQA* |
| Ga0066699_104515902 | 3300005561 | Soil | MNSLIVALLLVMQVQGVAPNIMGFSIQGTTVNLNSFKGKKSVLVVFYRTEA* |
| Ga0066703_103772752 | 3300005568 | Soil | MVALLLAMQVQGVAPNISGFSIQGTTVNLNSFKGKKSVLVVFYRTQA* |
| Ga0066705_100150586 | 3300005569 | Soil | LLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKTVLVVFYRTQA* |
| Ga0066694_103664893 | 3300005574 | Soil | LLLTVLLALQVQGVAPQITGFAIQGVTVNLNSYRGKKPVLVVFYRTQA* |
| Ga0068857_1018927491 | 3300005577 | Corn Rhizosphere | MKSLILALLLAFQVSGVAPNISGFSIQGTSVNLNSFKGKKPVLVVFYRTQA* |
| Ga0066691_106185421 | 3300005586 | Soil | MKSLIVALLLAMQVQAVAPNISGFSIQGTTVNLNSFKGKKNVLVVFY |
| Ga0066654_100851193 | 3300005587 | Soil | GCVPMKSLIVALLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKTVLVVFYRTQA* |
| Ga0066706_103531173 | 3300005598 | Soil | MNSLIVALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGKKSVLVVFYRTEA* |
| Ga0066903_1002504303 | 3300005764 | Tropical Forest Soil | MKSLILALLLAFQAQGIAPNITGFSIQGESVNLNSFKGKKPVLVVFYRTQA* |
| Ga0066903_1030637162 | 3300005764 | Tropical Forest Soil | MKSLIVTLLLAFQIQGIAPNITGFSVQGTTVNLSAFKGKKPVLVVFYRTQA* |
| Ga0081455_104142442 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKSLVLALLLAFQAAQGVAPNISGFSIQGTTVSLNSFKGKKPVLVVFYRTEA* |
| Ga0066651_108172311 | 3300006031 | Soil | LLTVLLALQVQGVAPQITGFAIQGVTVNLNSYRGKKPVLVVFYRTQA* |
| Ga0066653_100061135 | 3300006791 | Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKNVLVVFYRTQA* |
| Ga0066665_102666253 | 3300006796 | Soil | MKSLIVGLLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKNVLVVFYRTQA* |
| Ga0066665_106530953 | 3300006796 | Soil | VPMKSLIVALLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKNVLVVFYRTQA* |
| Ga0075428_1022836312 | 3300006844 | Populus Rhizosphere | MKTLVFALLLALQAPVVAPNISGFAVQGTTVNLNSFKGKKPVLVVFYRTEA* |
| Ga0075433_104180312 | 3300006852 | Populus Rhizosphere | MKSFVFALLLMFQAQGVAPNISGFSIQGTTVNLNSFKGKKPVLVVFYRTQA* |
| Ga0075433_116938071 | 3300006852 | Populus Rhizosphere | MKSLVFALLLAFQVQGVAPNITGFSVQGETVNLNSFKDKKPVLVVFYRTQA* |
| Ga0075425_1005278833 | 3300006854 | Populus Rhizosphere | MNSLIVALLLTMQVQGVAPNIMGFSIQGTTVNLNSFKGKKSVLVVFYRTQA* |
| Ga0075434_1002518691 | 3300006871 | Populus Rhizosphere | MKSLVISIFLLFQAQGVAPNISGFSIQGTTVNLNSFKGKKPVLVVFYQTQA* |
| Ga0075424_1005745524 | 3300006904 | Populus Rhizosphere | QRHTGGCVTIWLMKSLILALLLAFQAQGIAPNITGFSIQGESVNLNSFKGKKPVLVVFYRTQA* |
| Ga0079218_129755622 | 3300007004 | Agricultural Soil | MKTLVFALLFALQAQTPTVAPNVGGFSVQGTTVNLSQFKGKKPVLVVFYRTQG* |
| Ga0066710_1008090222 | 3300009012 | Grasslands Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTVNLNSFKGKKNVLVVFYRTQA |
