| Basic Information | |
|---|---|
| Family ID | F069934 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDNFTLFVIVTDVLMCVAFITLMVLDKPQKPAPAEPLKPAGKKPA |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.74 % |
| % of genes near scaffold ends (potentially truncated) | 30.08 % |
| % of genes from short scaffolds (< 2000 bps) | 84.55 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.748 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (28.455 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.846 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (78.049 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.51% β-sheet: 0.00% Coil/Unstructured: 68.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF01904 | DUF72 | 38.21 |
| PF09413 | DUF2007 | 25.20 |
| PF01928 | CYTH | 8.13 |
| PF01661 | Macro | 3.25 |
| PF13714 | PEP_mutase | 1.63 |
| PF00903 | Glyoxalase | 1.63 |
| PF03379 | CcmB | 0.81 |
| PF01977 | UbiD | 0.81 |
| PF00730 | HhH-GPD | 0.81 |
| PF13633 | Obsolete Pfam Family | 0.81 |
| PF13424 | TPR_12 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 38.21 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 3.25 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.81 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.81 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.81 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.81 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.81 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.81 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.75 % |
| Unclassified | root | N/A | 3.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10001398 | All Organisms → cellular organisms → Bacteria | 7628 | Open in IMG/M |
| 3300002908|JGI25382J43887_10220325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 896 | Open in IMG/M |
| 3300004139|Ga0058897_10356848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300004139|Ga0058897_10997784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 598 | Open in IMG/M |
| 3300005166|Ga0066674_10062926 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300005166|Ga0066674_10079382 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
| 3300005166|Ga0066674_10549018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300005171|Ga0066677_10181197 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300005171|Ga0066677_10354843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300005171|Ga0066677_10600160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300005177|Ga0066690_10181213 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300005177|Ga0066690_10966528 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300005178|Ga0066688_10105762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1725 | Open in IMG/M |
| 3300005180|Ga0066685_11145244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300005187|Ga0066675_10199708 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300005332|Ga0066388_103031687 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300005436|Ga0070713_100180575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1896 | Open in IMG/M |
| 3300005445|Ga0070708_101467764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300005446|Ga0066686_11061744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300005447|Ga0066689_10553399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300005450|Ga0066682_10295506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300005451|Ga0066681_10191759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1219 | Open in IMG/M |
| 3300005468|Ga0070707_100000574 | All Organisms → cellular organisms → Bacteria | 36986 | Open in IMG/M |
