| Basic Information | |
|---|---|
| Family ID | F069925 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 44 residues |
| Representative Sequence | IPGARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.37 % |
| % of genes from short scaffolds (< 2000 bps) | 92.68 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.951 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.016 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.276 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF00561 | Abhydrolase_1 | 47.15 |
| PF12697 | Abhydrolase_6 | 45.53 |
| PF07883 | Cupin_2 | 2.44 |
| PF01557 | FAA_hydrolase | 1.63 |
| PF12146 | Hydrolase_4 | 1.63 |
| PF12695 | Abhydrolase_5 | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000793|AF_2010_repII_A001DRAFT_10002618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4005 | Open in IMG/M |
| 3300000955|JGI1027J12803_108768942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300001164|JGI11823J13286_1015064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 572 | Open in IMG/M |
| 3300002239|JGI24034J26672_10004296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2013 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101519839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 565 | Open in IMG/M |
| 3300005105|Ga0066812_1013800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 606 | Open in IMG/M |
| 3300005363|Ga0008090_10126229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300005436|Ga0070713_101808846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 593 | Open in IMG/M |
| 3300005468|Ga0070707_101901087 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005536|Ga0070697_101749238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300005549|Ga0070704_101069870 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300005553|Ga0066695_10662422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 617 | Open in IMG/M |
| 3300005564|Ga0070664_101091032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300005569|Ga0066705_10563699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 704 | Open in IMG/M |
| 3300005575|Ga0066702_10525176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 718 | Open in IMG/M |
| 3300005713|Ga0066905_100765357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
| 3300005713|Ga0066905_101971025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 541 | Open in IMG/M |
| 3300005713|Ga0066905_102295078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 504 | Open in IMG/M |
| 3300005764|Ga0066903_101785534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1174 | Open in IMG/M |
| 3300005764|Ga0066903_101953253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
| 3300005764|Ga0066903_103427955 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005764|Ga0066903_103869662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 804 | Open in IMG/M |
| 3300005764|Ga0066903_104609494 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300005764|Ga0066903_107369487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 568 | Open in IMG/M |
| 3300005844|Ga0068862_102044936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 584 | Open in IMG/M |
| 3300005937|Ga0081455_10517957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300006047|Ga0075024_100263105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
| 3300006048|Ga0075363_100184276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1189 | Open in IMG/M |
| 3300006794|Ga0066658_10583234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 608 | Open in IMG/M |
| 3300006845|Ga0075421_100723102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1155 | Open in IMG/M |
| 3300006871|Ga0075434_102340818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 537 | Open in IMG/M |
| 3300006953|Ga0074063_10009545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300007788|Ga0099795_10399495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 624 | Open in IMG/M |
| 3300009038|Ga0099829_10420813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300009094|Ga0111539_10383176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1637 | Open in IMG/M |
| 3300009098|Ga0105245_12813172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 539 | Open in IMG/M |
| 3300009156|Ga0111538_10267573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2163 | Open in IMG/M |
| 3300010046|Ga0126384_10378019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1189 | Open in IMG/M |
