| Basic Information | |
|---|---|
| Family ID | F069924 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGT |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.75 % |
| % of genes from short scaffolds (< 2000 bps) | 94.31 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.301 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.203 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.325 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.089 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF08022 | FAD_binding_8 | 56.10 |
| PF00175 | NAD_binding_1 | 38.21 |
| PF07883 | Cupin_2 | 0.81 |
| PF02861 | Clp_N | 0.81 |
| PF04205 | FMN_bind | 0.81 |
| PF02347 | GDC-P | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.81 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.30 % |
| Unclassified | root | N/A | 18.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig51161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300001593|JGI12635J15846_10392011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 840 | Open in IMG/M |
| 3300001593|JGI12635J15846_10801044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300001976|JGI24752J21851_1061069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100416427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1222 | Open in IMG/M |
| 3300004635|Ga0062388_100631843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 987 | Open in IMG/M |
| 3300005331|Ga0070670_100251129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1541 | Open in IMG/M |
| 3300005591|Ga0070761_10013917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 4496 | Open in IMG/M |
| 3300005602|Ga0070762_10425025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 860 | Open in IMG/M |
| 3300006794|Ga0066658_10587221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300007076|Ga0075435_100857392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300009162|Ga0075423_11090689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
| 3300009520|Ga0116214_1044631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1604 | Open in IMG/M |
| 3300009524|Ga0116225_1555512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300009698|Ga0116216_10117086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1640 | Open in IMG/M |
| 3300009698|Ga0116216_10767154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 578 | Open in IMG/M |
| 3300010303|Ga0134082_10223257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 775 | Open in IMG/M |
| 3300010398|Ga0126383_11014768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
| 3300010880|Ga0126350_12368323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 715 | Open in IMG/M |
| 3300012205|Ga0137362_11051781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 692 | Open in IMG/M |
| 3300012960|Ga0164301_10209904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1248 | Open in IMG/M |
| 3300012989|Ga0164305_10248836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1283 | Open in IMG/M |
| 3300012989|Ga0164305_11014635 | Not Available | 706 | Open in IMG/M |
| 3300014169|Ga0181531_10066770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2117 | Open in IMG/M |
| 3300014493|Ga0182016_10580388 | Not Available | 640 | Open in IMG/M |
| 3300014497|Ga0182008_10723179 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300014657|Ga0181522_10468921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 757 | Open in IMG/M |
| 3300015373|Ga0132257_102863840 | Not Available | 629 | Open in IMG/M |
| 3300016294|Ga0182041_11091785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300016422|Ga0182039_11168649 | Not Available | 694 | Open in IMG/M |
| 3300017924|Ga0187820_1132409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 739 | Open in IMG/M |
| 3300017926|Ga0187807_1004572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4235 | Open in IMG/M |
| 3300017970|Ga0187783_11295409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
| 3300018001|Ga0187815_10068580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1491 | Open in IMG/M |
| 3300018009|Ga0187884_10458330 | Not Available | 512 | Open in IMG/M |
