| Basic Information | |
|---|---|
| Family ID | F069948 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDLGA |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.12 % |
| % of genes near scaffold ends (potentially truncated) | 98.37 % |
| % of genes from short scaffolds (< 2000 bps) | 90.24 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.179 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.951 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.033 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.42% β-sheet: 0.00% Coil/Unstructured: 57.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF08281 | Sigma70_r4_2 | 3.25 |
| PF00378 | ECH_1 | 2.44 |
| PF13229 | Beta_helix | 1.63 |
| PF12697 | Abhydrolase_6 | 1.63 |
| PF00753 | Lactamase_B | 1.63 |
| PF01764 | Lipase_3 | 1.63 |
| PF00313 | CSD | 1.63 |
| PF11941 | DUF3459 | 1.63 |
| PF13302 | Acetyltransf_3 | 1.63 |
| PF04542 | Sigma70_r2 | 1.63 |
| PF00583 | Acetyltransf_1 | 1.63 |
| PF00582 | Usp | 1.63 |
| PF13305 | TetR_C_33 | 0.81 |
| PF12710 | HAD | 0.81 |
| PF08818 | DUF1801 | 0.81 |
| PF04264 | YceI | 0.81 |
| PF03992 | ABM | 0.81 |
| PF01638 | HxlR | 0.81 |
| PF13460 | NAD_binding_10 | 0.81 |
| PF12900 | Pyridox_ox_2 | 0.81 |
| PF08659 | KR | 0.81 |
| PF01212 | Beta_elim_lyase | 0.81 |
| PF04952 | AstE_AspA | 0.81 |
| PF00171 | Aldedh | 0.81 |
| PF08530 | PepX_C | 0.81 |
| PF02577 | BFN_dom | 0.81 |
| PF07992 | Pyr_redox_2 | 0.81 |
| PF01593 | Amino_oxidase | 0.81 |
| PF00155 | Aminotran_1_2 | 0.81 |
| PF11578 | DUF3237 | 0.81 |
| PF07859 | Abhydrolase_3 | 0.81 |
| PF04075 | F420H2_quin_red | 0.81 |
| PF12680 | SnoaL_2 | 0.81 |
| PF01979 | Amidohydro_1 | 0.81 |
| PF02567 | PhzC-PhzF | 0.81 |
| PF00860 | Xan_ur_permease | 0.81 |
| PF05368 | NmrA | 0.81 |
| PF00196 | GerE | 0.81 |
| PF06441 | EHN | 0.81 |
| PF02627 | CMD | 0.81 |
| PF00106 | adh_short | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.63 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.63 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.63 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.63 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.63 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.81 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.81 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.81 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.81 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.81 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.81 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.81 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.81 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.81 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.81 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.81 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.81 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.81 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.81 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.81 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.81 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.81 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.81 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.81 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.81 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.81 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.81 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.81 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.81 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.81 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.81 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.99 % |