| 3300005468|Ga0070707_100311268 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300005532|Ga0070739_10518291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300005557|Ga0066704_10302948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1080 | Open in IMG/M |
| 3300005560|Ga0066670_10079240 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300005568|Ga0066703_10205782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300005574|Ga0066694_10511946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300005598|Ga0066706_10737479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300005764|Ga0066903_100043578 | All Organisms → cellular organisms → Bacteria | 5339 | Open in IMG/M |
| 3300006031|Ga0066651_10010799 | All Organisms → cellular organisms → Bacteria | 3704 | Open in IMG/M |
| 3300006046|Ga0066652_100118201 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
| 3300006046|Ga0066652_100234824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
| 3300006046|Ga0066652_101633844 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300006794|Ga0066658_10106202 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300006797|Ga0066659_10055730 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
| 3300006797|Ga0066659_10172421 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300006800|Ga0066660_10312399 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300006854|Ga0075425_100618543 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300007255|Ga0099791_10259930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300009012|Ga0066710_101332897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1113 | Open in IMG/M |
| 3300009012|Ga0066710_101773872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 934 | Open in IMG/M |
| 3300009090|Ga0099827_10531691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300009176|Ga0105242_12615120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300009792|Ga0126374_11571797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300010043|Ga0126380_12119828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300010046|Ga0126384_10053944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2787 | Open in IMG/M |
| 3300010048|Ga0126373_10723980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300010048|Ga0126373_11461239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300010048|Ga0126373_13193832 | Not Available | 510 | Open in IMG/M |
| 3300010087|Ga0127492_1102581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300010096|Ga0127473_1122045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300010100|Ga0127440_1111097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300010124|Ga0127498_1098334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300010323|Ga0134086_10046831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1458 | Open in IMG/M |
| 3300010329|Ga0134111_10055023 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300010333|Ga0134080_10055815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1561 | Open in IMG/M |
| 3300010336|Ga0134071_10197840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300010337|Ga0134062_10145451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300010358|Ga0126370_11229241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300010358|Ga0126370_11447304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300010359|Ga0126376_10176321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1744 | Open in IMG/M |
| 3300010359|Ga0126376_10898268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300010359|Ga0126376_11614938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
