| Basic Information | |
|---|---|
| Family ID | F069952 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPGKIP |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.76 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.24 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.610 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.016 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.659 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.62% β-sheet: 0.00% Coil/Unstructured: 52.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00583 | Acetyltransf_1 | 26.02 |
| PF13673 | Acetyltransf_10 | 21.95 |
| PF00330 | Aconitase | 11.38 |
| PF00694 | Aconitase_C | 2.44 |
| PF06727 | DUF1207 | 0.81 |
| PF00109 | ketoacyl-synt | 0.81 |
| PF08402 | TOBE_2 | 0.81 |
| PF00326 | Peptidase_S9 | 0.81 |
| PF13508 | Acetyltransf_7 | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.61 % |
| Unclassified | root | N/A | 24.39 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002916|JGI25389J43894_1034059 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005166|Ga0066674_10075599 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
| 3300005166|Ga0066674_10471261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 570 | Open in IMG/M |
| 3300005167|Ga0066672_10131081 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300005172|Ga0066683_10789073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
| 3300005172|Ga0066683_10804044 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 546 | Open in IMG/M |
| 3300005177|Ga0066690_10660902 | Not Available | 695 | Open in IMG/M |
| 3300005179|Ga0066684_10405093 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300005179|Ga0066684_10564942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 763 | Open in IMG/M |
| 3300005187|Ga0066675_10678711 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 774 | Open in IMG/M |
| 3300005437|Ga0070710_11123961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 578 | Open in IMG/M |
| 3300005446|Ga0066686_10984883 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 548 | Open in IMG/M |
| 3300005447|Ga0066689_10471529 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005518|Ga0070699_100741283 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 898 | Open in IMG/M |
| 3300005545|Ga0070695_100495412 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005546|Ga0070696_100035545 | All Organisms → cellular organisms → Bacteria | 3431 | Open in IMG/M |
| 3300005554|Ga0066661_10834352 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 539 | Open in IMG/M |
| 3300005555|Ga0066692_10633223 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 668 | Open in IMG/M |
| 3300005557|Ga0066704_10370330 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005576|Ga0066708_10498503 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300005586|Ga0066691_10591252 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 660 | Open in IMG/M |
| 3300005586|Ga0066691_10666669 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
| 3300005586|Ga0066691_10740445 | Not Available | 581 | Open in IMG/M |
| 3300006791|Ga0066653_10120534 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300006791|Ga0066653_10759187 | Not Available | 507 | Open in IMG/M |
| 3300006797|Ga0066659_10207089 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300006800|Ga0066660_10488519 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300006852|Ga0075433_11076151 | Not Available | 699 | Open in IMG/M |
| 3300006914|Ga0075436_100023150 | All Organisms → cellular organisms → Bacteria | 4267 | Open in IMG/M |
| 3300007076|Ga0075435_101618130 | Not Available | 568 | Open in IMG/M |
| 3300009012|Ga0066710_100562554 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300009012|Ga0066710_101650630 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300009012|Ga0066710_103415329 | Not Available | 603 | Open in IMG/M |
| 3300009038|Ga0099829_10202943 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300009089|Ga0099828_11481600 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 598 | Open in IMG/M |