| Unclassified | root | N/A | 13.01 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005366|Ga0070659_100605894 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300005435|Ga0070714_101037336 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005436|Ga0070713_100025762 | All Organisms → cellular organisms → Bacteria | 4604 | Open in IMG/M |
| 3300005437|Ga0070710_10439050 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005439|Ga0070711_101882277 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005458|Ga0070681_10168499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2112 | Open in IMG/M |
| 3300005602|Ga0070762_10061473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2093 | Open in IMG/M |
| 3300006791|Ga0066653_10358946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 740 | Open in IMG/M |
| 3300006800|Ga0066660_10591918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 928 | Open in IMG/M |
| 3300006804|Ga0079221_10687971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 709 | Open in IMG/M |
| 3300009521|Ga0116222_1249034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 766 | Open in IMG/M |
| 3300009553|Ga0105249_10478499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1288 | Open in IMG/M |
| 3300009700|Ga0116217_10165775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Williamsia | 1468 | Open in IMG/M |
| 3300009824|Ga0116219_10460474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 706 | Open in IMG/M |
| 3300010043|Ga0126380_10498594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 934 | Open in IMG/M |
| 3300010360|Ga0126372_11541122 | Not Available | 702 | Open in IMG/M |
| 3300010361|Ga0126378_11582052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 744 | Open in IMG/M |
| 3300010376|Ga0126381_100914918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1263 | Open in IMG/M |
| 3300010376|Ga0126381_103962256 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010867|Ga0126347_1567325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 699 | Open in IMG/M |
| 3300010868|Ga0124844_1298894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300010876|Ga0126361_10910176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1158 | Open in IMG/M |
| 3300010880|Ga0126350_11895627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1437 | Open in IMG/M |
| 3300012351|Ga0137386_10799396 | Not Available | 677 | Open in IMG/M |
| 3300012481|Ga0157320_1025554 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300012955|Ga0164298_10152497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1299 | Open in IMG/M |
| 3300012957|Ga0164303_10380071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 865 | Open in IMG/M |
| 3300013105|Ga0157369_10656768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1081 | Open in IMG/M |
| 3300014968|Ga0157379_12662168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 501 | Open in IMG/M |
| 3300015242|Ga0137412_10103770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2310 | Open in IMG/M |
| 3300015242|Ga0137412_10546260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 882 | Open in IMG/M |
| 3300015245|Ga0137409_10224965 | Not Available | 1678 | Open in IMG/M |
| 3300016270|Ga0182036_10688853 | Not Available | 826 | Open in IMG/M |
