NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069948

Metagenome / Metatranscriptome Family F069948

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069948
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 41 residues
Representative Sequence MALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDLGA
Number of Associated Samples 108
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.12 %
% of genes near scaffold ends (potentially truncated) 98.37 %
% of genes from short scaffolds (< 2000 bps) 90.24 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.179 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.951 % of family members)
Environment Ontology (ENVO) Unclassified
(23.577 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.033 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.42%    β-sheet: 0.00%    Coil/Unstructured: 57.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF08281Sigma70_r4_2 3.25
PF00378ECH_1 2.44
PF13229Beta_helix 1.63
PF12697Abhydrolase_6 1.63
PF00753Lactamase_B 1.63
PF01764Lipase_3 1.63
PF00313CSD 1.63
PF11941DUF3459 1.63
PF13302Acetyltransf_3 1.63
PF04542Sigma70_r2 1.63
PF00583Acetyltransf_1 1.63
PF00582Usp 1.63
PF13305TetR_C_33 0.81
PF12710HAD 0.81
PF08818DUF1801 0.81
PF04264YceI 0.81
PF03992ABM 0.81
PF01638HxlR 0.81
PF13460NAD_binding_10 0.81
PF12900Pyridox_ox_2 0.81
PF08659KR 0.81
PF01212Beta_elim_lyase 0.81
PF04952AstE_AspA 0.81
PF00171Aldedh 0.81
PF08530PepX_C 0.81
PF02577BFN_dom 0.81
PF07992Pyr_redox_2 0.81
PF01593Amino_oxidase 0.81
PF00155Aminotran_1_2 0.81
PF11578DUF3237 0.81
PF07859Abhydrolase_3 0.81
PF04075F420H2_quin_red 0.81
PF12680SnoaL_2 0.81
PF01979Amidohydro_1 0.81
PF02567PhzC-PhzF 0.81
PF00860Xan_ur_permease 0.81
PF05368NmrA 0.81
PF00196GerE 0.81
PF06441EHN 0.81
PF02627CMD 0.81
PF00106adh_short 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.63
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.63
COG1167DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domainTranscription [K] 1.63
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.63
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.63
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.81
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.81
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.81
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.81
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.81
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.81
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.81
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.81
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.81
COG3033TryptophanaseAmino acid transport and metabolism [E] 0.81
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.81
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.81
COG4992Acetylornithine/succinyldiaminopimelate/putrescine aminotransferaseAmino acid transport and metabolism [E] 0.81
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.81
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.81
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 0.81
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.81
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.81
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.81
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.81
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.81
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.81
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.81
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.81
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.81
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.81
COG0384Predicted epimerase YddE/YHI9, PhzF superfamilyGeneral function prediction only [R] 0.81
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.81
COG0112Glycine/serine hydroxymethyltransferaseAmino acid transport and metabolism [E] 0.81