| 3300010366|Ga0126379_13815804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300010401|Ga0134121_10307879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1405 | Open in IMG/M |
| 3300011120|Ga0150983_12266091 | Not Available | 585 | Open in IMG/M |
| 3300011120|Ga0150983_14927925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 741 | Open in IMG/M |
| 3300011269|Ga0137392_11489014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300012096|Ga0137389_10775967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300012198|Ga0137364_11474992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300012203|Ga0137399_11300694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300012207|Ga0137381_10084545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2670 | Open in IMG/M |
| 3300012207|Ga0137381_10363413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300012212|Ga0150985_112637973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300012356|Ga0137371_10074574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2629 | Open in IMG/M |
| 3300012357|Ga0137384_11357434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012361|Ga0137360_10719680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300012372|Ga0134037_1150494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300012375|Ga0134034_1042927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300012376|Ga0134032_1146577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300012390|Ga0134054_1133017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300012403|Ga0134049_1030306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300012410|Ga0134060_1378455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300012685|Ga0137397_10221956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300012918|Ga0137396_10950609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012918|Ga0137396_10951377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300015371|Ga0132258_10903967 | All Organisms → cellular organisms → Bacteria | 2229 | Open in IMG/M |
| 3300015374|Ga0132255_101613246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300016294|Ga0182041_11142189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300016319|Ga0182033_10925199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300017654|Ga0134069_1247566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300017654|Ga0134069_1265485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300017656|Ga0134112_10010719 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3029 | Open in IMG/M |
| 3300018431|Ga0066655_10339705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300018431|Ga0066655_10374578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300018433|Ga0066667_10031290 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
| 3300018433|Ga0066667_11570254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300018433|Ga0066667_12120107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300018468|Ga0066662_10473456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1130 | Open in IMG/M |
| 3300018482|Ga0066669_10115518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1899 | Open in IMG/M |
| 3300018482|Ga0066669_11942628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300021404|Ga0210389_10056223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3017 | Open in IMG/M |
| 3300021560|Ga0126371_11888100 | Not Available | 717 | Open in IMG/M |
| 3300025906|Ga0207699_10637487 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300025922|Ga0207646_10001710 | All Organisms → cellular organisms → Bacteria | 26655 | Open in IMG/M |