| 3300016294|Ga0182041_10599161 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300016294|Ga0182041_11032090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300016341|Ga0182035_10459880 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300016341|Ga0182035_10641005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 921 | Open in IMG/M |
| 3300016341|Ga0182035_10846861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 804 | Open in IMG/M |
| 3300016341|Ga0182035_12145026 | Not Available | 507 | Open in IMG/M |
| 3300016357|Ga0182032_10010318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5013 | Open in IMG/M |
| 3300016371|Ga0182034_11700323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300016445|Ga0182038_10724971 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300016445|Ga0182038_11559778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 593 | Open in IMG/M |
| 3300017821|Ga0187812_1262920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 549 | Open in IMG/M |
| 3300017924|Ga0187820_1193288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
| 3300017972|Ga0187781_10823174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 674 | Open in IMG/M |
| 3300017972|Ga0187781_11021772 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300017975|Ga0187782_11504151 | Not Available | 530 | Open in IMG/M |
| 3300018047|Ga0187859_10347957 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300018085|Ga0187772_11089737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300018090|Ga0187770_11471557 | Not Available | 554 | Open in IMG/M |
| 3300018090|Ga0187770_11595090 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300020580|Ga0210403_11128597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Planosporangium → Planosporangium mesophilum | 608 | Open in IMG/M |
| 3300020581|Ga0210399_10335508 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300020581|Ga0210399_11000807 | Not Available | 673 | Open in IMG/M |
| 3300021170|Ga0210400_10902009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300021180|Ga0210396_11501076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → unclassified Reyranella → Reyranella sp. CPCC 100927 | 554 | Open in IMG/M |
| 3300021403|Ga0210397_11297865 | Not Available | 565 | Open in IMG/M |
| 3300021406|Ga0210386_10494312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis mediterranei | 1057 | Open in IMG/M |
| 3300021432|Ga0210384_10879143 | Not Available | 796 | Open in IMG/M |
| 3300021433|Ga0210391_11471117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 523 | Open in IMG/M |
| 3300021474|Ga0210390_11273473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium canum | 591 | Open in IMG/M |
| 3300021560|Ga0126371_12193372 | Not Available | 666 | Open in IMG/M |
| 3300022557|Ga0212123_10606664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300025898|Ga0207692_10169284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1265 | Open in IMG/M |
| 3300025898|Ga0207692_10252496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 1057 | Open in IMG/M |
| 3300025906|Ga0207699_10044424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2587 | Open in IMG/M |
| 3300025912|Ga0207707_11473735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 540 | Open in IMG/M |
| 3300025915|Ga0207693_10989434 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300025916|Ga0207663_10273180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1253 | Open in IMG/M |
| 3300025916|Ga0207663_11405606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