| Ga0066710_1009241052 | 3300009012 | Grasslands Soil | MNSLIIALLLVMQVQGVAPNIMGFSIQGTTVNLNSFKGNKSVLVVFYRTQA |
| Ga0066710_1009736922 | 3300009012 | Grasslands Soil | VRSFVLTLLLALQVQGVAPQITGFAIQGVTVNLNSYKGKKNVLVVFYRTQA |
| Ga0066709_1006342003 | 3300009137 | Grasslands Soil | MNSLIVALLLVMQVQGVAPNIMGFSIQGTTGNLNSIKGNKSVLVVFYRT* |
| Ga0066709_1012610072 | 3300009137 | Grasslands Soil | VRSFVLTLLLALQVQGVAPQITGFAIQGVTVNLNSYKGKKNVLVVFYRTQA* |
| Ga0114129_102452033 | 3300009147 | Populus Rhizosphere | MKSVVLSLLFMLQVQGVAPLFSGFSIQGTTINLSYYKGKQNVLVVFYRTQG* |
| Ga0114945_102521872 | 3300009444 | Thermal Springs | MKLLLAFVLLLQVKGIAPPITGFSIQGTTVSLNSYKGKQNVLVVFYRTQA* |
| Ga0105347_10095475 | 3300009609 | Soil | MKSLVFALLLALQAQTPAVAPNVGGFSVQGSTVNLIQFKGKKPVLVVFYRTQG* |
| Ga0105084_10908612 | 3300009811 | Groundwater Sand | MKALVIALLLAFQVQGVAPKITGFSIQGTSVSLEYYKGKKSVLVVFYRTQA* |
| Ga0126384_100296504 | 3300010046 | Tropical Forest Soil | MKSIVFALLLAFQVQGVAPNITGFSVQGETVNLNSFKGKKPVLVVFYRTQA* |
| Ga0127460_11186153 | 3300010114 | Grasslands Soil | LLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKNVLVVFYRTQA* |
| Ga0127484_11521181 | 3300010134 | Grasslands Soil | KSLIVALLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKNVLVVFYRTQA* |
| Ga0127499_10064033 | 3300010141 | Grasslands Soil | ALLLAMQVQGVAPNISGFSIQGTTVSLNSFKGKKNVLVVFYRTQA* |
| Ga0127483_10984723 | 3300010142 | Grasslands Soil | LAMQVQGVAPNISGFSIQGTTINLNSFKGKKNVLVVFYRTQA* |
| Ga0134088_100009168 | 3300010304 | Grasslands Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTVSLNSFKGKKNVLVVFYRTQA* |
| Ga0134084_100177803 | 3300010322 | Grasslands Soil | MKSLIVALLLSMQVQGVAPNISGFSIQGTTINLNSFKGKKTVLVVFYRTQA* |
| Ga0126379_112418243 | 3300010366 | Tropical Forest Soil | MLAFQVQGVAPNITGFSVQGETVNLNSFKGKKPVLVVFYRTQA* |
| Ga0134124_100845266 | 3300010397 | Terrestrial Soil | MKALVLALLLAFQAQGIAPNITGFSIQGTSVNLNSFKGKKPVLVVFYRTQA* |
| Ga0126383_132263171 | 3300010398 | Tropical Forest Soil | TEGCVRIWLMKSLILALLLAFQAQGIAPNITGFSIQGESVNLNSFKGKKPVLVVFYRTQA |
| Ga0137422_10043885 | 3300011416 | Soil | MKSLVFALLLALQAQTPAVAPNVGGFSVQGSTVNLSQFKGKKPVLVVFYRTQG* |
| Ga0137314_10156454 | 3300011420 | Soil | MKSLVFALLLALQAQTGVQTGTVAPNVGGFAIQGSTVNLSQFKGKKPVLVVFYRTQG* |
| Ga0137421_10183081 | 3300012039 | Soil | MKSLVFALLLALQAQTGVQTGTVAPNVGGFAIQGSTVNLSQFKGK |
| Ga0137364_103920182 | 3300012198 | Vadose Zone Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTINLNSFKGQKTVLVVFYRTQA* |
| Ga0137383_100200294 | 3300012199 | Vadose Zone Soil | MKSLVFALLLALQGVQVQEVAPNITGFSIQGTTVNLNLFKGKKPVLVVFYRTQA* |
| Ga0137362_112095153 | 3300012205 | Vadose Zone Soil | MLFGLQGVQVQEVAPNITGFSIQGTTVNLNLFKGKKPVLVVFYRTQA* |