| 3300026306|Ga0209468_1014514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2880 | Open in IMG/M |
| 3300026307|Ga0209469_1011550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3301 | Open in IMG/M |
| 3300026314|Ga0209268_1137465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300026323|Ga0209472_1030760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2457 | Open in IMG/M |
| 3300026324|Ga0209470_1140552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300026325|Ga0209152_10072046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1254 | Open in IMG/M |
| 3300026327|Ga0209266_1250434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300026342|Ga0209057_1198110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300026528|Ga0209378_1124499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300026538|Ga0209056_10372597 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300031820|Ga0307473_10585435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300031910|Ga0306923_10138264 | All Organisms → cellular organisms → Bacteria | 2775 | Open in IMG/M |
| 3300031945|Ga0310913_10707323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300032076|Ga0306924_10808851 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300032261|Ga0306920_102596891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 28.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.63% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010087 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010096 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010100 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010124 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012376 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100013987 | 3300002558 | Grasslands Soil | MDNFTLFVIVTDVLMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA* |
| JGI25382J43887_102203252 | 3300002908 | Grasslands Soil | MDNFTLFVVGADIVMVAAFIALMVLDKPPKPAPIEPVKPAGKKPA* |
| Ga0058897_103568482 | 3300004139 | Forest Soil | MDNFTLFVIGADIVMCLAFIALMVLDKPQKPTPVEPLKSTGKKPA* |
| Ga0058897_109977842 | 3300004139 | Forest Soil | MDNFTLFVIAADVVMCLAFIALMVFDKPQKSRPIEPLKSAGKKSA* |
| Ga0066674_100629263 | 3300005166 | Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPLKPAVKRPA* |
| Ga0066674_100793823 | 3300005166 | Soil | MDNFTLFVIVTDILMCVAFVTLMVLDKPQKPAPAEPLKPAGKKPA* |
| Ga0066674_105490182 | 3300005166 | Soil | MDNFTWFVIVADVLMCAAFIALMILDKPQKPSPVEPLKPAGKKQ |
| Ga0066677_101811972 | 3300005171 | Soil | MDNFTLFVIGADIMMCLAFIALMVLDKPQKPTPVEPLKPAGKKPA* |
| Ga0066677_103548432 | 3300005171 | Soil | MDNFTLFVIIADVLMCLAFVALMVFDKPQKPLTAQPLKPGKKSA* |
| Ga0066677_106001602 | 3300005171 | Soil | MDNFTLFVVAADVLMVIAFIALMVLDKPRKPAPVAPLKPAGKKTA* |
| Ga0066690_101812131 | 3300005177 | Soil | MDNFTWFVIVADVLMCAAFIALMILDKPQKPSPVEPLKPAGKKQA* |
| Ga0066690_109665282 | 3300005177 | Soil | SGIIGRSGIFQSMDNFTLFVVAADVLMVIAFIALMVLDKPRKPAPVAPLKPAGKKTA* |
| Ga0066688_101057623 | 3300005178 | Soil | MDNFTLLVIVTDILMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA* |
| Ga0066685_111452442 | 3300005180 | Soil | VKWGIHPSDPESMDNFTLLVIVTDILMCVAFITLMVLDKPQKPEPAEPFKPAGKKPA* |
| Ga0066675_101997082 | 3300005187 | Soil | MDNFTLFVVGADIVMVLAFIALMILDKPQKPAPVVPLKPAGKKPV* |
| Ga0066388_1030316871 | 3300005332 | Tropical Forest Soil | MDNFTLFVIVTDILMCVAFVTLMVLDKPQKPAPAEPLKPAGKRPA* |
| Ga0070713_1001805753 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNFSIAVIVGDIVMCAAFIALMIFDKPSKPAPVEPLKPAGKRSA* |
| Ga0070708_1014677641 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GIIGRSGIFQSMDNFTLFVVAADVLMVIAFIALMVLDKPRKPAPVEPLKPAGKKTA* |