| 3300010046|Ga0126384_10499473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1048 | Open in IMG/M |
| 3300010047|Ga0126382_10417429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1053 | Open in IMG/M |
| 3300010048|Ga0126373_10393990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1408 | Open in IMG/M |
| 3300010359|Ga0126376_11756515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 657 | Open in IMG/M |
| 3300010366|Ga0126379_12886817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 575 | Open in IMG/M |
| 3300010376|Ga0126381_100968459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1227 | Open in IMG/M |
| 3300010398|Ga0126383_10716507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1080 | Open in IMG/M |
| 3300010398|Ga0126383_12581426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 592 | Open in IMG/M |
| 3300010868|Ga0124844_1168900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 817 | Open in IMG/M |
| 3300012189|Ga0137388_10719338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 927 | Open in IMG/M |
| 3300012205|Ga0137362_10179787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1817 | Open in IMG/M |
| 3300012209|Ga0137379_11809194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300012354|Ga0137366_10440247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 946 | Open in IMG/M |
| 3300012469|Ga0150984_117570927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 966 | Open in IMG/M |
| 3300012503|Ga0157313_1018087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300012685|Ga0137397_10449490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 960 | Open in IMG/M |
| 3300012930|Ga0137407_11751798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 592 | Open in IMG/M |
| 3300012948|Ga0126375_10744787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 769 | Open in IMG/M |
| 3300012971|Ga0126369_12750147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 576 | Open in IMG/M |
| 3300012985|Ga0164308_11795722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 571 | Open in IMG/M |
| 3300015077|Ga0173483_10898342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 521 | Open in IMG/M |
| 3300016387|Ga0182040_11469467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300018031|Ga0184634_10417156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 610 | Open in IMG/M |
| 3300018066|Ga0184617_1227302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 557 | Open in IMG/M |
| 3300019866|Ga0193756_1031007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 755 | Open in IMG/M |
| 3300019867|Ga0193704_1065603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 689 | Open in IMG/M |
| 3300019871|Ga0193702_1032342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 664 | Open in IMG/M |
| 3300021168|Ga0210406_10215127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1589 | Open in IMG/M |
| 3300021377|Ga0213874_10254537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 648 | Open in IMG/M |
| 3300021478|Ga0210402_11573131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 584 | Open in IMG/M |
| 3300024055|Ga0247794_10238942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 597 | Open in IMG/M |
| 3300025910|Ga0207684_10072914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2916 | Open in IMG/M |
| 3300025914|Ga0207671_10807274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 744 | Open in IMG/M |
| 3300025916|Ga0207663_10331563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1146 | Open in IMG/M |
| 3300025922|Ga0207646_11708084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 540 | Open in IMG/M |
| 3300025931|Ga0207644_11651973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 537 | Open in IMG/M |
| 3300026075|Ga0207708_10041917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3489 | Open in IMG/M |
| 3300027381|Ga0208983_1097111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300027527|Ga0209684_1076436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 523 | Open in IMG/M |
| 3300027546|Ga0208984_1007235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2039 | Open in IMG/M |
| 3300027633|Ga0208988_1134101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300027866|Ga0209813_10099768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
| 3300027882|Ga0209590_10814112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300028596|Ga0247821_10506853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 768 | Open in IMG/M |