| Ga0137381_100071017 | 3300012207 | Vadose Zone Soil | MKSLLLTVLLALQVQGLAPQITGFAIQGVTVNLNSYRGKKPVLVVFYRTQA* |
| Ga0137381_100488611 | 3300012207 | Vadose Zone Soil | LIVALLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKNVLLVFYRTQA* |
| Ga0137370_106028193 | 3300012285 | Vadose Zone Soil | AMQVQGVAPNISGFSIQGTTINLNSFKGQKTVLVVFYRTQA* |
| Ga0137387_100781974 | 3300012349 | Vadose Zone Soil | MKSLVFALLLALQGVQVQEMAPNITGFSIQGTTVNLNLFKGKKPVLVVFYRTQA* |
| Ga0137371_102953253 | 3300012356 | Vadose Zone Soil | MKSLLLTALLALQVQGVAPQITGFAIQGVTVNLNSYRGKKPVLVVFYRTQA* |
| Ga0137394_111176133 | 3300012922 | Vadose Zone Soil | MKAVVFSLLLMLQVQGVAPLFSGFSIQGTSINLSYYKGKQNVLVVFYRTQG* |
| Ga0126375_110447923 | 3300012948 | Tropical Forest Soil | MKSLALALLLGVQAQAVAPNITGFSVQGTTVNLSSFKGKKPVLVVFYRTQA* |
| Ga0134075_105034252 | 3300014154 | Grasslands Soil | MKSLIVGLLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKTVLVVFYRT |
| Ga0180065_11348523 | 3300014878 | Soil | LLALQAQTPAVAPNVGGFSVQGSTVNLSQFKGKKPVLVVFYRTQG* |
| Ga0134085_105309021 | 3300015359 | Grasslands Soil | VKSFLLTVLLALQVQGVAPQITGFAIQGVTVNLNSYKGKKSVLVVFYRTQ |
| Ga0132258_1001510115 | 3300015371 | Arabidopsis Rhizosphere | MRSFVLALLLMVQAQGLAPNSLAPNITGFSIQGTTVNLGSFKGKKPVLVVFYRTQA* |
| Ga0132258_134066012 | 3300015371 | Arabidopsis Rhizosphere | MKSLVIGLLLAFQVQGIAPKITGFSIQGTSVSLEYYKGKKNVLVVFYRTQA* |
| Ga0132256_1021826631 | 3300015372 | Arabidopsis Rhizosphere | IPRMRSFVLALLLMVQAQGLAPNSLAPNITGFSIQGTTVNLGSFKGKKPVLVVFYRTQA* |
| Ga0134112_102579663 | 3300017656 | Grasslands Soil | SLIVALLLAMQVQGVAPNISGFSIQGTTVSLNSFKGKKNVLVVFYRTQA |
| Ga0134074_10524552 | 3300017657 | Grasslands Soil | MKSLIVGLLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKTVLVVFYRTQA |
| Ga0134083_102798262 | 3300017659 | Grasslands Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTVSLNSFKGKKNVLVVFYRTQA |
| Ga0184639_106505962 | 3300018082 | Groundwater Sediment | MKPLLALLFLLFQVQGVAPNVTAFSIQGTTVNLDFYKGKQNVLLVFYRTQN |
| Ga0066655_100556974 | 3300018431 | Grasslands Soil | MKSLLLTVLLALQVQGVAPQITGFAIQGVTVNLNSYRGKKPVLVVFYRTQA |
| Ga0066655_101434373 | 3300018431 | Grasslands Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKTVLVVFYRTQA |
| Ga0066655_102279052 | 3300018431 | Grasslands Soil | MNSLIVALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGKKNVLVVFYRTQA |
| Ga0066667_100099305 | 3300018433 | Grasslands Soil | MKSLMVALLLAMQVQGVAPNISGFSIQGTTVNLNSFKGKKSVLVVFYRTQA |
| Ga0066669_102518671 | 3300018482 | Grasslands Soil | MNSLIVALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGKKSVLVVFYRTEA |
| Ga0184645_10423852 | 3300019233 | Groundwater Sediment | GGIVKSFLLTVLLALQVQGVAPQITGFAIQGVTVNLNSYKGKKSVLVVFYRTQA |
| Ga0222625_10139221 | 3300022195 | Groundwater Sediment | VKSFLLTVLLALQVQGVAPQITGFAIQGVTVNLNSYKGKKSVLVVFYRTQA |
| Ga0212128_109269372 | 3300022563 | Thermal Springs | MKLLLAFVLLLQVKGIAPPITGFSIQGTTVSLNSYKGKQNVLVVFYRTQA |
| Ga0209619_105708762 | 3300025159 | Soil | MNALLVALLLAVQGISQGISGVAPNINGFSIQGSTVSLSSFKGTKNVLVVFYRTQA |
| Ga0209323_105012892 | 3300025314 | Soil | MNALVIALLLALQGMPLGISGAAPNINGFSIQGSTVSLSSFKGTKNVLVVFYRTQA |
| Ga0209641_110703531 | 3300025322 | Soil | MNALLALLLLLVQVQGVAPNVTAFSIQGTTVNLDFYKGKQNVLLVFYRTQN |
| Ga0209640_107516612 | 3300025324 | Soil | MKPLLAGLLLLFQIQGAAPNVTGFSIQGTTVNLNFYKGKQNVLLVFYRTHN |
| Ga0207646_101457102 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSLIIALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGKKAVLVVFYRTQA |
| Ga0207646_118584422 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSLILALLLAFQVEGAAPNISGFSVQGTTVNLSSFKGKKPVLVVFYRTQA |
| Ga0209350_10478531 | 3300026277 | Grasslands Soil | MVALLLAMQVQGVAPNISGFSIQGTTVNLNSFKGKKSVLVVFYRTQA |
| Ga0209468_10584413 | 3300026306 | Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKNVLVVFYRTQA |
| Ga0209470_100046512 | 3300026324 | Soil | MKSLIVGLLLAMQVQGVAPNISGFSIQGTTINLNSFKGKKNVLVVFYRTQA |
| Ga0209470_13810712 | 3300026324 | Soil | VLTLLLALQIQGVAPQITGFAIQGVTVNLNSYKGKKNVLVVFYRTQA |
| Ga0209267_10972103 | 3300026331 | Soil | MNSLIVALLLAMQVQGVAPNIMGFSIQGTTVNLNSFKGNKSVLVVFYRTQA |
| Ga0209058_11055363 | 3300026536 | Soil | MKSLIFALLLAFQVQGVAPNISGFSVQGTTVNLNSFKGKKPVLVVFYRTQA |
| Ga0209156_102016982 | 3300026547 | Soil | MKSLIVALLLAMQVQGVAPNISGFSIQGTTVNLNSFKGKKSVLVVFYRTQA |
| Ga0209845_10446272 | 3300027324 | Groundwater Sand | MKTLVLALLLTLQAPIVAPNISGFSVQGTTVNLNSFKGKTPVLVVFYRTEA |
| Ga0209689_11168723 | 3300027748 | Soil | MKSLMVALLLAMQVQGVAPNISGFSIQGMTINLNSFKGKKTVLVVFYRTQA |
| Ga0209382_102860672 | 3300027909 | Populus Rhizosphere | MKSLVLALLLAFQVQAVAPNITGFSVQGETVNLNSFKGKKPVLVVFYRTQA |
| Ga0209382_111865402 | 3300027909 | Populus Rhizosphere | MKTLVFALLLALQAPVVAPNISGFAVQGTTVNLNSFKGKKPVLVVFYRTEA |
| Ga0307468_1002172002 | 3300031740 | Hardwood Forest Soil | MKALVIALLLAFQVQGVAPKITGFSIQGTSVSLEYYKGKKNVLVVFYRTQA |
| Ga0306923_118702342 | 3300031910 | Soil | MKALILALLLAFQAQGIAPNITGFSIQGESVNLNSFKGKKPVLVVFYRTQA |
| Ga0306926_111453791 | 3300031954 | Soil | GVTEGCVRIWLMKALILALLLAFQAQGIAPNITGFSIQGESVNLNSFKGKKPVLVVFYRTQA |
| Ga0310812_100594301 | 3300032421 | Soil | MKALVLALLLAFQAQGIAPNIIGFSIQGESVNLNSFKGKKPVLVVFYRTQA |
| Ga0326726_105528262 | 3300033433 | Peat Soil | MKSFVIALLLAFQVQGVAPKITGFSIQGTSVSLEYYKGKKNVLVVFYRTQA |
| ⦗Top⦘ |