| 3300025927|Ga0207687_11088417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 686 | Open in IMG/M |
| 3300026041|Ga0207639_11009930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 779 | Open in IMG/M |
| 3300027117|Ga0209732_1072660 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300027297|Ga0208241_1058795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Ilumatobacteraceae → Ilumatobacter → Ilumatobacter nonamiensis | 613 | Open in IMG/M |
| 3300027826|Ga0209060_10561280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 517 | Open in IMG/M |
| 3300027855|Ga0209693_10228175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 914 | Open in IMG/M |
| 3300027884|Ga0209275_10072433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1709 | Open in IMG/M |
| 3300027889|Ga0209380_10846733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300027905|Ga0209415_10089170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3475 | Open in IMG/M |
| 3300028654|Ga0265322_10144576 | Not Available | 679 | Open in IMG/M |
| 3300028715|Ga0307313_10127071 | Not Available | 782 | Open in IMG/M |
| 3300028800|Ga0265338_10702893 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300028877|Ga0302235_10221840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300028879|Ga0302229_10345004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300029701|Ga0222748_1106806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 551 | Open in IMG/M |
| 3300029999|Ga0311339_11893792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 514 | Open in IMG/M |
| 3300030053|Ga0302177_10296358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
| 3300030058|Ga0302179_10378462 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300030503|Ga0311370_11963231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300030580|Ga0311355_11589655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 562 | Open in IMG/M |
| 3300030855|Ga0075374_11290311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300031525|Ga0302326_10154707 | All Organisms → cellular organisms → Bacteria | 3936 | Open in IMG/M |
| 3300031543|Ga0318516_10230170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1072 | Open in IMG/M |
| 3300031680|Ga0318574_10774255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
| 3300031708|Ga0310686_108756102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300031718|Ga0307474_11398326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 551 | Open in IMG/M |
| 3300031718|Ga0307474_11503009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 530 | Open in IMG/M |
| 3300031719|Ga0306917_11131577 | Not Available | 609 | Open in IMG/M |
| 3300031724|Ga0318500_10568213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 573 | Open in IMG/M |
| 3300031770|Ga0318521_10758278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300031797|Ga0318550_10341029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300031819|Ga0318568_10208130 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 1207 | Open in IMG/M |
| 3300031819|Ga0318568_10732394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 614 | Open in IMG/M |
| 3300031820|Ga0307473_11221992 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031845|Ga0318511_10278422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
| 3300031845|Ga0318511_10366377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300031880|Ga0318544_10020913 | All Organisms → cellular organisms → Bacteria | 2195 | Open in IMG/M |