| 3300018025|Ga0187885_10471286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 560 | Open in IMG/M |
| 3300018038|Ga0187855_10911211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 513 | Open in IMG/M |
| 3300018060|Ga0187765_11082416 | Not Available | 555 | Open in IMG/M |
| 3300018064|Ga0187773_11186328 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300018086|Ga0187769_11234965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300019877|Ga0193722_1091140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 739 | Open in IMG/M |
| 3300020579|Ga0210407_10296272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1263 | Open in IMG/M |
| 3300020581|Ga0210399_11062538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 649 | Open in IMG/M |
| 3300020582|Ga0210395_11232015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300021344|Ga0193719_10419779 | Not Available | 548 | Open in IMG/M |
| 3300021374|Ga0213881_10010834 | All Organisms → cellular organisms → Bacteria | 3733 | Open in IMG/M |
| 3300021407|Ga0210383_10132789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2109 | Open in IMG/M |
| 3300021441|Ga0213871_10259212 | Not Available | 554 | Open in IMG/M |
| 3300021475|Ga0210392_11418794 | Not Available | 519 | Open in IMG/M |
| 3300021477|Ga0210398_11570530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300021559|Ga0210409_11449709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
| 3300021560|Ga0126371_10775180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1106 | Open in IMG/M |
| 3300021560|Ga0126371_11519281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 797 | Open in IMG/M |
| 3300021560|Ga0126371_11919551 | Not Available | 711 | Open in IMG/M |
| 3300022529|Ga0242668_1006325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1459 | Open in IMG/M |
| 3300022840|Ga0224549_1010186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1372 | Open in IMG/M |
| 3300024323|Ga0247666_1015522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1651 | Open in IMG/M |
| 3300025735|Ga0207713_1131445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 828 | Open in IMG/M |
| 3300025913|Ga0207695_11140300 | Not Available | 660 | Open in IMG/M |
| 3300025920|Ga0207649_10136851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1671 | Open in IMG/M |
| 3300025922|Ga0207646_11381152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
| 3300025925|Ga0207650_10991308 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300025928|Ga0207700_10738985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
| 3300025935|Ga0207709_10510327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 940 | Open in IMG/M |
| 3300025941|Ga0207711_11087667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 740 | Open in IMG/M |
| 3300025949|Ga0207667_10315154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1598 | Open in IMG/M |
| 3300026035|Ga0207703_11501877 | Not Available | 648 | Open in IMG/M |
| 3300026078|Ga0207702_10803912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 929 | Open in IMG/M |
| 3300026551|Ga0209648_10421936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 854 | Open in IMG/M |
| 3300027049|Ga0207806_1036981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300027330|Ga0207777_1047250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 766 | Open in IMG/M |
| 3300027505|Ga0209218_1133745 | Not Available | 523 | Open in IMG/M |
| 3300027652|Ga0209007_1026839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300027725|Ga0209178_1086328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1036 | Open in IMG/M |
| 3300027884|Ga0209275_10194155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1095 | Open in IMG/M |
| 3300027908|Ga0209006_10117589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2349 | Open in IMG/M |
| 3300028380|Ga0268265_10281224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1489 | Open in IMG/M |
| 3300028801|Ga0302226_10138554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1063 | Open in IMG/M |
| 3300028806|Ga0302221_10390613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 606 | Open in IMG/M |
| 3300028811|Ga0307292_10411782 | Not Available | 575 | Open in IMG/M |