| 3300028721|Ga0307315_10138471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 734 | Open in IMG/M |
| 3300028778|Ga0307288_10102831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1042 | Open in IMG/M |
| 3300028784|Ga0307282_10195622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 966 | Open in IMG/M |
| 3300028784|Ga0307282_10260105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 834 | Open in IMG/M |
| 3300028810|Ga0307294_10264334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 614 | Open in IMG/M |
| 3300028811|Ga0307292_10021887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2258 | Open in IMG/M |
| 3300028819|Ga0307296_10709321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 549 | Open in IMG/M |
| 3300028876|Ga0307286_10117727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 940 | Open in IMG/M |
| 3300030988|Ga0308183_1122413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 615 | Open in IMG/M |
| 3300031455|Ga0307505_10138419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1107 | Open in IMG/M |
| 3300031545|Ga0318541_10146799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1292 | Open in IMG/M |
| 3300031681|Ga0318572_10203870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1155 | Open in IMG/M |
| 3300031713|Ga0318496_10034536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2568 | Open in IMG/M |
| 3300031716|Ga0310813_12051805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 540 | Open in IMG/M |
| 3300031723|Ga0318493_10156146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1183 | Open in IMG/M |
| 3300031723|Ga0318493_10442185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 714 | Open in IMG/M |
| 3300031724|Ga0318500_10110765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1258 | Open in IMG/M |
| 3300031724|Ga0318500_10255632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 851 | Open in IMG/M |
| 3300031736|Ga0318501_10784244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 527 | Open in IMG/M |
| 3300031740|Ga0307468_100145919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1509 | Open in IMG/M |
| 3300031778|Ga0318498_10235303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 828 | Open in IMG/M |
| 3300031779|Ga0318566_10332634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 750 | Open in IMG/M |
| 3300031782|Ga0318552_10298148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 819 | Open in IMG/M |
| 3300031793|Ga0318548_10432686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 644 | Open in IMG/M |
| 3300031805|Ga0318497_10514701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 670 | Open in IMG/M |
| 3300031832|Ga0318499_10147418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 918 | Open in IMG/M |
| 3300031879|Ga0306919_10301878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1215 | Open in IMG/M |
| 3300031880|Ga0318544_10181799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 810 | Open in IMG/M |
| 3300031897|Ga0318520_10025009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2908 | Open in IMG/M |
| 3300031959|Ga0318530_10408191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 563 | Open in IMG/M |
| 3300031981|Ga0318531_10144018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1065 | Open in IMG/M |
| 3300032010|Ga0318569_10301618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 745 | Open in IMG/M |
| 3300032012|Ga0310902_11164279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 542 | Open in IMG/M |
| 3300032042|Ga0318545_10369994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 516 | Open in IMG/M |
| 3300032054|Ga0318570_10446125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 590 | Open in IMG/M |
| 3300032068|Ga0318553_10297324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 844 | Open in IMG/M |
| 3300032089|Ga0318525_10272549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 869 | Open in IMG/M |
| 3300032090|Ga0318518_10078398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1621 | Open in IMG/M |
| 3300032174|Ga0307470_11556924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 551 | Open in IMG/M |
| 3300033289|Ga0310914_11579982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 559 | Open in IMG/M |