| 3300031890|Ga0306925_10967551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora sera | 870 | Open in IMG/M |
| 3300031897|Ga0318520_10833631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 579 | Open in IMG/M |
| 3300031912|Ga0306921_11865508 | Not Available | 644 | Open in IMG/M |
| 3300031946|Ga0310910_10017718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4615 | Open in IMG/M |
| 3300032008|Ga0318562_10206426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora sera | 1139 | Open in IMG/M |
| 3300032043|Ga0318556_10098144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1480 | Open in IMG/M |
| 3300032065|Ga0318513_10134094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1175 | Open in IMG/M |
| 3300032074|Ga0308173_10376442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1243 | Open in IMG/M |
| 3300032160|Ga0311301_12475675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 582 | Open in IMG/M |
| 3300032515|Ga0348332_10914459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 596 | Open in IMG/M |
| 3300032805|Ga0335078_10307749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2126 | Open in IMG/M |
| 3300032893|Ga0335069_11086004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 883 | Open in IMG/M |
| 3300032898|Ga0335072_10090709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3937 | Open in IMG/M |
| 3300033134|Ga0335073_11728302 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300033158|Ga0335077_12135179 | Not Available | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.32% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.88% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.44% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.63% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027117 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030855 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070659_1006058942 | 3300005366 | Corn Rhizosphere | MTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEELGATVLV |
| Ga0070714_1010373363 | 3300005435 | Agricultural Soil | MSLYMYQASYTAKSMAAQLTDPHDPMEAIRPTLTEVGATIVV |
| Ga0070713_1000257626 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MALYMYQASYTARSMAAQIQEPQDPVETISAALEDVGATMVVAAF |
| Ga0070710_104390501 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEDLGATILVA |
| Ga0070711_1018822771 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAARGGISMTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELGA |
| Ga0070681_101684994 | 3300005458 | Corn Rhizosphere | MTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEELGATVLVAG |
| Ga0070762_100614731 | 3300005602 | Soil | MTLYMYQASYTAKSMAAQLTDPHDPMEAIQPTMQEL |
| Ga0066653_103589462 | 3300006791 | Soil | MTLYMYQASYTAKSMAAQLTEPHDPVEAIGPTLEDLGATIVVAGFPFG* |
| Ga0066660_105919182 | 3300006800 | Soil | MTLYMYQASYTAKSMAAQLTEPHDPMETIGPVLADLGAKVVVAGFPFG |
| Ga0079221_106879711 | 3300006804 | Agricultural Soil | MTIYMYQASYTAKSMAAQLTEPHDPMEAISPVLEELGAKVLVAGFPF |
| Ga0116222_12490341 | 3300009521 | Peatlands Soil | MALYMYQASYTAKSMAAQLKDPQDPVDAIRSALEDVGATIVVAGFP |
| Ga0105249_104784991 | 3300009553 | Switchgrass Rhizosphere | MAARGGISMTLYMYQASYTAKSMAAQLTDPHDPMEAI |
| Ga0116217_101657751 | 3300009700 | Peatlands Soil | MTLYMYQASYTAKSMAAQLKDPQDPVEAIRPALEDL |
| Ga0116219_104604741 | 3300009824 | Peatlands Soil | MTLYMYQASYTAKSMAAQLTEPHDPMEAIRPVLEDLGATIVVAGF |
| Ga0126380_104985941 | 3300010043 | Tropical Forest Soil | MTLYMYQASYTAKSMAAQLTDPHDPLEEITPILEELGAT |