| Ga0066686_110617442 | 3300005446 | Soil | MDNFTLLVIVTDILMCVAFITLMVLDKPQRPEPAEPFKPAGKKPA* |
| Ga0066689_105533993 | 3300005447 | Soil | MDNFTLFVIGADIFMCLAFIALMVLDKPQKPAPVEPLKSAGKKPA* |
| Ga0066682_102955061 | 3300005450 | Soil | TPNFQAKFMDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPLKPAVKRPA* |
| Ga0066681_101917592 | 3300005451 | Soil | MDNFTLLVIVTDILMCVAFITLIVLDKPQKPEPAEPFKPAGKKPA* |
| Ga0070707_10000057436 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNFTLFVVAADVLMVIAFIALMVLDKPRKPAPVEPLKPAGKKTA* |
| Ga0070707_1003112682 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNFDNFTLFVIAADILMCVAFVALMVLDKPRKPAPVEPLKPAGKKTA* |
| Ga0070739_105182912 | 3300005532 | Surface Soil | MDNFTLFVVATDILMCIAFVALMVLDKPPKTAPAEPLK |
| Ga0066704_103029485 | 3300005557 | Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKSEPAEPFKPAGKKPA* |
| Ga0066670_100792401 | 3300005560 | Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPLKPA |
| Ga0066703_102057822 | 3300005568 | Soil | MDNFTWFVIVADVLMCAAFIALMILDKPQKPSPAEPLKPAGKK* |
| Ga0066694_105119461 | 3300005574 | Soil | RIMDNFTWFVIVADVLMCAAFIALMILDKPQKPSPVEPLKPAGKKQA* |
| Ga0066706_107374791 | 3300005598 | Soil | VIVTDILMCVAFITLMVLDKPQKPAPAEPLKPAGKRPA* |
| Ga0066903_1000435788 | 3300005764 | Tropical Forest Soil | MDNFSIAVIVGDIVMCAAFIALMVLDKPRKPAPVEPLKSAGKKSA* |
| Ga0066651_100107996 | 3300006031 | Soil | MDNFTLFVIVTDVLMCVAFITLMVLDKPQKPAPAEPLKPAGKRPA* |
| Ga0066652_1001182015 | 3300006046 | Soil | MDNFTLFVVAADVLMVVAFIALMVLDKPRKPALVQP |
| Ga0066652_1002348243 | 3300006046 | Soil | MDNFTLLVIVTDILMCVAFITLMVLDKPQKPEPAEPFKPAGKKPA* |
| Ga0066652_1016338442 | 3300006046 | Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPLKPAGKRPA* |
| Ga0066658_101062024 | 3300006794 | Soil | MDNFTLFVVAADVLMVVAFIALMVLDKPRKPALVQPLKPAGKKTL* |
| Ga0066659_100557301 | 3300006797 | Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA* |
| Ga0066659_101724213 | 3300006797 | Soil | MDNFTLFVVGADIVMVAAFIALMVLDKPQKPAPIEPVKPAGKKPA* |
| Ga0066660_103123992 | 3300006800 | Soil | MDNFTLFVIIADVLMFLAFVALMVFDKPQKPLTAQPLKPGKKSA* |
| Ga0075425_1006185433 | 3300006854 | Populus Rhizosphere | MDNFTLFVVAADVLMVIAFIALMVLDKQKKPAPVEPLKPAGKKTA* |
| Ga0099791_102599302 | 3300007255 | Vadose Zone Soil | MDNFTLFVIGADVVMCLAFIALMVLDKPQKPAPVDPLKSAGKKPA* |
| Ga0066710_1013328972 | 3300009012 | Grasslands Soil | MDNFTLFVIVTDILMCAAFVTLMVLDKPQKPAPAEPLKPAGKRPA |
| Ga0066710_1017738722 | 3300009012 | Grasslands Soil | VADVLMCVAFIALMVLDKPPKPSPVEPLKPAGKKPA |
| Ga0099827_105316913 | 3300009090 | Vadose Zone Soil | MDNFTLFVVAADVAMCIAFIALMVLDKPQKPTPVEPLKPAGKKSA* |
| Ga0105242_126151201 | 3300009176 | Miscanthus Rhizosphere | MDNFTIAVITGDIVMCAAFIALMVLDKPRKLAPVEPPKPAGKRSA* |
| Ga0126374_115717971 | 3300009792 | Tropical Forest Soil | IAVIVGDIVMCAAFIALMVLDKPSKPAPVEPLKSAGKKSA* |
| Ga0126380_121198282 | 3300010043 | Tropical Forest Soil | SMDNFSIAVIVGDIVMCAAFIALMIFDKPSKPAPAQPLKPAGKKSA* |
| Ga0126384_100539445 | 3300010046 | Tropical Forest Soil | MDNFSIAVIVGDIVMCAAFIALMVLDKPSKPAPVEPLKSAGKKSA* |
| Ga0126373_107239801 | 3300010048 | Tropical Forest Soil | MDNFSIAVIVGDIVMCAAFIALMVLDKPRKPAPVEPLKPAGKKSA* |
| Ga0126373_114612391 | 3300010048 | Tropical Forest Soil | MDDFSIAVIVGDIVMCAAFIALMVLDKPSKPAPVEPLKSAGKKSA* |
| Ga0126373_131938322 | 3300010048 | Tropical Forest Soil | MDNFTIAVIVGDVVMCAAFIALMVFDKGGKPSAPVEPLKPAGKRPS* |
| Ga0127492_11025812 | 3300010087 | Grasslands Soil | MDNFTWFVIVADVLMCVAFIALMVLDKPPKPSPVEPLKPAGKKPA* |
| Ga0127473_11220452 | 3300010096 | Grasslands Soil | MDNFTWFVIVADVLMCAAFIALMILDKPQKPSPVEPLKPAGK |