| 3300034151|Ga0364935_0110464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.01% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.06% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.06% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.25% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.63% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.81% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019871 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A001DRAFT_100026181 | 3300000793 | Forest Soil | RFELIDAVHMMPAQAPAPLLALLQDFLNAQARSTTRQRAG* |
| JGI1027J12803_1087689422 | 3300000955 | Soil | ELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS* |
| JGI11823J13286_10150641 | 3300001164 | Forest Soil | ASEQFAQAIPNARFELIDAVHMMPAQAAGPLLALLKDFLGAQATSATQQRAS* |
| JGI24034J26672_100042961 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | AVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS* |
| JGIcombinedJ26739_1015198392 | 3300002245 | Forest Soil | FELIDAVHMMPAQAPDALLALLLDFLGAQAASTNRQRAG* |
| Ga0066812_10138001 | 3300005105 | Soil | IPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS* |
| Ga0008090_101262291 | 3300005363 | Tropical Rainforest Soil | FARTIPSARFELIDAVHMMPAQAPDALLALLQDFLGAQPASTTRQRAG* |
| Ga0070713_1018088461 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AASEQFAKTIPDARFELIDGVHMMPAQASGPLLALLQDFLDAQAAPAARRAKG* |
| Ga0070707_1019010872 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | DARFELIDAVHMMPAQAPDALLALLLDFLGTQAASTTRQRTG* |
| Ga0070697_1017492382 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | FARTIPGARFELIDAVHMMPAQAAAALLALLRDFLGGQARPAARQRVI* |
| Ga0070704_1010698701 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PAASEQFAQTIPAARFELIDAVHMMPAQAAGPLLALLEDFLPAQAASAAQQRAS* |
| Ga0066695_106624221 | 3300005553 | Soil | ARFELIDAVHMMPAQAPAALLALLQDFLGGEAQSVTRQRAG* |
| Ga0070664_1010910321 | 3300005564 | Corn Rhizosphere | AQTIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASSAKQRAS* |
| Ga0066705_105636992 | 3300005569 | Soil | SIPGARFELIDAVHMMPAQAPAALLALLQDFLHGQTRSATQQRVG* |
| Ga0066702_105251761 | 3300005575 | Soil | ARFELIDAVHMMPAQAPAALLALLQDFLQGQTRSPARQRAG* |
| Ga0066905_1007653571 | 3300005713 | Tropical Forest Soil | EQFARTIPGARFELIDAVHMMPAQAAAALLALLQDFLGAQPASATQERAG* |
| Ga0066905_1019710252 | 3300005713 | Tropical Forest Soil | EQMAREIRGARFELIDAVHMMPAQAPGPLLALLKDFLTTAAAPQAQGASQTS* |
| Ga0066905_1022950781 | 3300005713 | Tropical Forest Soil | EQFARTIPGARFELIDAVHMMPAQAAAALLALLQDFLGAQSASATQQRAG* |
| Ga0066903_1017855343 | 3300005764 | Tropical Forest Soil | AVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG* |
| Ga0066903_1019532531 | 3300005764 | Tropical Forest Soil | LARDIPGARFEAIDAVHMLPAQAPDALLALLDDFLTAHAAGAAQRAH* |
| Ga0066903_1034279551 | 3300005764 | Tropical Forest Soil | IPGARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTLQRAG* |
| Ga0066903_1038696621 | 3300005764 | Tropical Forest Soil | ARFELIDAVHMMPAQAPHALLALIEDFLRSEPGAQHGASAASAGRQRAG* |
| Ga0066903_1046094942 | 3300005764 | Tropical Forest Soil | IPSARFELIDGVHMMPAQAAPVLLALLQDFLGAQAASTADTRRVKG* |
| Ga0066903_1073694872 | 3300005764 | Tropical Forest Soil | RFELIDAVHMMPAQAPAALLALLQDFLGSQARPATRQRAS* |
| Ga0068862_1020449361 | 3300005844 | Switchgrass Rhizosphere | PPAASEQFAQTIPAARFELIDAVHMMPAQAAGPLLALLEDFLPAQAASAAQQRAS* |
| Ga0081455_105179572 | 3300005937 | Tabebuia Heterophylla Rhizosphere | IPGARFELIDACHMMPAQAPDLLLPLLTNFLTRHAASAA* |
| Ga0075024_1002631051 | 3300006047 | Watersheds | FELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS* |
| Ga0075363_1001842763 | 3300006048 | Populus Endosphere | FELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS* |
| Ga0066658_105832341 | 3300006794 | Soil | AVHMMPAQAPEALLALLQDFLGGQARPAARQRAS* |
| Ga0075421_1007231023 | 3300006845 | Populus Rhizosphere | QFAQTIPAARFELIDAVHMMPAQAAGPLLALLEDFLPAQAASAAQQRAS* |
| Ga0075434_1023408181 | 3300006871 | Populus Rhizosphere | ARFELIDAVHMMPAQAPAALLALLQDFLHAQTRSAPRQRAG* |
| Ga0074063_100095452 | 3300006953 | Soil | PDARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG* |
| Ga0099795_103994951 | 3300007788 | Vadose Zone Soil | IPGARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG* |
| Ga0099829_104208132 | 3300009038 | Vadose Zone Soil | ARFELIDAVHMMPAQAAGPLLALLEDFLGAQSASTTQQRAS* |
| Ga0111539_103831761 | 3300009094 | Populus Rhizosphere | PDARFELIDAVHMMPAQAPAALLALLQDFLQGQTRSPARQRAG* |
| Ga0105245_128131722 | 3300009098 | Miscanthus Rhizosphere | PDARFELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS* |
| Ga0111538_102675731 | 3300009156 | Populus Rhizosphere | FAETIPDVRFELIDAVHMMPAQAARELLALLQDFLSAQDAATQGTRRVKG* |