| 3300028872|Ga0307314_10262161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300028884|Ga0307308_10397554 | Not Available | 660 | Open in IMG/M |
| 3300029910|Ga0311369_10817448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 752 | Open in IMG/M |
| 3300029943|Ga0311340_10526560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1050 | Open in IMG/M |
| 3300029999|Ga0311339_10425672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1376 | Open in IMG/M |
| 3300030056|Ga0302181_10366784 | Not Available | 626 | Open in IMG/M |
| 3300030058|Ga0302179_10182073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 928 | Open in IMG/M |
| 3300030058|Ga0302179_10195312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 894 | Open in IMG/M |
| 3300030503|Ga0311370_11454811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 720 | Open in IMG/M |
| 3300030503|Ga0311370_11978591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 583 | Open in IMG/M |
| 3300030594|Ga0210280_1035737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 800 | Open in IMG/M |
| 3300030730|Ga0307482_1150526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 678 | Open in IMG/M |
| 3300030906|Ga0302314_11230413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 699 | Open in IMG/M |
| 3300031525|Ga0302326_12654459 | Not Available | 623 | Open in IMG/M |
| 3300031543|Ga0318516_10210278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1124 | Open in IMG/M |
| 3300031549|Ga0318571_10226778 | Not Available | 679 | Open in IMG/M |
| 3300031564|Ga0318573_10117319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1378 | Open in IMG/M |
| 3300031572|Ga0318515_10552690 | Not Available | 613 | Open in IMG/M |
| 3300031640|Ga0318555_10638339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 576 | Open in IMG/M |
| 3300031713|Ga0318496_10717503 | Not Available | 551 | Open in IMG/M |
| 3300031724|Ga0318500_10158959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1066 | Open in IMG/M |
| 3300031754|Ga0307475_10684851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 818 | Open in IMG/M |
| 3300031768|Ga0318509_10173009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1196 | Open in IMG/M |
| 3300031769|Ga0318526_10136501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 994 | Open in IMG/M |
| 3300031781|Ga0318547_10149514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1372 | Open in IMG/M |
| 3300031796|Ga0318576_10059643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1673 | Open in IMG/M |
| 3300031805|Ga0318497_10027304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2826 | Open in IMG/M |
| 3300031819|Ga0318568_10246493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1106 | Open in IMG/M |
| 3300031819|Ga0318568_10522322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 740 | Open in IMG/M |
| 3300031896|Ga0318551_10325448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 867 | Open in IMG/M |
| 3300031942|Ga0310916_10780936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 805 | Open in IMG/M |
| 3300031942|Ga0310916_11386785 | Not Available | 576 | Open in IMG/M |
| 3300031943|Ga0310885_10886691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 511 | Open in IMG/M |
| 3300032001|Ga0306922_12420256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300032010|Ga0318569_10086538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1403 | Open in IMG/M |
| 3300032035|Ga0310911_10778773 | Not Available | 553 | Open in IMG/M |
| 3300032039|Ga0318559_10313133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 729 | Open in IMG/M |
| 3300032060|Ga0318505_10257777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 821 | Open in IMG/M |
| 3300032074|Ga0308173_11290164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album | 684 | Open in IMG/M |
| 3300032174|Ga0307470_11390754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 579 | Open in IMG/M |
| 3300032205|Ga0307472_101867204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300032261|Ga0306920_101462188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 977 | Open in IMG/M |