| Ga0127440_11110972 | 3300010100 | Grasslands Soil | MDNFTLFVIVTDILMCVAFVTLMVLDKPQKPAPAEPFKPAGKKPA* |
| Ga0127498_10983341 | 3300010124 | Grasslands Soil | MDNFTLFVIVTDVLMCVAFVTLMVLDKPQKPAPAEPLKPAGKKPA* |
| Ga0134086_100468313 | 3300010323 | Grasslands Soil | VIVTDVLMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA* |
| Ga0134111_100550233 | 3300010329 | Grasslands Soil | IVTDILMCVAFITLMVLDKPQKPAPAEPLKPAGKRPA* |
| Ga0134080_100558153 | 3300010333 | Grasslands Soil | MDNFTLFVIVTDILMCVAFITLMVLYKPQKPAPAEPFKPAGKKPA* |
| Ga0134071_101978402 | 3300010336 | Grasslands Soil | VTDVLMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA* |
| Ga0134062_101454513 | 3300010337 | Grasslands Soil | MDNFTLFVIVTDILMCVAFITLIVLDKPQKPEPAEPFKPAGKKPA* |
| Ga0126370_112292412 | 3300010358 | Tropical Forest Soil | MDNFTLFVIVTDTLMCLAFVALMVLDKPQKTTPVEPLKPGKKSA* |
| Ga0126370_114473042 | 3300010358 | Tropical Forest Soil | MDNFTLFVIVTDTLMCLAFIALMVLDKPQKPTPVEPLKPGKKSA* |
| Ga0126376_101763213 | 3300010359 | Tropical Forest Soil | MDNFSIAVIVGDIVMCAAFIALMVLDKPSKPAPVEPLKPAGKKSA* |
| Ga0126376_108982681 | 3300010359 | Tropical Forest Soil | FVIVTDILMCVAFVTLMVLDKPQKPAPAEPLKPAGKRPA* |
| Ga0126376_116149382 | 3300010359 | Tropical Forest Soil | TDTLMCLAFIALMVLDKPQKPTPVEPLKPGKKSA* |
| Ga0126379_138158041 | 3300010366 | Tropical Forest Soil | MDNFTLFVIVTDTLMCLAFIALMVLDKPQKPTPAEPLKPGKKSA* |
| Ga0126381_1005306222 | 3300010376 | Tropical Forest Soil | MDDFSIAVIVGDIVMCAAFIALIVLDKPRKPAPVQPLKSAGKKSA* |
| Ga0134121_103078792 | 3300010401 | Terrestrial Soil | MDNFTLFVIIADVIMCLAFIALMVFDKPQKPLTAEPLKTGKKSA* |
| Ga0150983_122660912 | 3300011120 | Forest Soil | MDNFTLFVIIADVLMCLAFIALMVFDKPQKPAPVGPLKPAGKKSA* |
| Ga0150983_149279251 | 3300011120 | Forest Soil | LKAGIFRSMDNFTLFVIVADVLMCLAFIALMVFDKPQKSRPIEPLKSAGKKSA* |
| Ga0137392_114890142 | 3300011269 | Vadose Zone Soil | MDNFTLFVIVADVIMCLAFIALMVFDKPQKPSPMEPLKPGKKSA* |
| Ga0137389_107759671 | 3300012096 | Vadose Zone Soil | MDNFTLFVIVADVLMCLAFIALMVFDKPQKPSPIEPLKPGKKSA* |
| Ga0137364_114749922 | 3300012198 | Vadose Zone Soil | MDNFTLLVIIADVIMCLAFVALMVFDKPQKPLTAQPLKPGKKSA* |
| Ga0137399_113006942 | 3300012203 | Vadose Zone Soil | MDNFTLFVVGADIVMVAAFIALMVLDKPPKPAPVETLKPAGKKPA* |
| Ga0137381_100845454 | 3300012207 | Vadose Zone Soil | FMDNFTLFVIVTDVLMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA* |
| Ga0137381_103634131 | 3300012207 | Vadose Zone Soil | MDNFTLFVVATDVLMVVAFIALMVLDKPRKPALVQPLKPAGKKTV* |
| Ga0150985_1126379732 | 3300012212 | Avena Fatua Rhizosphere | MDNFTIFVVAADVIMCLAFVALMVFDKPQKPTPVEPLKPAGRRSA* |
| Ga0137371_100745743 | 3300012356 | Vadose Zone Soil | MDNFTLFVIVTDVLMCVAFITLMVLDKPQKPAPAEPLKPAVKRPA* |
| Ga0137384_113574342 | 3300012357 | Vadose Zone Soil | MDNFTLFVIIADVIMCLAFIALMVFDKPQKITPVAPLKPGKKSA* |
| Ga0137360_107196802 | 3300012361 | Vadose Zone Soil | MDNFTLFVIVADVLMCLAFIALMVFDKPQTPARIEPLKPGKKSA* |
| Ga0134037_11504942 | 3300012372 | Grasslands Soil | MDNFTWFVIVADVLMCAAFIALMILDKPQKPSPVEPLKPAEKKQA* |
| Ga0134034_10429271 | 3300012375 | Grasslands Soil | MDNFTWFVIVADVLMCAAFIALMILDKPQKPSPVEPLKPAGKKPA* |
| Ga0134032_11465771 | 3300012376 | Grasslands Soil | MDNFTLFVIVTDVLMCVAFITLMVLDKPQKPAPAEPLKPAGKKPA* |
| Ga0134054_11330173 | 3300012390 | Grasslands Soil | MDNFILFVIVTDILMCVAFVTLMVLDKPQKPAPAEPLKPAGKKPA* |
| Ga0134049_10303062 | 3300012403 | Grasslands Soil | MDNFTLFVIVTDVLMCVVFITLMVLDKPQKPAPAEPFKPAGKKPA* |
| Ga0134060_13784551 | 3300012410 | Grasslands Soil | FTLFVIVTDVLMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA* |
| Ga0137397_102219562 | 3300012685 | Vadose Zone Soil | MDNFTLFVVAADIVMVLAFIALMVLDKPQKPAPVEPLKPAGKKPA* |