| Ga0126384_103780193 | 3300010046 | Tropical Forest Soil | IRGARFELIDAVHMMPAQAPGPLLALLKDFLTTAAAPQAQGASQTS* |
| Ga0126384_104994732 | 3300010046 | Tropical Forest Soil | ARTIPGARFELIDAVHMMPAQAAHALLALLQDFFGAQAASATQQRAG* |
| Ga0126382_104174291 | 3300010047 | Tropical Forest Soil | RFELIDAVHMMPAQAAAALLALLQDFLGAQPASATQQRVG* |
| Ga0126373_103939903 | 3300010048 | Tropical Forest Soil | FELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG* |
| Ga0126376_117565152 | 3300010359 | Tropical Forest Soil | TIPGARFELIDAVHMMPAQAAHALLALLQDFLGAQAVSATQQRAG* |
| Ga0126379_128868171 | 3300010366 | Tropical Forest Soil | PPAASEQFARTIPGVRFELIDAVHMMPAQAADALLTLLQDFLGAQAASTTRQRAG* |
| Ga0126381_1009684593 | 3300010376 | Tropical Forest Soil | AASEQFARTIPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRTG* |
| Ga0126383_107165072 | 3300010398 | Tropical Forest Soil | IPGARFELIDAVHMMPAQAAAALLALLQDFLGAQAASATQQRAG* |
| Ga0126383_125814262 | 3300010398 | Tropical Forest Soil | EQFAQTIPGARFELIDAVHMMPAQAPAPLLALLQDFLNAQARSTTRQRAG* |
| Ga0124844_11689002 | 3300010868 | Tropical Forest Soil | LIDAVHMMPAQAPGPLLALLKSFLTTATASPAQRASR* |
| Ga0137388_107193382 | 3300012189 | Vadose Zone Soil | EQFAQTIPHARFELIDAVHMMPAQAAGPLLALLEDFLGAQPASTTQQRAS* |
| Ga0137362_101797871 | 3300012205 | Vadose Zone Soil | ASEQFARTIPGARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG* |
| Ga0137379_118091941 | 3300012209 | Vadose Zone Soil | LIDAVHMMPAQAAGALLALLEDFLPAQSAAQQRAN* |
| Ga0137366_104402472 | 3300012354 | Vadose Zone Soil | FARTVPGARFELIDAVHMMPAQAPAALLALLQDFLGGEAQSVTRQRAG* |
| Ga0150984_1175709271 | 3300012469 | Avena Fatua Rhizosphere | IPYARFELIDAVHMMPAQAAGALLALLEDFLGKQAASTAKQRAS* |
| Ga0157313_10180871 | 3300012503 | Arabidopsis Rhizosphere | ASEQFAQTIPGARFELIDGVHMMPAQAAPVLLALLQDFLGAQAAATEGARRVKG* |
| Ga0137397_104494901 | 3300012685 | Vadose Zone Soil | TIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASAAPRRAS* |
| Ga0137407_117517982 | 3300012930 | Vadose Zone Soil | PGVRFELIDAVHMMPAQAAGPLLALLQDFLGAQAASTTQQRAG* |
| Ga0126375_107447872 | 3300012948 | Tropical Forest Soil | GARFELIDAVHMMPAQAPAALLALLQDFLGSQARPATRQRAS* |
| Ga0126369_127501472 | 3300012971 | Tropical Forest Soil | EQFARTIPGARFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTQQRAG* |
| Ga0164308_117957221 | 3300012985 | Soil | RFELIDAVHMMPAQAAGPLLALLNDFLGAQAASAAPRRAS* |
| Ga0173483_108983421 | 3300015077 | Soil | RFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS* |
| Ga0182040_114694671 | 3300016387 | Soil | FELIDAVHMMPAQAPAALLPLLEDFLTAPAGAGARAAAQSR |
| Ga0184634_104171561 | 3300018031 | Groundwater Sediment | TIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS |
| Ga0184617_12273021 | 3300018066 | Groundwater Sediment | ARFELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS |
| Ga0193756_10310072 | 3300019866 | Soil | QTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASAAPRRAS |
| Ga0193704_10656032 | 3300019867 | Soil | ASEQFAQTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASAAPRRAS |
| Ga0193702_10323422 | 3300019871 | Soil | LIDAVHMMPAQAAGPLLALLNDFLGAHAASAAPRRAS |
| Ga0210406_102151271 | 3300021168 | Soil | QTIPDARFELIDAVHMMPAQAPAALLALLQDFLQGQTRSPARQRAG |
| Ga0213874_102545371 | 3300021377 | Plant Roots | IDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0210402_115731311 | 3300021478 | Soil | RFELIDAVHMMPAQAPAALLALLQDFLQGQTRSPARQRAG |
| Ga0247794_102389421 | 3300024055 | Soil | TIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS |
| Ga0207684_100729141 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0207671_108072742 | 3300025914 | Corn Rhizosphere | AQTIPDARFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS |
| Ga0207663_103315632 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DVRFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS |
| Ga0207646_117080842 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0207644_116519732 | 3300025931 | Switchgrass Rhizosphere | AASEQFAQTIPAARFELIDAVHMMPAQAAGPLLALLEDFLPAQAASAAQQRAS |
| Ga0207708_100419175 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | DARFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS |
| Ga0208983_10971112 | 3300027381 | Forest Soil | PPAASEQFAQAIPNARFELIDAVHMMPAQAAGPLLALLKDFLGAQATSATQQRAS |
| Ga0209684_10764362 | 3300027527 | Tropical Forest Soil | ASEQFARTIPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG |
| Ga0208984_10072351 | 3300027546 | Forest Soil | RPPAASEQFAQAIPNARFELIDAVHMMPAQAAGPLLALLKDFLGAQATSATQQRAS |