| 3300009089|Ga0099828_12023227 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300009137|Ga0066709_100776655 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300009147|Ga0114129_10529408 | All Organisms → cellular organisms → Bacteria | 1535 | Open in IMG/M |
| 3300009821|Ga0105064_1121021 | Not Available | 548 | Open in IMG/M |
| 3300010301|Ga0134070_10135707 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010301|Ga0134070_10399766 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300010322|Ga0134084_10087214 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300010329|Ga0134111_10194071 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
| 3300010335|Ga0134063_10229527 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300010335|Ga0134063_10698659 | Not Available | 524 | Open in IMG/M |
| 3300010336|Ga0134071_10396154 | Not Available | 703 | Open in IMG/M |
| 3300010403|Ga0134123_13057713 | Not Available | 537 | Open in IMG/M |
| 3300011271|Ga0137393_10171836 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300012038|Ga0137431_1239413 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 508 | Open in IMG/M |
| 3300012096|Ga0137389_10663507 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300012096|Ga0137389_11744003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300012189|Ga0137388_10498350 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300012198|Ga0137364_11084630 | Not Available | 603 | Open in IMG/M |
| 3300012200|Ga0137382_10041510 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
| 3300012200|Ga0137382_10438097 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300012203|Ga0137399_11457355 | Not Available | 571 | Open in IMG/M |
| 3300012205|Ga0137362_10308124 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300012207|Ga0137381_11572589 | Not Available | 549 | Open in IMG/M |
| 3300012208|Ga0137376_11644142 | Not Available | 533 | Open in IMG/M |
| 3300012210|Ga0137378_10066895 | All Organisms → cellular organisms → Bacteria | 3256 | Open in IMG/M |
| 3300012210|Ga0137378_10691277 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300012211|Ga0137377_10038210 | All Organisms → cellular organisms → Bacteria | 4388 | Open in IMG/M |
| 3300012211|Ga0137377_11090668 | Not Available | 729 | Open in IMG/M |
| 3300012211|Ga0137377_11542622 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 589 | Open in IMG/M |
| 3300012351|Ga0137386_10177296 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300012360|Ga0137375_10627012 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 890 | Open in IMG/M |
| 3300012361|Ga0137360_10485766 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300012361|Ga0137360_10825062 | Not Available | 798 | Open in IMG/M |
| 3300012392|Ga0134043_1306000 | Not Available | 510 | Open in IMG/M |
| 3300012683|Ga0137398_10761205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 675 | Open in IMG/M |
| 3300012685|Ga0137397_10076175 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
| 3300012918|Ga0137396_10862229 | Not Available | 665 | Open in IMG/M |
| 3300012918|Ga0137396_11255835 | Not Available | 518 | Open in IMG/M |
| 3300012927|Ga0137416_10611442 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300012927|Ga0137416_11131592 | Not Available | 703 | Open in IMG/M |
| 3300012944|Ga0137410_11625932 | Not Available | 567 | Open in IMG/M |
| 3300012972|Ga0134077_10363528 | Not Available | 619 | Open in IMG/M |
| 3300012975|Ga0134110_10009647 | All Organisms → cellular organisms → Bacteria | 3649 | Open in IMG/M |
| 3300012977|Ga0134087_10677747 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300014166|Ga0134079_10001069 | All Organisms → cellular organisms → Bacteria | 7272 | Open in IMG/M |
| 3300015358|Ga0134089_10458728 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 552 | Open in IMG/M |
| 3300017656|Ga0134112_10033760 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300017659|Ga0134083_10142289 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300018068|Ga0184636_1326065 | Not Available | 538 | Open in IMG/M |