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.81
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.99 %
UnclassifiedrootN/A13.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005366|Ga0070659_100605894All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300005435|Ga0070714_101037336All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300005436|Ga0070713_100025762All Organisms → cellular organisms → Bacteria4604Open in IMG/M
3300005437|Ga0070710_10439050All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300005439|Ga0070711_101882277All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005458|Ga0070681_10168499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2112Open in IMG/M
3300005602|Ga0070762_10061473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2093Open in IMG/M
3300006791|Ga0066653_10358946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales740Open in IMG/M
3300006800|Ga0066660_10591918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia928Open in IMG/M
3300006804|Ga0079221_10687971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria709Open in IMG/M
3300009521|Ga0116222_1249034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria766Open in IMG/M
3300009553|Ga0105249_10478499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1288Open in IMG/M
3300009700|Ga0116217_10165775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Williamsia1468Open in IMG/M
3300009824|Ga0116219_10460474All Organisms → cellular organisms → Bacteria → Terrabacteria group706Open in IMG/M
3300010043|Ga0126380_10498594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii934Open in IMG/M
3300010360|Ga0126372_11541122Not Available702Open in IMG/M
3300010361|Ga0126378_11582052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii744Open in IMG/M
3300010376|Ga0126381_100914918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1263Open in IMG/M
3300010376|Ga0126381_103962256All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300010867|Ga0126347_1567325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii699Open in IMG/M
3300010868|Ga0124844_1298894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300010876|Ga0126361_10910176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1158Open in IMG/M
3300010880|Ga0126350_11895627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1437Open in IMG/M
3300012351|Ga0137386_10799396Not Available677Open in IMG/M
3300012481|Ga0157320_1025554All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012955|Ga0164298_10152497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1299Open in IMG/M
3300012957|Ga0164303_10380071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia865Open in IMG/M
3300013105|Ga0157369_10656768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1081Open in IMG/M
3300014968|Ga0157379_12662168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300015242|Ga0137412_10103770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2310Open in IMG/M
3300015242|Ga0137412_10546260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300015245|Ga0137409_10224965Not Available1678Open in IMG/M
3300016270|Ga0182036_10688853Not Available826Open in IMG/M
3300016294|Ga0182041_10599161All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300016294|Ga0182041_11032090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300016341|Ga0182035_10459880All Organisms → cellular organisms → Bacteria1080Open in IMG/M
3300016341|Ga0182035_10641005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium921Open in IMG/M
3300016341|Ga0182035_10846861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria804Open in IMG/M
3300016341|Ga0182035_12145026Not Available507Open in IMG/M
3300016357|Ga0182032_10010318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5013Open in IMG/M