| Ga0126372_115411222 | 3300010360 | Tropical Forest Soil | MALYMYQASYTAKSMAAQLTEPQDPVEAFRPTLEDLGAKIVVA |
| Ga0126378_115820521 | 3300010361 | Tropical Forest Soil | MTLYMYQASYTAKSMAAQLKEPQDPVEVIRPTMDELGAKIM |
| Ga0126381_1009149182 | 3300010376 | Tropical Forest Soil | MALYMYQASYTAKSMAAQLTEPKDPVEAIRQALEELGATMVVAGFPF |
| Ga0126381_1039622561 | 3300010376 | Tropical Forest Soil | MALYMYQASYTARSMAAQIQEPQDPVEAISAALEDVGAKIVVAAFP |
| Ga0126347_15673251 | 3300010867 | Boreal Forest Soil | MPLFMYQASYTAKSMAAQLKDPQDPEEAITSALEDLGATIVVA |
| Ga0124844_12988941 | 3300010868 | Tropical Forest Soil | MALYMYQASYTAKSMAAQIKEPQDPVEAFRPTLEDLGV* |
| Ga0126361_109101763 | 3300010876 | Boreal Forest Soil | MTLYMYQASYTAKSMAAQLQEPHDPMEAIRPTLEDL |
| Ga0126350_118956271 | 3300010880 | Boreal Forest Soil | MALYMYQASYTAKSMAAQLKEPQDPAEAIRSALEDVGAELVVAA |
| Ga0137386_107993962 | 3300012351 | Vadose Zone Soil | MTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEDLGATIVVA |
| Ga0157320_10255541 | 3300012481 | Arabidopsis Rhizosphere | MTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELGATILVAGFP |
| Ga0164298_101524971 | 3300012955 | Soil | MAARGGISMTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEELGATVLVA |
| Ga0164303_103800712 | 3300012957 | Soil | MAARGGIAMTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELG |
| Ga0157369_106567681 | 3300013105 | Corn Rhizosphere | LSRDAYLREGSMTLYMYQASYTAKSMAAQLTDPHDPMEAIRPTLTEVGATIVVAG |
| Ga0157379_126621682 | 3300014968 | Switchgrass Rhizosphere | MASRGGISMTLYMYQASYTAKSMAAQLTEPHDPMEAIG |
| Ga0137412_101037703 | 3300015242 | Vadose Zone Soil | MTLYMYQASYTAKSMAAQLTEPHDPMEAIRPALEEL |
| Ga0137412_105462601 | 3300015242 | Vadose Zone Soil | MTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEDLGATILVAGFPF |
| Ga0137409_102249654 | 3300015245 | Vadose Zone Soil | MALYMYQASYTAKSMAAQLNEPEDPVEAIRSALEDV |
| Ga0182036_106888531 | 3300016270 | Soil | MALYMYQASYTAKSMAAQLAEPQDPVEAIRPALEDVGATLLVAGFP |
| Ga0182041_105991611 | 3300016294 | Soil | MALYMYQASYTAKSMAAQLKGPKDPVEAIRLTLEDLGATILVAGFPFG |
| Ga0182041_110320902 | 3300016294 | Soil | MALYMYQASYTATSMAAQLTEPRDPVDVIRPALEELGAKIVV |
| Ga0182035_104598801 | 3300016341 | Soil | MTIYMYQASYTARSMAAQLKEPQDPVEAIRPTLEELGAKILVAGFPF |
| Ga0182035_106410051 | 3300016341 | Soil | MPLFMYQASYTAKSMADQLKEPQDPVEVIRPALEELGATIVVAGFP |
| Ga0182035_108468611 | 3300016341 | Soil | MTFYMYQASYTAKSMAAQLKEPQDPVEAFSPTLEELGAKILVAGFP |
| Ga0182035_121450262 | 3300016341 | Soil | MALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDVGA |
| Ga0182032_100103181 | 3300016357 | Soil | MALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDVGAQLL |
| Ga0182034_117003231 | 3300016371 | Soil | MALYMYQASYTAKSMAAQLKEPQDPVEAFSPTLEELGAKILVA |
| Ga0182038_107249712 | 3300016445 | Soil | MALYMYQASYTAKSMAAQLEEPQDPVEAIRPTLDDLGAKILVAGFPFG |
| Ga0182038_115597781 | 3300016445 | Soil | MALYMYQASYTAKSMAAQLTEPQDPVEAIRPALEDVGATLLVAGFP |
| Ga0187812_12629201 | 3300017821 | Freshwater Sediment | MALYMYQASYTAKSMAAQLREPQDPVEAIRPALEDVGAKILVAGFPF |
| Ga0187820_11932881 | 3300017924 | Freshwater Sediment | MALYMYQASYTAKSMAAQLQDPHDPMEAIGPTLEDLGATLVVA |
| Ga0187781_108231742 | 3300017972 | Tropical Peatland | MALYMYQASYTAKSMAAQLREPQDPVEMIRSTLEDLG |
| Ga0187781_110217722 | 3300017972 | Tropical Peatland | MALYMYQASYTAKSMAAQLKEPRDPVEVIRPTLED |
| Ga0187782_115041512 | 3300017975 | Tropical Peatland | MALYMYQASYTAKSMAAQLKEPRDPMEAIRPSLEDLGA |
| Ga0187859_103479572 | 3300018047 | Peatland | MALYMYQASYTAKSMAAQLKEPEDPVESIRSALEDVGAEL |