| 3300034163|Ga0370515_0350485 | Not Available | 623 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.20% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.25% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.44% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.81% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.81% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.81% | |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030594 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_02350020 | 2124908016 | MRRAILAVTGTIAGLVALLSFRSHVPSAPVAATTGGTGGTSTSSSSTS | |
| JGI12635J15846_103920111 | 3300001593 | Forest Soil | MRRVILAIVGTVAGLVALLSFKSHVPSLPSAAAASTGGSGTSV |
| JGI12635J15846_108010441 | 3300001593 | Forest Soil | MRRVILTIVGTIAGLVALLSFKSHLPTAPSAAVSTTGG |
| JGI24752J21851_10610691 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTS |
| JGIcombinedJ26739_1004164272 | 3300002245 | Forest Soil | MRRVILAVTGTIAGLVALLSFKAHVPTMPVAATTGTGG |
| Ga0062388_1006318431 | 3300004635 | Bog Forest Soil | MRRAILAVTGTIAGLVALLSFKSHDPTVPVASTSGTSGGSS |
| Ga0070670_1002511292 | 3300005331 | Switchgrass Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSS |
| Ga0070761_100139171 | 3300005591 | Soil | MRRAILAVTGTIAGLVALLSFKSHDPAVPVASTSGTSGGSSTSSSPS |
| Ga0070762_104250251 | 3300005602 | Soil | MRRVIIAIVATVAGLVALLSFKSHTPATVADTGTTTGG |
| Ga0066658_105872212 | 3300006794 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSVPVAATAGGSG |
| Ga0075435_1008573922 | 3300007076 | Populus Rhizosphere | MRRVILAITGTIAGLVALLSFKSHVPSAPVAATTGGTGGTS |
| Ga0075423_110906892 | 3300009162 | Populus Rhizosphere | MRRAILAVTGAIAGLVALLSFKSHVPSAPVAATTGG |
| Ga0116214_10446311 | 3300009520 | Peatlands Soil | MRRVILAVTGTIAGLVALLSFKSHVPSVPVAATTGGSGGS |
| Ga0116225_15555121 | 3300009524 | Peatlands Soil | MRRVILAVTGTIAGLVALLSFKSHVPSVPVAATTGGSGGSSSSSA |
| Ga0116216_101170862 | 3300009698 | Peatlands Soil | MRRVILAVTGTIAGLVALLSFKSHDPTMPVAATTGTGGGSTTSSSSS |
| Ga0116216_107671541 | 3300009698 | Peatlands Soil | MRRVILAVVGTIAGLVALLSFKSHSPVLPVASTSGTGGGSSASSTSS |
| Ga0134082_102232572 | 3300010303 | Grasslands Soil | MRRVILAVAGTIAGLVALLSFKSHVPSAPVAATTGGAGGT |
| Ga0126383_110147681 | 3300010398 | Tropical Forest Soil | MRRVILAVTGTIAGLVALLSFKSHAPALPVAATSGTG |
| Ga0126350_123683233 | 3300010880 | Boreal Forest Soil | MRRVILTIAGTVAGLVALLSFKSHVPSVSSASTATTSGASS |
| Ga0137362_110517811 | 3300012205 | Vadose Zone Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGSGGTSS |
| Ga0164301_102099041 | 3300012960 | Soil | MRRVILAVAGTIAGLVTLLSFKSHVPSAPVAVTTGGAGGTSS |
| Ga0164305_102488361 | 3300012989 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTST |
| Ga0164305_110146351 | 3300012989 | Soil | MRRVILAVTGTIAGLAALLSFKSHVPSSPLAATASGSGGTSAAGASP |
| Ga0181531_100667701 | 3300014169 | Bog | MRRVILAVTATIAGLVALLSFKSHVPAIAAATSGTGVSSGGTSGSGSGS |
| Ga0182016_105803882 | 3300014493 | Bog | MRRVILTIAGTIAGLVALLSFKSHVPSVPSASAATTGGT |
| Ga0182008_107231791 | 3300014497 | Rhizosphere | MRRAILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGTS |
| Ga0181522_104689211 | 3300014657 | Bog | MRRVILAVTGTIAGLVALLSFKSHDPTMPVAATSGTGGASSSS |
| Ga0132257_1028638402 | 3300015373 | Arabidopsis Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHIPSAPVAATAGGS |
| Ga0182041_110917852 | 3300016294 | Soil | MRRVILAVTGTVAGLVALLSFKSHSPTVPVAATTGT |
| Ga0182039_111686491 | 3300016422 | Soil | MRRVILAVTGTIAGLVALLSFKSHSPTMPVAATTGTVSGSSS |
| Ga0187820_11324092 | 3300017924 | Freshwater Sediment | MRRVILAVTGTIAGLVALLSFKTHAPSLSAAATSGT |
| Ga0187807_10045721 | 3300017926 | Freshwater Sediment | MRRVILAVTGTIAGLVALLSFKSHVPSIPVAATTGGSGSSS |
| Ga0187783_112954091 | 3300017970 | Tropical Peatland | MRRVILAITGTVAGLVALLSFKAHVPAVPSASAATTGSGG |
| Ga0187815_100685803 | 3300018001 | Freshwater Sediment | MRRVILAVTGTIAGLVALLSFKSHVPSIPVAATTGGSGSSSSSPT |
| Ga0187884_104583302 | 3300018009 | Peatland | MRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGG |
| Ga0187885_104712861 | 3300018025 | Peatland | MRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGSSGTGGT |
| Ga0187855_109112111 | 3300018038 | Peatland | MRRVILAVVGTVAGLVALLSFKSHLPTVPSAAVSTTGGTSGTSGT |
| Ga0187765_110824162 | 3300018060 | Tropical Peatland | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGS |
| Ga0187773_111863282 | 3300018064 | Tropical Peatland | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGTAGAVSVA |
| Ga0187769_112349651 | 3300018086 | Tropical Peatland | MRRVILAVTGTFAGLVALLSFKSHAPSLPVAATSGTSGGSLLSSSPTAPGEFPT |
| Ga0193722_10911402 | 3300019877 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGTSSSSSS |
| Ga0210407_102962722 | 3300020579 | Soil | MRRVILAVAGTIAGLVALLSFKSHVPSAPVAATTGGAGGPSPS |
| Ga0210399_110625381 | 3300020581 | Soil | MRRVILAVAGTIAGLVALLSFKSHVPSAPVAVTTGGAGGTSSSS |
| Ga0210395_112320151 | 3300020582 | Soil | MRRVILAVTGTIAGLLALLGFRSHVPTSAAAVSARTAPGGTGGTPSAA |
| Ga0193719_104197792 | 3300021344 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPLAATTGGTGS |
| Ga0213881_100108341 | 3300021374 | Exposed Rock | MRRVILAVTGTVAGLVALLSFKSHAPSVAVAATGGPGGASSSP |
| Ga0210383_101327891 | 3300021407 | Soil | MRRVILAVTATIAGLVALLSFKSHAPTLAAATGTTGGS |
| Ga0213871_102592122 | 3300021441 | Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHSPTVPVASTSGTSGGSSS |
| Ga0210392_114187941 | 3300021475 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGT |
| Ga0210398_115705302 | 3300021477 | Soil | MRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGSSSTGGTSA |
| Ga0210409_114497092 | 3300021559 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGAAS |
| Ga0126371_107751801 | 3300021560 | Tropical Forest Soil | MRRAIIAITGTIAGLVALLSFKSHVPSVPSAAAAGGT |
| Ga0126371_115192811 | 3300021560 | Tropical Forest Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGG |
| Ga0126371_119195511 | 3300021560 | Tropical Forest Soil | MRRVILAVTGTIAGLAALLSFKSHVPSSPLASTASGAGGTSA |
| Ga0242668_10063252 | 3300022529 | Soil | MRRVILAVTGTIAGLVALLSFKAHVPTVPVASTSGTGGSSTSS |
| Ga0224549_10101861 | 3300022840 | Soil | MRRVILAVTGTIAGLVALLSFKSHDPTMPVAATSGT |
| Ga0247666_10155222 | 3300024323 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGAGGTSSS |
| Ga0207713_11314452 | 3300025735 | Switchgrass Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSTSP |
| Ga0207695_111403001 | 3300025913 | Corn Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSSTSPSSSGG |
| Ga0207649_101368512 | 3300025920 | Corn Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGT |
| Ga0207646_113811521 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGG |
| Ga0207650_109913081 | 3300025925 | Switchgrass Rhizosphere | MRRVILAVTGTIAGLAALLSFKSHVPSSPLAVTASGSGGTPAAGASPSA |
| Ga0207700_107389851 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRVILAVAGTIAGLVALLSFKSHVPSAPVAATTGGAGG |
| Ga0207709_105103271 | 3300025935 | Miscanthus Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGT |
| Ga0207711_110876671 | 3300025941 | Switchgrass Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSPSSSGGGQ |
| Ga0207667_103151541 | 3300025949 | Corn Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGISTSSTSGGGQTE |
| Ga0207703_115018771 | 3300026035 | Switchgrass Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSSTSPS |
| Ga0207702_108039122 | 3300026078 | Corn Rhizosphere | MRRVILAVTGTIAGLAALLSFKSHVPSSPLAATASGSGGTSAAG |
| Ga0209648_104219361 | 3300026551 | Grasslands Soil | MRRVILAVTGTIAGLVALLSFKAHVPTVPVAATSGT |
| Ga0207806_10369812 | 3300027049 | Tropical Forest Soil | MRRVILAVTGTIAGLVALLSFKSHAPSLSAAATGGTS |
| Ga0207777_10472501 | 3300027330 | Tropical Forest Soil | MRRVILAVTGTIAGLVALLSFKSHAPSLSAAATGGTSGG |
| Ga0209218_11337452 | 3300027505 | Forest Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGTSTSSTSTSPS |
| Ga0209007_10268392 | 3300027652 | Forest Soil | MRRAILAVVSTIAGLVALLSFKSHVPAIAAATKCPGQCP |
| Ga0209178_10863282 | 3300027725 | Agricultural Soil | MRRVILAVTGTIAGLAALLSFKSHVPSSPLAVTASGSGGTPAAGAS |
| Ga0209275_101941551 | 3300027884 | Soil | MRRVIIAIVATVAGLVALLSFKSHTPATVADTGTTTGGTATSEP |
| Ga0209006_101175891 | 3300027908 | Forest Soil | MRRVILAVTGTIAGLVALLSFKAHVPTVPVAATTGTGGGSSTS |
| Ga0268265_102812242 | 3300028380 | Switchgrass Rhizosphere | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGG |
| Ga0302226_101385542 | 3300028801 | Palsa | MRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGT |
| Ga0302221_103906132 | 3300028806 | Palsa | MRRVVLTIVVTIAGLVALLSFKSHLPTAPSAAVSTTGGTS |