3300016371|Ga0182034_11700323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia555Open in IMG/M
3300016445|Ga0182038_10724971All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300016445|Ga0182038_11559778All Organisms → cellular organisms → Bacteria → Terrabacteria group593Open in IMG/M
3300017821|Ga0187812_1262920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia549Open in IMG/M
3300017924|Ga0187820_1193288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia632Open in IMG/M
3300017972|Ga0187781_10823174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii674Open in IMG/M
3300017972|Ga0187781_11021772All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300017975|Ga0187782_11504151Not Available530Open in IMG/M
3300018047|Ga0187859_10347957All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300018085|Ga0187772_11089737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300018090|Ga0187770_11471557Not Available554Open in IMG/M
3300018090|Ga0187770_11595090All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300020580|Ga0210403_11128597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium mesophilum608Open in IMG/M
3300020581|Ga0210399_10335508All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300020581|Ga0210399_11000807Not Available673Open in IMG/M
3300021170|Ga0210400_10902009All Organisms → cellular organisms → Bacteria → Terrabacteria group722Open in IMG/M
3300021180|Ga0210396_11501076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927554Open in IMG/M
3300021403|Ga0210397_11297865Not Available565Open in IMG/M
3300021406|Ga0210386_10494312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis mediterranei1057Open in IMG/M
3300021432|Ga0210384_10879143Not Available796Open in IMG/M
3300021433|Ga0210391_11471117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii523Open in IMG/M
3300021474|Ga0210390_11273473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium canum591Open in IMG/M
3300021560|Ga0126371_12193372Not Available666Open in IMG/M
3300022557|Ga0212123_10606664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300025898|Ga0207692_10169284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1265Open in IMG/M
3300025898|Ga0207692_10252496All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae1057Open in IMG/M
3300025906|Ga0207699_10044424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2587Open in IMG/M
3300025912|Ga0207707_11473735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura540Open in IMG/M
3300025915|Ga0207693_10989434All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300025916|Ga0207663_10273180All Organisms → cellular organisms → Bacteria → Terrabacteria group1253Open in IMG/M
3300025916|Ga0207663_11405606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300025927|Ga0207687_11088417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia686Open in IMG/M
3300026041|Ga0207639_11009930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia779Open in IMG/M
3300027117|Ga0209732_1072660All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300027297|Ga0208241_1058795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis613Open in IMG/M
3300027826|Ga0209060_10561280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii517Open in IMG/M
3300027855|Ga0209693_10228175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae914Open in IMG/M
3300027884|Ga0209275_10072433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1709Open in IMG/M
3300027889|Ga0209380_10846733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium516Open in IMG/M
3300027905|Ga0209415_10089170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3475Open in IMG/M
3300028654|Ga0265322_10144576Not Available679Open in IMG/M
3300028715|Ga0307313_10127071Not Available782Open in IMG/M
3300028800|Ga0265338_10702893All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300028877|Ga0302235_10221840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria829Open in IMG/M