| Ga0208988_11341011 | 3300027633 | Forest Soil | KTIPGARFELIDAVHMMPAQAPAPLLALLTDFLGAQAASNAQRAS |
| Ga0209813_100997681 | 3300027866 | Populus Endosphere | RFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS |
| Ga0209590_108141122 | 3300027882 | Vadose Zone Soil | RAIPGARFELIDAGHMMPAQAPGPLLRLLQDFLAVHAAHAG |
| Ga0247821_105068531 | 3300028596 | Soil | PDARFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS |
| Ga0307315_101384712 | 3300028721 | Soil | EQFAKTIPGARFELIDAVHMMPAQAPGPLLALLTDFLGAQAASNAQRAS |
| Ga0307288_101028311 | 3300028778 | Soil | ASEQFAQTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAQAASAAPRRAS |
| Ga0307282_101956222 | 3300028784 | Soil | EQFAKTIPGARFELIDAVHMMPAQAPGPLLALLTDFLGAQAASSAQHAS |
| Ga0307282_102601051 | 3300028784 | Soil | AQTIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTVKQRAS |
| Ga0307294_102643342 | 3300028810 | Soil | SEQFAQTIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS |
| Ga0307292_100218873 | 3300028811 | Soil | FAKTIPGVRFELIDAVHMMPAQAPGPLLALLTDFLGAQAASNAQRAS |
| Ga0307296_107093212 | 3300028819 | Soil | FELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAKQRAS |
| Ga0307286_101177272 | 3300028876 | Soil | IDAVHMMPAQAAGPLLALLEDFLGKQAASTVKQRAS |
| Ga0308183_11224131 | 3300030988 | Soil | SEQFAQTIPDARFELIDAVHMMPAQAAGPLLALLEDFLGKQAASTAQQRAS |
| Ga0307505_101384192 | 3300031455 | Soil | QTIPDARFELIDAVHMMPAQAAGPLLALLSDFLGKQAASTAKQRAS |
| Ga0318541_101467993 | 3300031545 | Soil | TIPGARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG |
| Ga0318572_102038701 | 3300031681 | Soil | ARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG |
| Ga0318496_100345364 | 3300031713 | Soil | EEFARTIPGARFELIDAVHMMPAQAAGSLLALLEDFLSTQAAARQGAQ |
| Ga0310813_120518052 | 3300031716 | Soil | RFELIDAVHMMPAQAPAALLALLQDFLHAQTRSAPRQRAG |
| Ga0318493_101561462 | 3300031723 | Soil | TIPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG |
| Ga0318493_104421851 | 3300031723 | Soil | DAVHMMPAQAPAPLLALLLDFFNAQTRSTTRQRAG |
| Ga0318500_101107653 | 3300031724 | Soil | IPDARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0318500_102556321 | 3300031724 | Soil | GARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG |
| Ga0318501_107842441 | 3300031736 | Soil | LIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0307468_1001459191 | 3300031740 | Hardwood Forest Soil | ELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS |
| Ga0318498_102353032 | 3300031778 | Soil | AASEQFARTIPGARFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG |
| Ga0318566_103326342 | 3300031779 | Soil | LIDAVHMMPAQAAHALLALLQDFLGAQAASATQQRAG |
| Ga0318552_102981482 | 3300031782 | Soil | IPGARFELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG |
| Ga0318548_104326862 | 3300031793 | Soil | FARTIPDARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0318497_105147012 | 3300031805 | Soil | RFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTQQRAG |
| Ga0318499_101474182 | 3300031832 | Soil | ARTIPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG |
| Ga0306919_103018783 | 3300031879 | Soil | RFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0318544_101817992 | 3300031880 | Soil | ELIDAVHMMPAQAPDALLALLHDFLGAQAASTTRQRTG |
| Ga0318520_100250094 | 3300031897 | Soil | EFARTIPGARFELIDAVHMMPAQAAGSLLALLEDFLSTQAAARQGAQ |
| Ga0318530_104081912 | 3300031959 | Soil | QFAQTIPGARFELIDAVHMMPAQAPAPLLALLLDFFNAQTRSTTRQRAG |
| Ga0318531_101440182 | 3300031981 | Soil | FELIDAVHMMPAQAPDALLALLQDFLGAQAASTTRQRAG |
| Ga0318569_103016181 | 3300032010 | Soil | TIPGARFELIDAVHMMPAQAPAPLLALLLDFFNAQTRSTTRQRAG |
| Ga0310902_111642791 | 3300032012 | Soil | DARFELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS |
| Ga0318545_103699942 | 3300032042 | Soil | ARTIPDARFELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0318570_104461251 | 3300032054 | Soil | KTSEEFARTIPGARFELIDAVHMMPAQAAGSLLALLEDFLSTQAAARQGAQ |
| Ga0318553_102973241 | 3300032068 | Soil | DAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0318525_102725491 | 3300032089 | Soil | YELIDAVHMMPAQAPDALLALLLDFLGAQAASTTRQRAG |
| Ga0318518_100783983 | 3300032090 | Soil | IPGVRFELIDAVHMMPAQAAGALLALLQDFLGAQAASTTRQRAG |
| Ga0307470_115569242 | 3300032174 | Hardwood Forest Soil | QFAQTIPNARFELIDAVHMMPAQAAGPLLALLNDFLGAHAASTAPRRAS |
| Ga0310914_115799822 | 3300033289 | Soil | IDAVHMMPAQAAGALLALLQDFLGAQAASTSQQRAG |
| Ga0364935_0110464_3_125 | 3300034151 | Sediment | RFELIDAVHMMPAQAAGPLLALLNDFLGKQAASTAKQRAS |
| ⦗Top⦘ |