| Ga0187772_110897371 | 3300018085 | Tropical Peatland | MALYMYQASYTAKSMAAQLQEPRDPMEAIRPTLEDLGAKLLVA |
| Ga0187770_114715571 | 3300018090 | Tropical Peatland | MTLYMYQASYTAKSMAAQLKEPHDPVEAIRPTLADLGAEII |
| Ga0187770_115950901 | 3300018090 | Tropical Peatland | MALYMYQASYTAKSMAAQLKEPRDPVEAFRPTLEELGAKILVA |
| Ga0210403_111285972 | 3300020580 | Soil | MALYMYQASYTAKSMAAQLKEPQDPAEAIRSALEDVG |
| Ga0210399_103355081 | 3300020581 | Soil | MALYMYQASYSARSMAAQLKEPQDPVEAIRPTLEDLGAKMVVAGFPF |
| Ga0210399_110008072 | 3300020581 | Soil | MALYMYQASYTAKSMAAQLTKPQNPVEVIRPALED |
| Ga0210400_109020092 | 3300021170 | Soil | MALYMYQASYTAKSMAAQLKEPQDPAEAIRSALEDVGAEL |
| Ga0210396_115010762 | 3300021180 | Soil | MALYMYQASYTSKSMAAQLKEPQDPLEAIRPVLED |
| Ga0210397_112978651 | 3300021403 | Soil | MALYMYQASYSARSMAAQLKEPQDPVEAIRPTLEDLGA |
| Ga0210386_104943123 | 3300021406 | Soil | MPLFMYQASYTAKSMAAQLKDPKDPEEAISSALEDLGAS |
| Ga0210384_108791431 | 3300021432 | Soil | MALYMYQASYTARSMAAQLKEPQDPVEAIRPTLEDLGAKM |
| Ga0210391_114711171 | 3300021433 | Soil | MALYMYQASYTAKSMAAQLKDPEDPVEAIRTALEEV |
| Ga0210390_112734731 | 3300021474 | Soil | MTLYMYQASYTAKSMAAQLTDPHDPMEAIQPTMQELGATILVAGF |
| Ga0126371_121933722 | 3300021560 | Tropical Forest Soil | MTLYMYQASYTARSMAAQLKEPQDPVEAIKPTLEDLGA |
| Ga0212123_106066642 | 3300022557 | Iron-Sulfur Acid Spring | MTLYMYQASYTAKSMAAQLKEPQDPVETIRPTLEELGAKI |
| Ga0207692_101692841 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLAEL |
| Ga0207692_102524961 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLYMYQASYTAKSMAAQLTEPHDPMEAIRPTLEELGAKVLVAGFPFG |
| Ga0207699_100444246 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLYMYQASYTAKSMAAQLTEPHDPMEAIAPTLEE |
| Ga0207707_114737352 | 3300025912 | Corn Rhizosphere | MTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELGARV |
| Ga0207693_109894342 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LALYMYQASYTARSMAAQIAEPQDPVETISTALEDVGAKMVVAAFPF |
| Ga0207663_102731801 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLYMYQASYTAKSMAAQLTDPHDPMDTIGPTLTDV |
| Ga0207663_114056062 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEDLGATILVAGFP |
| Ga0207687_110884172 | 3300025927 | Miscanthus Rhizosphere | MTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTLEEL |
| Ga0207639_110099301 | 3300026041 | Corn Rhizosphere | MTLYMYQASYTAKSMAAQLTDPHDPMEAIGPTLEELGATVLVA |
| Ga0209732_10726602 | 3300027117 | Forest Soil | MALYMYQASYTAKSMAAQLKDPKDPVEAIGTALEDVGAEIVVAAFP |
| Ga0208241_10587952 | 3300027297 | Forest Soil | VALYMYQASYTAKSMAAQLKDPEDPVDAIRSALEDVGA |
| Ga0209060_105612801 | 3300027826 | Surface Soil | MALYMYQASYTAKSMAAQLTDPQDPVELITPALEDL |
| Ga0209693_102281752 | 3300027855 | Soil | MTLYMYQASYTAKSMAAQLTDPHDPMEAIQPTMQELGATILVAGFPFGEY |
| Ga0209275_100724333 | 3300027884 | Soil | MTLYMYQASYTAKSMAAQLTDPHDPMEAIQPTMQELGATI |
| Ga0209380_108467332 | 3300027889 | Soil | MALYMYQASYTAKSMAAQLTEPRDPVEAMRSALEDLGAEIVVAGFPFGE |
| Ga0209415_100891704 | 3300027905 | Peatlands Soil | MALYMYQASYTAKSMAAQLKEPEDPVEAIRSALDDVGAELVVAGFPF |
| Ga0265322_101445761 | 3300028654 | Rhizosphere | MALYMYQASYTAKSMAAQIQEPQDPVETISAALEDV |
| Ga0307313_101270712 | 3300028715 | Soil | MTLYMYQASYTAKSMAAQLTEPHDPMEAIGPTMEDLGATIVVAGF |
| Ga0265338_107028931 | 3300028800 | Rhizosphere | MALYMYQASYTAKSMAAQIQEPQDPVETISAALEDVGAKIVVAAF |
| Ga0302235_102218402 | 3300028877 | Palsa | MARYMYQASYTSKSMAAQLREPQDPVEAISPVLEDLGATLLVAG |
| Ga0302229_103450042 | 3300028879 | Palsa | MALYMYQASYTAKSMAAQLKEPQDPVEAIRSALEDVGAE |