3300028879|Ga0302229_10345004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300029701|Ga0222748_1106806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae551Open in IMG/M
3300029999|Ga0311339_11893792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii514Open in IMG/M
3300030053|Ga0302177_10296358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria863Open in IMG/M
3300030058|Ga0302179_10378462All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300030503|Ga0311370_11963231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia586Open in IMG/M
3300030580|Ga0311355_11589655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii562Open in IMG/M
3300030855|Ga0075374_11290311All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300031525|Ga0302326_10154707All Organisms → cellular organisms → Bacteria3936Open in IMG/M
3300031543|Ga0318516_10230170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1072Open in IMG/M
3300031680|Ga0318574_10774255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300031708|Ga0310686_108756102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia519Open in IMG/M
3300031718|Ga0307474_11398326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii551Open in IMG/M
3300031718|Ga0307474_11503009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii530Open in IMG/M
3300031719|Ga0306917_11131577Not Available609Open in IMG/M
3300031724|Ga0318500_10568213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300031770|Ga0318521_10758278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300031797|Ga0318550_10341029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300031819|Ga0318568_10208130All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1207Open in IMG/M
3300031819|Ga0318568_10732394All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii614Open in IMG/M
3300031820|Ga0307473_11221992All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300031845|Ga0318511_10278422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia754Open in IMG/M
3300031845|Ga0318511_10366377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300031880|Ga0318544_10020913All Organisms → cellular organisms → Bacteria2195Open in IMG/M
3300031890|Ga0306925_10967551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora sera870Open in IMG/M
3300031897|Ga0318520_10833631All Organisms → cellular organisms → Bacteria → Terrabacteria group579Open in IMG/M
3300031912|Ga0306921_11865508Not Available644Open in IMG/M
3300031946|Ga0310910_10017718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4615Open in IMG/M
3300032008|Ga0318562_10206426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora sera1139Open in IMG/M
3300032043|Ga0318556_10098144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1480Open in IMG/M
3300032065|Ga0318513_10134094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1175Open in IMG/M
3300032074|Ga0308173_10376442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1243Open in IMG/M
3300032160|Ga0311301_12475675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii582Open in IMG/M
3300032515|Ga0348332_10914459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M
3300032805|Ga0335078_10307749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2126Open in IMG/M
3300032893|Ga0335069_11086004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii883Open in IMG/M
3300032898|Ga0335072_10090709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales3937Open in IMG/M
