NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069924

Metagenome / Metatranscriptome Family F069924

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069924
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 42 residues
Representative Sequence MRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGT
Number of Associated Samples 114
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 96.75 %
% of genes from short scaffolds (< 2000 bps) 94.31 %
Associated GOLD sequencing projects 110
AlphaFold2 3D model prediction Yes
3D model pTM-score0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (81.301 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.203 % of family members)
Environment Ontology (ENVO) Unclassified
(20.325 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.089 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: Yes Secondary Structure distribution: α-helix: 32.35%    β-sheet: 0.00%    Coil/Unstructured: 67.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF08022FAD_binding_8 56.10
PF00175NAD_binding_1 38.21
PF07883Cupin_2 0.81
PF02861Clp_N 0.81
PF04205FMN_bind 0.81
PF02347GDC-P 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG0403Glycine cleavage system protein P (pyridoxal-binding), N-terminal domainAmino acid transport and metabolism [E] 0.81
COG0542ATP-dependent Clp protease, ATP-binding subunit ClpAPosttranslational modification, protein turnover, chaperones [O] 0.81
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.30 %
UnclassifiedrootN/A18.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig51161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300001593|JGI12635J15846_10392011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album840Open in IMG/M
3300001593|JGI12635J15846_10801044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300001976|JGI24752J21851_1061069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300002245|JGIcombinedJ26739_100416427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1222Open in IMG/M
3300004635|Ga0062388_100631843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300005331|Ga0070670_100251129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1541Open in IMG/M
3300005591|Ga0070761_10013917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae4496Open in IMG/M
3300005602|Ga0070762_10425025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia860Open in IMG/M
3300006794|Ga0066658_10587221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300007076|Ga0075435_100857392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300009162|Ga0075423_11090689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia850Open in IMG/M
3300009520|Ga0116214_1044631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1604Open in IMG/M
3300009524|Ga0116225_1555512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300009698|Ga0116216_10117086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1640Open in IMG/M
3300009698|Ga0116216_10767154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300010303|Ga0134082_10223257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album775Open in IMG/M
3300010398|Ga0126383_11014768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia918Open in IMG/M
3300010880|Ga0126350_12368323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia715Open in IMG/M
3300012205|Ga0137362_11051781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album692Open in IMG/M
3300012960|Ga0164301_10209904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1248Open in IMG/M
3300012989|Ga0164305_10248836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1283Open in IMG/M
3300012989|Ga0164305_11014635Not Available706Open in IMG/M
3300014169|Ga0181531_10066770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2117Open in IMG/M
3300014493|Ga0182016_10580388Not Available640Open in IMG/M
3300014497|Ga0182008_10723179All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300014657|Ga0181522_10468921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album757Open in IMG/M
3300015373|Ga0132257_102863840Not Available629Open in IMG/M
3300016294|Ga0182041_11091785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia724Open in IMG/M
3300016422|Ga0182039_11168649Not Available694Open in IMG/M
3300017924|Ga0187820_1132409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album739Open in IMG/M
3300017926|Ga0187807_1004572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4235Open in IMG/M
3300017970|Ga0187783_11295409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia525Open in IMG/M
3300018001|Ga0187815_10068580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1491Open in IMG/M
3300018009|Ga0187884_10458330Not Available512Open in IMG/M
3300018025|Ga0187885_10471286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia560Open in IMG/M
3300018038|Ga0187855_10911211All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia513Open in IMG/M
3300018060|Ga0187765_11082416Not Available555Open in IMG/M
3300018064|Ga0187773_11186328All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300018086|Ga0187769_11234965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300019877|Ga0193722_1091140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album739Open in IMG/M
3300020579|Ga0210407_10296272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1263Open in IMG/M
3300020581|Ga0210399_11062538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album649Open in IMG/M
3300020582|Ga0210395_11232015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia549Open in IMG/M
3300021344|Ga0193719_10419779Not Available548Open in IMG/M
3300021374|Ga0213881_10010834All Organisms → cellular organisms → Bacteria3733Open in IMG/M
3300021407|Ga0210383_10132789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2109Open in IMG/M
3300021441|Ga0213871_10259212Not Available554Open in IMG/M
3300021475|Ga0210392_11418794Not Available519Open in IMG/M
3300021477|Ga0210398_11570530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300021559|Ga0210409_11449709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300021560|Ga0126371_10775180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1106Open in IMG/M
3300021560|Ga0126371_11519281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album797Open in IMG/M
3300021560|Ga0126371_11919551Not Available711Open in IMG/M
3300022529|Ga0242668_1006325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1459Open in IMG/M
3300022840|Ga0224549_1010186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1372Open in IMG/M
3300024323|Ga0247666_1015522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1651Open in IMG/M
3300025735|Ga0207713_1131445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album828Open in IMG/M
3300025913|Ga0207695_11140300Not Available660Open in IMG/M
3300025920|Ga0207649_10136851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1671Open in IMG/M
3300025922|Ga0207646_11381152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia613Open in IMG/M
3300025925|Ga0207650_10991308All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300025928|Ga0207700_10738985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia879Open in IMG/M
3300025935|Ga0207709_10510327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia940Open in IMG/M
3300025941|Ga0207711_11087667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album740Open in IMG/M
3300025949|Ga0207667_10315154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1598Open in IMG/M
3300026035|Ga0207703_11501877Not Available648Open in IMG/M
3300026078|Ga0207702_10803912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia929Open in IMG/M
3300026551|Ga0209648_10421936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia854Open in IMG/M