| Ga0222748_11068061 | 3300029701 | Soil | MALYMYQASYTAKSMAAQLKEPEDPAEAIRSALEEVGATLL |
| Ga0311339_118937922 | 3300029999 | Palsa | MALYMYQASYTAKSMAAQLKEPQDPVEAIRSALEDVGAELVVTGFPF |
| Ga0302177_102963583 | 3300030053 | Palsa | MALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEELGAEIVVAGFP |
| Ga0302179_103784622 | 3300030058 | Palsa | MALYMYQASYTSKSMAAQLKEPQDPMEAIRPVLEDLGAKI |
| Ga0311370_119632312 | 3300030503 | Palsa | MALYMYQASYTAKSMAAQLNEPEDPAEAIRSALEDVGAELLVA |
| Ga0311355_115896551 | 3300030580 | Palsa | MALYMYQASYTAKSMAAQLQEPQDPVEAIRPTLEDLGATM |
| Ga0075374_112903112 | 3300030855 | Soil | MALYMYQASYSARSMAAQLKEPQDPVEAIRPTLEDLGAK |
| Ga0302326_101547071 | 3300031525 | Palsa | MARYMYQASYTSKSMAAQLREPQDPVEAISPVLEDLGATLLV |
| Ga0318516_102301701 | 3300031543 | Soil | MTLYMYQASYTAKSMAAQLTEPHDPMEAIRPTLDELGATIVV |
| Ga0318574_107742551 | 3300031680 | Soil | MTLYMYQASYTAKSMAAQLKEPQDPVEAFSPTLEELGAKILVAGFPFG |
| Ga0310686_1087561022 | 3300031708 | Soil | MALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDLGA |
| Ga0307474_113983261 | 3300031718 | Hardwood Forest Soil | MALYMYQASYTARSMAAQLKEPQDPVEAIRPTLQDLGAKMVVAGF |
| Ga0307474_115030091 | 3300031718 | Hardwood Forest Soil | MALYMYQASYTAKSMAAQLTEPKDPVEAIRPTLEDLG |
| Ga0306917_111315772 | 3300031719 | Soil | MTLYMYQASYTARSMAAQLKEPHDPVEAIRPTLQDLGAKIVVAGFPFG |
| Ga0318500_105682132 | 3300031724 | Soil | MTFYMYQASYTAKSMAAQLKDPQDPVEAITPALEELGAKIVV |
| Ga0318521_107582781 | 3300031770 | Soil | MALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDVGAKILVAGFP |
| Ga0318550_103410293 | 3300031797 | Soil | MTFYMYQASYTAKSMAAQLKDPQDPVEAITPALEELGAKIVVAGFP |
| Ga0318568_102081301 | 3300031819 | Soil | MPLFMYQASYTAKSMADQLKEPQDPVEVIRPALEEL |
| Ga0318568_107323941 | 3300031819 | Soil | MALYMYQASYTAKSMAAQLKDPQDPVEAIKPTLEELGATIM |
| Ga0307473_112219922 | 3300031820 | Hardwood Forest Soil | MTLYMYQASYTAKSMAAQLKEPRDPAEAIRPALEDLGAEILVA |
| Ga0318511_102784222 | 3300031845 | Soil | MALYMYQASYTATSMAAQLTEPRDPVDVIRPALEELG |
| Ga0318511_103663772 | 3300031845 | Soil | MTFYMYQASYTAKSMAAQLKDPQDPVEAITPALEELGAKIVVAG |
| Ga0318544_100209132 | 3300031880 | Soil | MALYMYQASYTAKSMAAQLKEPQDPVEAIRPALED |
| Ga0306925_109675513 | 3300031890 | Soil | MAMYMYQASYTAKSMASQIKEPQDPVEAIMPALEDVGAKILVA |
| Ga0318520_108336311 | 3300031897 | Soil | MALYMYQASYTAKSMAAQLTEPQDPVEAIRPALEDVG |
| Ga0306921_118655082 | 3300031912 | Soil | MALYMYQASYTAKSMAAQLTEPQDPVEVIRPTLEELGAKMLV |
| Ga0310910_100177185 | 3300031946 | Soil | MALYMYQASYTAKSMAAQLKEPQDPVEAIRPALEDVGAQLLVA |
| Ga0318562_102064264 | 3300032008 | Soil | MAMYMYQASYTAKSMASQIKEPQDPVEAIMPALEDV |
| Ga0318556_100981441 | 3300032043 | Soil | MPLFMYQASYTAKSMADQLKKPQDPVEVIRPALEELGATIVVAGFPFG |
| Ga0318513_101340943 | 3300032065 | Soil | MTLYMYQASYTARSMAAQLKEPQDPVEAFKPTLEDLGAK |
| Ga0308173_103764422 | 3300032074 | Soil | MTIYMYQASYTAKSMAAQLTEPHDPMEAIGPVLEELEA |
| Ga0311301_124756752 | 3300032160 | Peatlands Soil | MALYMYQASYTAKSMAAQLKEPQDPVEAIRPTLEDL |
| Ga0348332_109144592 | 3300032515 | Plant Litter | MALYMYQASYTAKSMAAQLKDPEDPVDAIRTALADVGA |
| Ga0335078_103077494 | 3300032805 | Soil | MTLYMYQASYTAKSMAAQIKQPQDPLEVIRPTLEDLGA |
| Ga0335069_110860042 | 3300032893 | Soil | MTLYMYQASYTAKSMAAQLKEPHDPVEVFRPTLEELGAKILVAGFP |
| Ga0335072_100907093 | 3300032898 | Soil | MALYMYQASYTAKSMAAQLTEPQDPVEVIRPALEDVGAKI |
| Ga0335073_117283021 | 3300033134 | Soil | MALYMYQASYTARSMAAQIAEPQDPVEAISAALEDV |
| Ga0335077_121351791 | 3300033158 | Soil | MALYMYQASYTAKSMAAQLTDPHDPSEAIRSALEDM |
| ⦗Top⦘ |