3300033134|Ga0335073_11728302All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300033158|Ga0335077_12135179Not Available516Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.32%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.06%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.25%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.44%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil2.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.63%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.63%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.81%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.81%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.81%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012481Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610Host-AssociatedOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027117Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028654Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaGHost-AssociatedOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030053Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070659_10060589423300005366Corn RhizosphereMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEELGATVLV
Ga0070714_10103733633300005435Agricultural SoilMSLYMYQASYTAKSMAAQLTDPHDPMEAIRPTLTEVGATIVV
Ga0070713_10002576263300005436Corn, Switchgrass And Miscanthus RhizosphereMALYMYQASYTARSMAAQIQEPQDPVETISAALEDVGATMVVAAF
Ga0070710_1043905013300005437Corn, Switchgrass And Miscanthus RhizosphereMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEDLGATILVA
Ga0070711_10188227713300005439Corn, Switchgrass And Miscanthus RhizosphereMAARGGISMTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELGA
Ga0070681_1016849943300005458Corn RhizosphereMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEELGATVLVAG
Ga0070762_1006147313300005602SoilMTLYMYQASYTAKSMAAQLTDPHDPMEAIQPTMQEL
Ga0066653_1035894623300006791SoilMTLYMYQASYTAKSMAAQLTEPHDPVEAIGPTLEDLGATIVVAGFPFG*
Ga0066660_1059191823300006800SoilMTLYMYQASYTAKSMAAQLTEPHDPMETIGPVLADLGAKVVVAGFPFG
Ga0079221_1068797113300006804Agricultural SoilMTIYMYQASYTAKSMAAQLTEPHDPMEAISPVLEELGAKVLVAGFPF
Ga0116222_124903413300009521Peatlands SoilMALYMYQASYTAKSMAAQLKDPQDPVDAIRSALEDVGATIVVAGFP
Ga0105249_1047849913300009553Switchgrass RhizosphereMAARGGISMTLYMYQASYTAKSMAAQLTDPHDPMEAI
Ga0116217_1016577513300009700Peatlands SoilMTLYMYQASYTAKSMAAQLKDPQDPVEAIRPALEDL
Ga0116219_1046047413300009824Peatlands SoilMTLYMYQASYTAKSMAAQLTEPHDPMEAIRPVLEDLGATIVVAGF
Ga0126380_1049859413300010043Tropical Forest SoilMTLYMYQASYTAKSMAAQLTDPHDPLEEITPILEELGAT
Ga0126372_1154112223300010360Tropical Forest SoilMALYMYQASYTAKSMAAQLTEPQDPVEAFRPTLEDLGAKIVVA
Ga0126378_1158205213300010361Tropical Forest SoilMTLYMYQASYTAKSMAAQLKEPQDPVEVIRPTMDELGAKIM
Ga0126381_10091491823300010376Tropical Forest SoilMALYMYQASYTAKSMAAQLTEPKDPVEAIRQALEELGATMVVAGFPF
Ga0126381_10396225613300010376Tropical Forest SoilMALYMYQASYTARSMAAQIQEPQDPVEAISAALEDVGAKIVVAAFP
Ga0126347_156732513300010867Boreal Forest SoilMPLFMYQASYTAKSMAAQLKDPQDPEEAITSALEDLGATIVVA
Ga0124844_129889413300010868Tropical Forest SoilMALYMYQASYTAKSMAAQIKEPQDPVEAFRPTLEDLGV*
Ga0126361_1091017633300010876Boreal Forest SoilMTLYMYQASYTAKSMAAQLQEPHDPMEAIRPTLEDL
Ga0126350_1189562713300010880Boreal Forest SoilMALYMYQASYTAKSMAAQLKEPQDPAEAIRSALEDVGAELVVAA
Ga0137386_1079939623300012351Vadose Zone SoilMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEDLGATIVVA
Ga0157320_102555413300012481Arabidopsis RhizosphereMTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELGATILVAGFP
Ga0164298_1015249713300012955SoilMAARGGISMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEELGATVLVA
Ga0164303_1038007123300012957SoilMAARGGIAMTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELG
Ga0157369_1065676813300013105Corn RhizosphereLSRDAYLREGSMTLYMYQASYTAKSMAAQLTDPHDPMEAIRPTLTEVGATIVVAG
Ga0157379_1266216823300014968Switchgrass RhizosphereMASRGGISMTLYMYQASYTAKSMAAQLTEPHDPMEAIG
Ga0137412_1010377033300015242Vadose Zone SoilMTLYMYQASYTAKSMAAQLTEPHDPMEAIRPALEEL
Ga0137412_1054626013300015242Vadose Zone SoilMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEDLGATILVAGFPF
Ga0137409_1022496543300015245Vadose Zone SoilMALYMYQASYTAKSMAAQLNEPEDPVEAIRSALEDV