| Ga0307292_104117821 | 3300028811 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPAAPVAATTGGTGGTSAS |
| Ga0307314_102621612 | 3300028872 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPLAATTGGTGSTST |
| Ga0307308_103975542 | 3300028884 | Soil | MRRVILAVAGTIAGLVALLSFKSHVPSAPVAATTGGSGGTSSSSS |
| Ga0311369_108174481 | 3300029910 | Palsa | MRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGTSGTSGTGGTP |
| Ga0311340_105265602 | 3300029943 | Palsa | MRRVILTIVGTIAGLVALLSFKSHLPTAPSASVSTAGGS |
| Ga0311339_104256721 | 3300029999 | Palsa | MRRVILTIVGTVAGLVALLSFKSHLPTAASAAVSTTGGTGSTSGT |
| Ga0302181_103667842 | 3300030056 | Palsa | MRRVILAVTGTIAGLVALLSFKSHDPTMPVAATSGTGGASS |
| Ga0302179_101820732 | 3300030058 | Palsa | MRRVILTIAGTIAGLVALLSFKSHLPTIPSASVSTTGGSS |
| Ga0302179_101953121 | 3300030058 | Palsa | MRRVILTIVGTIAGLVALLSFKSHLPTVPSASVSN |
| Ga0311370_114548112 | 3300030503 | Palsa | MRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGSGTAGT |
| Ga0311370_119785912 | 3300030503 | Palsa | MRRVILAVVGTVAGLVALLSFKSHLPTVPSAAVSTTGGTSGT |
| Ga0210280_10357371 | 3300030594 | Soil | MRRVILTIVGTIAGLVALLSFKSHLPTAPSAAVSTTGGTGSAGGTPAASS |
| Ga0307482_11505261 | 3300030730 | Hardwood Forest Soil | MRRAILAITATIAGLVALLTFKSHAPTIPTATVSGTGGGTSSSSSSG |
| Ga0302314_112304131 | 3300030906 | Palsa | MRRVILTIVGTIAGLVALLSFKSHLPTAPSASVSTAGG |
| Ga0302326_126544592 | 3300031525 | Palsa | MRRVILAVTGTIAGLVALLSFKSHDPTMPVAATSGTGGAS |
| Ga0318516_102102781 | 3300031543 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATVGGSG |
| Ga0318571_102267782 | 3300031549 | Soil | MRRVILAVTGTVAGLVALLSFKSHSPTVPVAATTGTGGAS |
| Ga0318573_101173192 | 3300031564 | Soil | MRRVILAVTGTIAGLAALLSFKSHVPSAPVAATVGGSGGTA |
| Ga0318515_105526901 | 3300031572 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSVPAAATSGGSGG |
| Ga0318555_106383391 | 3300031640 | Soil | MRRVILAVTGTIAGLVALLSFKSHSPAVPVAATTGTAGGSSSSS |
| Ga0318496_107175032 | 3300031713 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSVPAAATSGGSGGSSS |
| Ga0318500_101589592 | 3300031724 | Soil | MRRVILAVTGTIAGLVALLSFKSHAPSLPAAATTGTSGGSSSSS |
| Ga0307475_106848511 | 3300031754 | Hardwood Forest Soil | MRRVILAVTGTIAGLVALLSFKAHVPTVPVAATSGTG |
| Ga0318509_101730092 | 3300031768 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGTAA |
| Ga0318526_101365011 | 3300031769 | Soil | MRRVILAVTGTVAGLVALLSFKSHVPSVPVAATTGGSGGTSSSS |
| Ga0318547_101495142 | 3300031781 | Soil | MRRVILAVTGTIAGLVALLSFKSHAPSLSAAATSGTGAG |
| Ga0318576_100596431 | 3300031796 | Soil | MRRVILAVTGTIAGLVALLSFKSHAPSLSAAATSGTGAGSS |
| Ga0318497_100273045 | 3300031805 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSG |
| Ga0318568_102464932 | 3300031819 | Soil | MRRVILAVTATIAGLVALLSFKSHAPALPAAATSGTGGGSSAAS |
| Ga0318568_105223222 | 3300031819 | Soil | MRRVIFAVTGTVAGLVALLSFKSHSPTVPVAATSG |
| Ga0318551_103254481 | 3300031896 | Soil | MRRVILAVTGTIAGLVALLSFRSHVPSAPVAVTTGGSGG |
| Ga0310916_107809361 | 3300031942 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGPGGTSSSSA |
| Ga0310916_113867852 | 3300031942 | Soil | MRRVILAVTGTIAGLVALLSFKSHAPSLPAAATTGTSGGSSSSSTTVQGEFFT |
| Ga0310885_108866912 | 3300031943 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSSTSPSSSGGGQ |
| Ga0306922_124202561 | 3300032001 | Soil | MRRAILAITGTVAGLVALLSFKSHVPSIPSAAASGTGSGTGAAAPA |
| Ga0318569_100865381 | 3300032010 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGTAASS |
| Ga0310911_107787732 | 3300032035 | Soil | MRRVILAVTGTIAGLVALLSFKSHAPSLPAAATTG |
| Ga0318559_103131333 | 3300032039 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGPGGTSSSSAPSSS |
| Ga0318505_102577772 | 3300032060 | Soil | MRRVILAVTGTVAGLVALLSFKSHSPTVPVTARIT |
| Ga0308173_112901642 | 3300032074 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGG |
| Ga0307470_113907542 | 3300032174 | Hardwood Forest Soil | MRRVVLTVTGTIAGLVALLSFKSHVPSSPVAAASGSGGST |
| Ga0307472_1018672041 | 3300032205 | Hardwood Forest Soil | MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGPG |
| Ga0306920_1014621882 | 3300032261 | Soil | MRRVILAVTGTIAGLVALLSFKSHVPSVPAAATSGG |
| Ga0370515_0350485_2_130 | 3300034163 | Untreated Peat Soil | MRRVILTIAGTIAGLVALLSFKSHVPTIPSASVSTTGGTSSAS |
| ⦗Top⦘ |