| 3300018433|Ga0066667_10565241 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300018433|Ga0066667_11472825 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 601 | Open in IMG/M |
| 3300018468|Ga0066662_10117947 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300018468|Ga0066662_10326016 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300018468|Ga0066662_11470591 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 708 | Open in IMG/M |
| 3300018468|Ga0066662_12504537 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 544 | Open in IMG/M |
| 3300019789|Ga0137408_1242623 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300021080|Ga0210382_10034933 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300022694|Ga0222623_10308285 | Not Available | 607 | Open in IMG/M |
| 3300026295|Ga0209234_1048666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter | 1611 | Open in IMG/M |
| 3300026295|Ga0209234_1276838 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300026296|Ga0209235_1106126 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300026296|Ga0209235_1244156 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
| 3300026297|Ga0209237_1223763 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 585 | Open in IMG/M |
| 3300026310|Ga0209239_1024097 | All Organisms → cellular organisms → Bacteria | 2967 | Open in IMG/M |
| 3300026310|Ga0209239_1048614 | All Organisms → cellular organisms → Bacteria | 1922 | Open in IMG/M |
| 3300026310|Ga0209239_1202062 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 714 | Open in IMG/M |
| 3300026322|Ga0209687_1282000 | Not Available | 522 | Open in IMG/M |
| 3300026324|Ga0209470_1385701 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300026325|Ga0209152_10322609 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
| 3300026333|Ga0209158_1134384 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 916 | Open in IMG/M |
| 3300026532|Ga0209160_1016954 | All Organisms → cellular organisms → Bacteria | 5028 | Open in IMG/M |
| 3300026536|Ga0209058_1078217 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300026547|Ga0209156_10022427 | All Organisms → cellular organisms → Bacteria | 3744 | Open in IMG/M |
| 3300026700|Ga0208474_100822 | Not Available | 823 | Open in IMG/M |
| 3300027383|Ga0209213_1100389 | Not Available | 535 | Open in IMG/M |
| 3300027748|Ga0209689_1267730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 682 | Open in IMG/M |
| 3300027748|Ga0209689_1271381 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 674 | Open in IMG/M |
| 3300027882|Ga0209590_10255504 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1119 | Open in IMG/M |
| 3300028720|Ga0307317_10202019 | Not Available | 670 | Open in IMG/M |
| 3300031820|Ga0307473_10074843 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300031962|Ga0307479_10883665 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 866 | Open in IMG/M |
| 3300031965|Ga0326597_10119240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3191 | Open in IMG/M |
| 3300032180|Ga0307471_101999377 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 727 | Open in IMG/M |
| 3300032205|Ga0307472_101084800 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 756 | Open in IMG/M |
| 3300032205|Ga0307472_102447309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 530 | Open in IMG/M |
| 3300032782|Ga0335082_10794162 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300034164|Ga0364940_0170977 | Not Available | 631 | Open in IMG/M |
| 3300034177|Ga0364932_0247381 | Not Available | 675 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 15.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.20% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018068 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026700 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN350 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25389J43894_10340593 | 3300002916 | Grasslands Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGSLNLIDPTKIF |
| Ga0066674_100755991 | 3300005166 | Soil | MTFNRMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNA |
| Ga0066674_104712612 | 3300005166 | Soil | MGTVPLPLALHLATYTVLGLFCAFAGGLNLIDPTKIFPNGVVFLAIAGF |