Ga0182036_1068885313300016270SoilMALYMYQASYTAKSMAAQLAEPQDPVEAIRPALEDVGATLLVAGFP
Ga0182041_1059916113300016294SoilMALYMYQASYTAKSMAAQLKGPKDPVEAIRLTLEDLGATILVAGFPFG
Ga0182041_1103209023300016294SoilMALYMYQASYTATSMAAQLTEPRDPVDVIRPALEELGAKIVV
Ga0182035_1045988013300016341SoilMTIYMYQASYTARSMAAQLKEPQDPVEAIRPTLEELGAKILVAGFPF
Ga0182035_1064100513300016341SoilMPLFMYQASYTAKSMADQLKEPQDPVEVIRPALEELGATIVVAGFP
Ga0182035_1084686113300016341SoilMTFYMYQASYTAKSMAAQLKEPQDPVEAFSPTLEELGAKILVAGFP
Ga0182035_1214502623300016341SoilMALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDVGA
Ga0182032_1001031813300016357SoilMALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDVGAQLL
Ga0182034_1170032313300016371SoilMALYMYQASYTAKSMAAQLKEPQDPVEAFSPTLEELGAKILVA
Ga0182038_1072497123300016445SoilMALYMYQASYTAKSMAAQLEEPQDPVEAIRPTLDDLGAKILVAGFPFG
Ga0182038_1155977813300016445SoilMALYMYQASYTAKSMAAQLTEPQDPVEAIRPALEDVGATLLVAGFP
Ga0187812_126292013300017821Freshwater SedimentMALYMYQASYTAKSMAAQLREPQDPVEAIRPALEDVGAKILVAGFPF
Ga0187820_119328813300017924Freshwater SedimentMALYMYQASYTAKSMAAQLQDPHDPMEAIGPTLEDLGATLVVA
Ga0187781_1082317423300017972Tropical PeatlandMALYMYQASYTAKSMAAQLREPQDPVEMIRSTLEDLG
Ga0187781_1102177223300017972Tropical PeatlandMALYMYQASYTAKSMAAQLKEPRDPVEVIRPTLED
Ga0187782_1150415123300017975Tropical PeatlandMALYMYQASYTAKSMAAQLKEPRDPMEAIRPSLEDLGA
Ga0187859_1034795723300018047PeatlandMALYMYQASYTAKSMAAQLKEPEDPVESIRSALEDVGAEL
Ga0187772_1108973713300018085Tropical PeatlandMALYMYQASYTAKSMAAQLQEPRDPMEAIRPTLEDLGAKLLVA
Ga0187770_1147155713300018090Tropical PeatlandMTLYMYQASYTAKSMAAQLKEPHDPVEAIRPTLADLGAEII
Ga0187770_1159509013300018090Tropical PeatlandMALYMYQASYTAKSMAAQLKEPRDPVEAFRPTLEELGAKILVA
Ga0210403_1112859723300020580SoilMALYMYQASYTAKSMAAQLKEPQDPAEAIRSALEDVG
Ga0210399_1033550813300020581SoilMALYMYQASYSARSMAAQLKEPQDPVEAIRPTLEDLGAKMVVAGFPF
Ga0210399_1100080723300020581SoilMALYMYQASYTAKSMAAQLTKPQNPVEVIRPALED
Ga0210400_1090200923300021170SoilMALYMYQASYTAKSMAAQLKEPQDPAEAIRSALEDVGAEL
Ga0210396_1150107623300021180SoilMALYMYQASYTSKSMAAQLKEPQDPLEAIRPVLED
Ga0210397_1129786513300021403SoilMALYMYQASYSARSMAAQLKEPQDPVEAIRPTLEDLGA
Ga0210386_1049431233300021406SoilMPLFMYQASYTAKSMAAQLKDPKDPEEAISSALEDLGAS
Ga0210384_1087914313300021432SoilMALYMYQASYTARSMAAQLKEPQDPVEAIRPTLEDLGAKM
Ga0210391_1147111713300021433SoilMALYMYQASYTAKSMAAQLKDPEDPVEAIRTALEEV
Ga0210390_1127347313300021474SoilMTLYMYQASYTAKSMAAQLTDPHDPMEAIQPTMQELGATILVAGF
Ga0126371_1219337223300021560Tropical Forest SoilMTLYMYQASYTARSMAAQLKEPQDPVEAIKPTLEDLGA
Ga0212123_1060666423300022557Iron-Sulfur Acid SpringMTLYMYQASYTAKSMAAQLKEPQDPVETIRPTLEELGAKI
Ga0207692_1016928413300025898Corn, Switchgrass And Miscanthus RhizosphereMTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLAEL
Ga0207692_1025249613300025898Corn, Switchgrass And Miscanthus RhizosphereMTLYMYQASYTAKSMAAQLTEPHDPMEAIRPTLEELGAKVLVAGFPFG
Ga0207699_1004442463300025906Corn, Switchgrass And Miscanthus RhizosphereMTLYMYQASYTAKSMAAQLTEPHDPMEAIAPTLEE
Ga0207707_1147373523300025912Corn RhizosphereMTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELGARV
Ga0207693_1098943423300025915Corn, Switchgrass And Miscanthus RhizosphereLALYMYQASYTARSMAAQIAEPQDPVETISTALEDVGAKMVVAAFPF
Ga0207663_1027318013300025916Corn, Switchgrass And Miscanthus RhizosphereMTLYMYQASYTAKSMAAQLTDPHDPMDTIGPTLTDV
Ga0207663_1140560623300025916Corn, Switchgrass And Miscanthus RhizosphereMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEDLGATILVAGFP
Ga0207687_1108841723300025927Miscanthus RhizosphereMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEEL
Ga0207639_1100993013300026041Corn RhizosphereMTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELGATVLVA
Ga0209732_107266023300027117Forest SoilMALYMYQASYTAKSMAAQLKDPKDPVEAIGTALEDVGAEIVVAAFP
Ga0208241_105879523300027297Forest SoilVALYMYQASYTAKSMAAQLKDPEDPVDAIRSALEDVGA