| Ga0137396_109506091 | 3300012918 | Vadose Zone Soil | MDNFTLFVIGADIVMCLAFIALMVLDKPQKPAPVDPLKSAGKKPA* |
| Ga0137396_109513771 | 3300012918 | Vadose Zone Soil | YFDTMDNFTLFVVGADIVMVAAFIALMVLDKPPKPAPVEPLKPAGKKPA* |
| Ga0132258_109039671 | 3300015371 | Arabidopsis Rhizosphere | GVRIFLSMDNFTLFVIIADVVMCLAFIALMVFDKPARTAPIEPLKPAGKKSA* |
| Ga0132255_1016132462 | 3300015374 | Arabidopsis Rhizosphere | MDNFTLFVIIADVVMCLAFIALMVFDKPARTAPIEPLKPAGKKSA* |
| Ga0182041_111421891 | 3300016294 | Soil | GIFERMDNFTLFVIVADTLMCLAFIALMVLDKPQKPAPAEPLKPAGKKPA |
| Ga0182033_109251991 | 3300016319 | Soil | ADTLMCLAFIALMVLDKPQKPAPAEPLKPAGKKPA |
| Ga0134069_12475662 | 3300017654 | Grasslands Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKPEPAEPFKPAGKKPA |
| Ga0134069_12654852 | 3300017654 | Grasslands Soil | PNLMDNFTLLVIVTDILMCVAFITLMVLDKPQRPEPAEPFKPAGKKPA |
| Ga0134112_100107195 | 3300017656 | Grasslands Soil | MDNFTWFVIVADVLMCVAFIALMVLDKPPKPSPVEPLKPAGKKPA |
| Ga0066655_103397051 | 3300018431 | Grasslands Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA |
| Ga0066655_103745783 | 3300018431 | Grasslands Soil | MDNFTLFVIVTDILMCVAFVTLMVLDKPQKPAPAEPLKPAGKKPA |
| Ga0066667_100312903 | 3300018433 | Grasslands Soil | MDNFTWFVIVADVLMCAAFIALMILDKPQKPSPVEPLKPAGKKQA |
| Ga0066667_115702542 | 3300018433 | Grasslands Soil | MDNFTLLVIVTDILMCVAFITLMVLDKPQRPEPAEPFKPAGKKPA |
| Ga0066667_121201072 | 3300018433 | Grasslands Soil | MDNFTLFVIVTDVLMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA |
| Ga0066662_104734562 | 3300018468 | Grasslands Soil | MDNFTLFVVGADIVMVAAFIALMVLDKPPKPAPIEPVKPAGKKPA |
| Ga0066669_101155182 | 3300018482 | Grasslands Soil | MDNFTLFVVAADVLMVIAFIALMVLDKPRKPAPVAPLKPAGKKTA |
| Ga0066669_119426282 | 3300018482 | Grasslands Soil | MYNFTLFVIIADVLMCLAFVALMVFDKPQKPLTAQPLKPGKKSA |
| Ga0210389_100562233 | 3300021404 | Soil | MVDMDNFSIAVIVGDIVMCAAFVALMVFDNPSKPVPVEPLKPAGKKSA |
| Ga0126371_118881003 | 3300021560 | Tropical Forest Soil | MDNFSIAVIVGDIVMCAAFIALMVLDKPRKPAPVEPLKPAGKKSA |
| Ga0207699_106374872 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VIVGDIVMCAAFIALMIFDKPSKPAPVEPLKPAGKRSA |
| Ga0207646_1000171027 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNFTLFVVAADVLMVIAFIALMVLDKPRKPAPVEPLKPAGKKTA |
| Ga0209468_10145141 | 3300026306 | Soil | FMDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPFKPAGKKPA |
| Ga0209469_10115504 | 3300026307 | Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPLKPAVKRPA |
| Ga0209268_11374651 | 3300026314 | Soil | MNNFTLFVIVTDILMCVAFVTLMVLDKPQKPAPAEPFKPAGKKPA |
| Ga0209472_10307602 | 3300026323 | Soil | MDNFTLFVIVTDILMCVAFITLIVLDKPQKPEPAEPFKPAGKKPA |
| Ga0209470_11405521 | 3300026324 | Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPLKPAGKRPA |
| Ga0209152_100720461 | 3300026325 | Soil | MDNFTWFVIVADVLMCAAFIALMILDKPQKPSSVEPLKPAGKKQA |
| Ga0209266_12504342 | 3300026327 | Soil | MDNFTLLVIVTDILMCVAFITLMVLDKPQKPEPAEPFKPAGKKPA |
| Ga0209057_11981101 | 3300026342 | Soil | LFVIVTDILMCVAFVTLMVLDKPQKPAPAEPLKPAGKKPA |
| Ga0209378_11244993 | 3300026528 | Soil | MDNFTLLVIVTDILMCVAFITLMVLDKPQKPEPAEPFKPAG |
| Ga0209056_103725973 | 3300026538 | Soil | MDNFTLFVVAADVLMVVAFIALMVLDKPRKPALVQPLKPAGKKTV |
| Ga0307473_105854353 | 3300031820 | Hardwood Forest Soil | MDNFTLFVIVTDILMCVAFITLMVLDKPQKPAPAEPLRPAGKKPA |
| Ga0306923_101382642 | 3300031910 | Soil | MDNFTLFVIVADTLMCLAFIALMVLDKPQKPAPAEPLKPAGKKPA |
| Ga0310913_107073231 | 3300031945 | Soil | FVIVADTLMCLAFIALMVLDKPQKPAPAEPLKPAGKKPA |
| Ga0306924_108088513 | 3300032076 | Soil | MDNFTLFVIVADTLMCLAFIALMVLDKPQKPAPAEPLKP |
| Ga0306920_1025968911 | 3300032261 | Soil | MDNFTLFVIVADTLMCLAFIALMVLDKPQKPAPAEPLK |
| ⦗Top⦘ |