| Ga0066672_101310811 | 3300005167 | Soil | MTFNKMGTVPLPLALHLAAYTVLGLFCLFAGALNLIDPVKIPH |
| Ga0066683_107890731 | 3300005172 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLIDPGKIPHGIMFLLV |
| Ga0066683_108040441 | 3300005172 | Soil | MGTVPLPLALHLASYTVLGLFCFFAGALNLIDPGKIPHGIMFLLV |
| Ga0066690_106609021 | 3300005177 | Soil | MTFNRMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNAVIFLG |
| Ga0066684_104050931 | 3300005179 | Soil | MTFNRMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPIKIIPNAI |
| Ga0066684_105649421 | 3300005179 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLIDPVKVPHG |
| Ga0066675_106787112 | 3300005187 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPSKIPHGVMFLAVCGFSWG |
| Ga0070710_111239611 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFNRMGTVPLPLTLHLASYTVVGLFCFFAGVLNLIDPTKIPHGL |
| Ga0066686_109848832 | 3300005446 | Soil | MTFNKMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVKIPHGLM |
| Ga0066689_104715291 | 3300005447 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVKIPHGLMF |
| Ga0070699_1007412831 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFNKMGTVPLPLALHLASHTVIGLFCAFAGGLNLIDPTKIF |
| Ga0070695_1004954121 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MFCAMTFNKMGTVPLPLALHLATHTVIGLFCAFAGGLNLIDPTKIIPN |
| Ga0070696_1000355451 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTFNKMGTVPLPLALHLATHTVIGLFCAFAGGLNLIDPTKIFPNGVVFL |
| Ga0066661_108343522 | 3300005554 | Soil | MTFNRMGTVPLPLALHLASHTVLGLFCFFAGVLNL |
| Ga0066692_106332232 | 3300005555 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLID |
| Ga0066704_103703303 | 3300005557 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLIDPGKIPHGIMFLL |
| Ga0066708_104985031 | 3300005576 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLI |
| Ga0066691_105912522 | 3300005586 | Soil | MSFQHTETVPLPLTLHLASYTVIGLFCAFAGGLNLIDPGHILRL |
| Ga0066691_106666692 | 3300005586 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPSKIPHGVMFLAVCGFSW |
| Ga0066691_107404451 | 3300005586 | Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNAVIFLG |
| Ga0066653_101205341 | 3300006791 | Soil | MTFNRMGTVPLPLALHLATYTVLGLFCAFAGGLNLIDPTKIFPNGVVF |
| Ga0066653_107591872 | 3300006791 | Soil | MTFNKMGTLPLPLALHLATHTVIGLFCAFAGGLNLIDPTKIIPNAVIFLG |
| Ga0066659_102070894 | 3300006797 | Soil | MTFNKMGTLPLPLALHLASYTVIGLFCAFAGGLNLIDPTK |
| Ga0066660_104885193 | 3300006800 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLI |
| Ga0075433_110761512 | 3300006852 | Populus Rhizosphere | MTFNRMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIF |
| Ga0075436_1000231505 | 3300006914 | Populus Rhizosphere | MTFNKMGTVPLPLALHLATHTVIGLFCAFAGGLNLIDPTKIFPNGVIFL |
| Ga0075435_1016181302 | 3300007076 | Populus Rhizosphere | MGTVPLPLALHLATHTVIGLFCAFAGGLNLIDPTKIFPNGVIFLAIAGFS |
| Ga0066710_1005625541 | 3300009012 | Grasslands Soil | MTVNKMGTVPLPLALHLAAYTVLGLFCFFAGALNLIDPLK |
| Ga0066710_1016506303 | 3300009012 | Grasslands Soil | MTFNKMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVK |
| Ga0066710_1034153292 | 3300009012 | Grasslands Soil | MTFNRMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNAV |
| Ga0099829_102029434 | 3300009038 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPGKIP |
| Ga0099828_114816001 | 3300009089 | Vadose Zone Soil | MTFNRMGTVPLPLALHLAGYTVLGLFCFFAGGLNLIDPGKIPHGLMFLAVCGFSWGY |
| Ga0099828_120232272 | 3300009089 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPGKIPHGLMFLAVC |
| Ga0066709_1007766554 | 3300009137 | Grasslands Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKI |
| Ga0114129_105294081 | 3300009147 | Populus Rhizosphere | MTFNKMGTVPLPLALHLATYTVIGLFCAFAGGLNLIDPTKI |
| Ga0105064_11210211 | 3300009821 | Groundwater Sand | MTFNKMGTLPLALALHLATHTVIGLFCAFAGGLNLIDPTKIFPNAVIF |
| Ga0134070_101357071 | 3300010301 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVKIPHGL |
| Ga0134070_103997661 | 3300010301 | Grasslands Soil | MTFNRMGIVPLPLALHLATYTVLGLFCAFAGGLNLIDPTKI |
| Ga0134084_100872141 | 3300010322 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPSKIPHGVMLLAVCGFS |
| Ga0134111_101940711 | 3300010329 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVKIPHGLMFLAV |
| Ga0134063_102295273 | 3300010335 | Grasslands Soil | MTANKMGTVPLPLALHLAAYTVLGLFCFFAGALNLIDP |
| Ga0134063_106986592 | 3300010335 | Grasslands Soil | MTFNRMGTLPLPLALHLATYTVIGLFCAFAGGLNLID |
| Ga0134071_103961541 | 3300010336 | Grasslands Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNAVIFLGLA |
| Ga0134123_130577131 | 3300010403 | Terrestrial Soil | MFCAMTFNKMGTVPLPLALHLATHTVIGLFCAFAGGL |
| Ga0137393_101718361 | 3300011271 | Vadose Zone Soil | MTFNRMGTVPLPLALHLAGYTVLGLFCFFAGGLNLIDPGKIPHGLMFLAV |
| Ga0137431_12394132 | 3300012038 | Soil | MPTHRDTVPLPLALHLAGYTVLGLFCAFAGSMNLIDPGK |
| Ga0137389_106635073 | 3300012096 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPGKI |
| Ga0137389_117440032 | 3300012096 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPGKIPHGLMFFAVCGF |
| Ga0137388_104983503 | 3300012189 | Vadose Zone Soil | MTFQHTETVPLPLALHLATYTVIGLFCAFAGGLNLIDP |
| Ga0137364_110846302 | 3300012198 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNAV |
| Ga0137382_100415101 | 3300012200 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPSKIPHGVM |
| Ga0137382_104380971 | 3300012200 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPSKI |
| Ga0137399_114573551 | 3300012203 | Vadose Zone Soil | MTFNRMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIIPNAVIF |
| Ga0137362_103081244 | 3300012205 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNL |
| Ga0137381_115725891 | 3300012207 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPSKIFPN |
| Ga0137376_116441422 | 3300012208 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATHTVIGLFCAFAGSLNLIDPTKIFPNAVIFLGLA |
| Ga0137378_100668954 | 3300012210 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLID |
| Ga0137378_106912773 | 3300012210 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPT |
| Ga0137377_100382105 | 3300012211 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASHTVLGLFCFFAGVLNLVDPVKIPQGILFLL |
| Ga0137377_110906682 | 3300012211 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATHTVIGLFCASAGSLNLIDPTKIFPNA |
| Ga0137377_115426221 | 3300012211 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGVLNLI |
| Ga0137386_101772964 | 3300012351 | Vadose Zone Soil | MTFNLMGTVSLPLALHLACCAFLGLFCFFAGVLNLIYPG |
| Ga0137375_106270121 | 3300012360 | Vadose Zone Soil | MTFNRMGTVPLPLALHLATYTVLGLFCAFAGGLNLIEPTKIFPNG |
| Ga0137360_104857661 | 3300012361 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCLFAGGLNLI |
| Ga0137360_108250623 | 3300012361 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIIPNAVIFLGLAGF |
| Ga0134043_13060002 | 3300012392 | Grasslands Soil | MTFNKMGTLPLPLALHLATHTVIGLFCAFAGGLNLIDPTKIIPNAVIF |
| Ga0137398_107612051 | 3300012683 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPGKIPHGLM |
| Ga0137397_100761754 | 3300012685 | Vadose Zone Soil | MTFNKTGTLPLPLALHLATYPVIGLFCAFAGGLNLIDPTN |
| Ga0137396_108622291 | 3300012918 | Vadose Zone Soil | MTFNKMGTLPLPLALHLAMYTVIGLFCAFAGGLNLIDPTKIFPNAVVFL |
| Ga0137396_112558351 | 3300012918 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFP |
| Ga0137416_106114421 | 3300012927 | Vadose Zone Soil | MTFNKMGTLPLPLALHLAMYTVIGLFCAFAGGLNLIDPTKIFPNAVIFLGLCA |
| Ga0137416_111315921 | 3300012927 | Vadose Zone Soil | MFSPMSFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPMKIFPNAVI |
| Ga0137410_116259322 | 3300012944 | Vadose Zone Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNAVIFLGLAGFS |
| Ga0134077_103635281 | 3300012972 | Grasslands Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNAVIFLGLAG |
| Ga0134110_100096474 | 3300012975 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLIDPGK |
| Ga0134087_106777471 | 3300012977 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCLFAGALNLI |
| Ga0134079_100010698 | 3300014166 | Grasslands Soil | MTFNRTGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIIP |
| Ga0134089_104587281 | 3300015358 | Grasslands Soil | MTFNRMGTVPLPLALHLASHTVLGLFCFFAGVLNLIDPVKIPQG |
| Ga0134112_100337604 | 3300017656 | Grasslands Soil | MTFNRLGTVPLPLALHLASYTVLGLFCMFGFVLNLIDPDKIIPNA |