Ga0209060_1056128013300027826Surface SoilMALYMYQASYTAKSMAAQLTDPQDPVELITPALEDL
Ga0209693_1022817523300027855SoilMTLYMYQASYTAKSMAAQLTDPHDPMEAIQPTMQELGATILVAGFPFGEY
Ga0209275_1007243333300027884SoilMTLYMYQASYTAKSMAAQLTDPHDPMEAIQPTMQELGATI
Ga0209380_1084673323300027889SoilMALYMYQASYTAKSMAAQLTEPRDPVEAMRSALEDLGAEIVVAGFPFGE
Ga0209415_1008917043300027905Peatlands SoilMALYMYQASYTAKSMAAQLKEPEDPVEAIRSALDDVGAELVVAGFPF
Ga0265322_1014457613300028654RhizosphereMALYMYQASYTAKSMAAQIQEPQDPVETISAALEDV
Ga0307313_1012707123300028715SoilMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTMEDLGATIVVAGF
Ga0265338_1070289313300028800RhizosphereMALYMYQASYTAKSMAAQIQEPQDPVETISAALEDVGAKIVVAAF
Ga0302235_1022184023300028877PalsaMARYMYQASYTSKSMAAQLREPQDPVEAISPVLEDLGATLLVAG
Ga0302229_1034500423300028879PalsaMALYMYQASYTAKSMAAQLKEPQDPVEAIRSALEDVGAE
Ga0222748_110680613300029701SoilMALYMYQASYTAKSMAAQLKEPEDPAEAIRSALEEVGATLL
Ga0311339_1189379223300029999PalsaMALYMYQASYTAKSMAAQLKEPQDPVEAIRSALEDVGAELVVTGFPF
Ga0302177_1029635833300030053PalsaMALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEELGAEIVVAGFP
Ga0302179_1037846223300030058PalsaMALYMYQASYTSKSMAAQLKEPQDPMEAIRPVLEDLGAKI
Ga0311370_1196323123300030503PalsaMALYMYQASYTAKSMAAQLNEPEDPAEAIRSALEDVGAELLVA
Ga0311355_1158965513300030580PalsaMALYMYQASYTAKSMAAQLQEPQDPVEAIRPTLEDLGATM
Ga0075374_1129031123300030855SoilMALYMYQASYSARSMAAQLKEPQDPVEAIRPTLEDLGAK
Ga0302326_1015470713300031525PalsaMARYMYQASYTSKSMAAQLREPQDPVEAISPVLEDLGATLLV
Ga0318516_1023017013300031543SoilMTLYMYQASYTAKSMAAQLTEPHDPMEAIRPTLDELGATIVV
Ga0318574_1077425513300031680SoilMTLYMYQASYTAKSMAAQLKEPQDPVEAFSPTLEELGAKILVAGFPFG
Ga0310686_10875610223300031708SoilMALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDLGA
Ga0307474_1139832613300031718Hardwood Forest SoilMALYMYQASYTARSMAAQLKEPQDPVEAIRPTLQDLGAKMVVAGF
Ga0307474_1150300913300031718Hardwood Forest SoilMALYMYQASYTAKSMAAQLTEPKDPVEAIRPTLEDLG
Ga0306917_1113157723300031719SoilMTLYMYQASYTARSMAAQLKEPHDPVEAIRPTLQDLGAKIVVAGFPFG
Ga0318500_1056821323300031724SoilMTFYMYQASYTAKSMAAQLKDPQDPVEAITPALEELGAKIVV
Ga0318521_1075827813300031770SoilMALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDVGAKILVAGFP
Ga0318550_1034102933300031797SoilMTFYMYQASYTAKSMAAQLKDPQDPVEAITPALEELGAKIVVAGFP
Ga0318568_1020813013300031819SoilMPLFMYQASYTAKSMADQLKEPQDPVEVIRPALEEL
Ga0318568_1073239413300031819SoilMALYMYQASYTAKSMAAQLKDPQDPVEAIKPTLEELGATIM
Ga0307473_1122199223300031820Hardwood Forest SoilMTLYMYQASYTAKSMAAQLKEPRDPAEAIRPALEDLGAEILVA
Ga0318511_1027842223300031845SoilMALYMYQASYTATSMAAQLTEPRDPVDVIRPALEELG
Ga0318511_1036637723300031845SoilMTFYMYQASYTAKSMAAQLKDPQDPVEAITPALEELGAKIVVAG
Ga0318544_1002091323300031880SoilMALYMYQASYTAKSMAAQLKEPQDPVEAIRPALED
Ga0306925_1096755133300031890SoilMAMYMYQASYTAKSMASQIKEPQDPVEAIMPALEDVGAKILVA
Ga0318520_1083363113300031897SoilMALYMYQASYTAKSMAAQLTEPQDPVEAIRPALEDVG
Ga0306921_1186550823300031912SoilMALYMYQASYTAKSMAAQLTEPQDPVEVIRPTLEELGAKMLV
Ga0310910_1001771853300031946SoilMALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDVGAQLLVA
Ga0318562_1020642643300032008SoilMAMYMYQASYTAKSMASQIKEPQDPVEAIMPALEDV
Ga0318556_1009814413300032043SoilMPLFMYQASYTAKSMADQLKKPQDPVEVIRPALEELGATIVVAGFPFG
Ga0318513_1013409433300032065SoilMTLYMYQASYTARSMAAQLKEPQDPVEAFKPTLEDLGAK
Ga0308173_1037644223300032074SoilMTIYMYQASYTAKSMAAQLTEPHDPMEAIGPVLEELEA
Ga0311301_1247567523300032160Peatlands SoilMALYMYQASYTAKSMAAQLKEPQDPVEAIRPTLEDL
Ga0348332_1091445923300032515Plant LitterMALYMYQASYTAKSMAAQLKDPEDPVDAIRTALADVGA
Ga0335078_1030774943300032805SoilMTLYMYQASYTAKSMAAQIKQPQDPLEVIRPTLEDLGA
Ga0335069_1108600423300032893SoilMTLYMYQASYTAKSMAAQLKEPHDPVEVFRPTLEELGAKILVAGFP
Ga0335072_1009070933300032898SoilMALYMYQASYTAKSMAAQLTEPQDPVEVIRPALEDVGAKI
Ga0335073_1172830213300033134SoilMALYMYQASYTARSMAAQIAEPQDPVEAISAALEDV
Ga0335077_1213517913300033158SoilMALYMYQASYTAKSMAAQLTDPHDPSEAIRSALEDM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.