| Ga0134083_101422891 | 3300017659 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVKIPHGLMFLAVCV |
| Ga0184636_13260651 | 3300018068 | Groundwater Sediment | MTFNKMGTVPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNG |
| Ga0066667_105652413 | 3300018433 | Grasslands Soil | MTFNRMGTVPLPLALHLACYTVLGLFCFFAGALNLIDPGKIPHGIMFLL |
| Ga0066667_114728251 | 3300018433 | Grasslands Soil | MTFNKMGTVPLPLALHLAAYTVLGLFCFFAGALNLIDPVKIPHG |
| Ga0066662_101179471 | 3300018468 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLIDP |
| Ga0066662_103260164 | 3300018468 | Grasslands Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPNAVIFL |
| Ga0066662_114705911 | 3300018468 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVKIPHGLMFLAVC |
| Ga0066662_125045371 | 3300018468 | Grasslands Soil | MTFQHTETVPLPLALHLATYTVIGLFCAFAGGLNLIDPGHIL |
| Ga0137408_12426231 | 3300019789 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDP |
| Ga0210382_100349334 | 3300021080 | Groundwater Sediment | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGGLNLIDPVKIPHG |
| Ga0222623_103082852 | 3300022694 | Groundwater Sediment | MSFNRMGTVPLPLALHLAIHTVIGLFCAFAGGLNLIDPTKIFPN |
| Ga0209234_10486661 | 3300026295 | Grasslands Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIF |
| Ga0209234_12768382 | 3300026295 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLIDPGKIPHGIMFL |
| Ga0209235_11061261 | 3300026296 | Grasslands Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGSLNLIDPTKIFPN |
| Ga0209235_12441562 | 3300026296 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVKIPHGLMFLA |
| Ga0209237_12237631 | 3300026297 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVKI |
| Ga0209239_10240974 | 3300026310 | Grasslands Soil | MFCVMTFNKMGTVPLPLALHLAAYTVLGLFCCFAGALNL |
| Ga0209239_10486144 | 3300026310 | Grasslands Soil | MTFNKMGTVPLPLALHLAAYTVLGLFCFFAGALNLIDPVKIPHGVLFLGI |
| Ga0209239_12020621 | 3300026310 | Grasslands Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLIDPVKIPHGIMFL |
| Ga0209687_12820002 | 3300026322 | Soil | MGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKI |
| Ga0209470_13857012 | 3300026324 | Soil | MTFNRMGTVPLPLALHLATYTVLGLFCAFAGGLNLI |
| Ga0209152_103226092 | 3300026325 | Soil | MTFNKMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVKIPHGL |
| Ga0209158_11343843 | 3300026333 | Soil | MSFQHTDTVPLPLALHLATYTVIGLFCAFAGGLNLIDPGHILPLG |
| Ga0209160_10169541 | 3300026532 | Soil | MTFNRMGTVPLPLALHLASHTVLGLFCFFAGVLNLVDPVKI |
| Ga0209058_10782171 | 3300026536 | Soil | MTFNKMGTLPLPLALHLATHTVIGLFCAFAGGLNLIDPTKIFPNAVIFLGLAGFSWGY |
| Ga0209156_100224274 | 3300026547 | Soil | MTFNKMGTVPLPLALHLAAYTVLGLFCLFAGGLNLIDPVKIPHG |
| Ga0208474_1008221 | 3300026700 | Soil | MGTVPLPLTLHLASYTVVGLFCLFAGVLNLIDPTKIPHGLIYLAICG |
| Ga0209213_11003891 | 3300027383 | Forest Soil | MTFNKMGTLPLPLALHLATYTVIGLFCAFAGGLNLIDPTKIFPN |
| Ga0209689_12677301 | 3300027748 | Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLIDPGKIP |
| Ga0209689_12713812 | 3300027748 | Soil | MGTVPLPLALHLASYTVLGLFCFFAGALNLIDPGKIP |
| Ga0209590_102555041 | 3300027882 | Vadose Zone Soil | MTFNRMGTVPLPLALHLASYTVLGLFCLFAGSLNLIDPVKIPHG |
| Ga0307317_102020192 | 3300028720 | Soil | MGTVPLPLALHLASHTVIGLFCAFAGGLNLIDPTKIFPNGV |
| Ga0307473_100748431 | 3300031820 | Hardwood Forest Soil | MHTVPLPLALHLASYTVLGLFCMFAGGLNLIDPGHIL |
| Ga0307479_108836653 | 3300031962 | Hardwood Forest Soil | MFSAMTFNRMGTVPLPLALHLASYTVLGLFCFFAGALNLIDP |
| Ga0326597_101192403 | 3300031965 | Soil | MTFNRMGTVPLPLALHLATYTVIGLFCAFAGGLNLIDPTKILPNGVP |
| Ga0307471_1019993772 | 3300032180 | Hardwood Forest Soil | MFANRTDSVPLPLALHLASYTLIGLFCAFAGGLNLI |
| Ga0307472_1010848002 | 3300032205 | Hardwood Forest Soil | MTFNRMGTVPLPLALHLASYTVLGLFCFFAGSLNLIDPVK |
| Ga0307472_1024473091 | 3300032205 | Hardwood Forest Soil | MTFNRMGTVPLPLTLHLASYTVVGLFCFFAGVLNLIDPTKIPHGV |
| Ga0335082_107941623 | 3300032782 | Soil | MSFDRHSVPLPLALHLASYTVVGLFCGAAGTLNLIDP |
| Ga0364940_0170977_2_106 | 3300034164 | Sediment | MTFNRMGTLPLPLALHLATYTVIGLFCAFAGGLNL |
| Ga0364932_0247381_2_124 | 3300034177 | Sediment | MTFNKMGTVPLPLALHLATHTVIGLFCAFAGGLNLIDPTKI |
| ⦗Top⦘ |