3300027049|Ga0207806_1036981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300027330|Ga0207777_1047250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album766Open in IMG/M
3300027505|Ga0209218_1133745Not Available523Open in IMG/M
3300027652|Ga0209007_1026839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1481Open in IMG/M
3300027725|Ga0209178_1086328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1036Open in IMG/M
3300027884|Ga0209275_10194155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1095Open in IMG/M
3300027908|Ga0209006_10117589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2349Open in IMG/M
3300028380|Ga0268265_10281224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1489Open in IMG/M
3300028801|Ga0302226_10138554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1063Open in IMG/M
3300028806|Ga0302221_10390613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album606Open in IMG/M
3300028811|Ga0307292_10411782Not Available575Open in IMG/M
3300028872|Ga0307314_10262161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia540Open in IMG/M
3300028884|Ga0307308_10397554Not Available660Open in IMG/M
3300029910|Ga0311369_10817448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album752Open in IMG/M
3300029943|Ga0311340_10526560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1050Open in IMG/M
3300029999|Ga0311339_10425672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1376Open in IMG/M
3300030056|Ga0302181_10366784Not Available626Open in IMG/M
3300030058|Ga0302179_10182073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia928Open in IMG/M
3300030058|Ga0302179_10195312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia894Open in IMG/M
3300030503|Ga0311370_11454811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album720Open in IMG/M
3300030503|Ga0311370_11978591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia583Open in IMG/M
3300030594|Ga0210280_1035737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album800Open in IMG/M
3300030730|Ga0307482_1150526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria678Open in IMG/M
3300030906|Ga0302314_11230413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album699Open in IMG/M
3300031525|Ga0302326_12654459Not Available623Open in IMG/M
3300031543|Ga0318516_10210278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1124Open in IMG/M
3300031549|Ga0318571_10226778Not Available679Open in IMG/M
3300031564|Ga0318573_10117319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1378Open in IMG/M
3300031572|Ga0318515_10552690Not Available613Open in IMG/M
3300031640|Ga0318555_10638339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M
3300031713|Ga0318496_10717503Not Available551Open in IMG/M
3300031724|Ga0318500_10158959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1066Open in IMG/M
3300031754|Ga0307475_10684851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia818Open in IMG/M
3300031768|Ga0318509_10173009All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1196Open in IMG/M
3300031769|Ga0318526_10136501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia994Open in IMG/M
3300031781|Ga0318547_10149514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1372Open in IMG/M
3300031796|Ga0318576_10059643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1673Open in IMG/M
3300031805|Ga0318497_10027304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2826Open in IMG/M
3300031819|Ga0318568_10246493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1106Open in IMG/M
3300031819|Ga0318568_10522322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album740Open in IMG/M
3300031896|Ga0318551_10325448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia867Open in IMG/M
3300031942|Ga0310916_10780936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album805Open in IMG/M
3300031942|Ga0310916_11386785Not Available576Open in IMG/M
3300031943|Ga0310885_10886691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300032001|Ga0306922_12420256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300032010|Ga0318569_10086538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1403Open in IMG/M
3300032035|Ga0310911_10778773Not Available553Open in IMG/M
3300032039|Ga0318559_10313133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album729Open in IMG/M
3300032060|Ga0318505_10257777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album821Open in IMG/M
3300032074|Ga0308173_11290164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium album684Open in IMG/M
3300032174|Ga0307470_11390754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300032205|Ga0307472_101867204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300032261|Ga0306920_101462188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia977Open in IMG/M
3300034163|Ga0370515_0350485Not Available623Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.20%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa9.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.25%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.25%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.25%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.25%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.44%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.44%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.44%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.63%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.63%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.63%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.63%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.81%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.81%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.81%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.81%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.81%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.81%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001976Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7Host-AssociatedOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021441Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1Host-AssociatedOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025735Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027049Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes)EnvironmentalOpen in IMG/M
3300027330Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes)EnvironmentalOpen in IMG/M
3300027505Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028806Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_023500202124908016MRRAILAVTGTIAGLVALLSFRSHVPSAPVAATTGGTGGTSTSSSSTS
JGI12635J15846_1039201113300001593Forest SoilMRRVILAIVGTVAGLVALLSFKSHVPSLPSAAAASTGGSGTSV
JGI12635J15846_1080104413300001593Forest SoilMRRVILTIVGTIAGLVALLSFKSHLPTAPSAAVSTTGG
JGI24752J21851_106106913300001976Corn, Switchgrass And Miscanthus RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTS
JGIcombinedJ26739_10041642723300002245Forest SoilMRRVILAVTGTIAGLVALLSFKAHVPTMPVAATTGTGG
Ga0062388_10063184313300004635Bog Forest SoilMRRAILAVTGTIAGLVALLSFKSHDPTVPVASTSGTSGGSS
Ga0070670_10025112923300005331Switchgrass RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSS
Ga0070761_1001391713300005591SoilMRRAILAVTGTIAGLVALLSFKSHDPAVPVASTSGTSGGSSTSSSPS
Ga0070762_1042502513300005602SoilMRRVIIAIVATVAGLVALLSFKSHTPATVADTGTTTGG
Ga0066658_1058722123300006794SoilMRRVILAVTGTIAGLVALLSFKSHVPSVPVAATAGGSG
Ga0075435_10085739223300007076Populus RhizosphereMRRVILAITGTIAGLVALLSFKSHVPSAPVAATTGGTGGTS
Ga0075423_1109068923300009162Populus RhizosphereMRRAILAVTGAIAGLVALLSFKSHVPSAPVAATTGG
Ga0116214_104463113300009520Peatlands SoilMRRVILAVTGTIAGLVALLSFKSHVPSVPVAATTGGSGGS
Ga0116225_155551213300009524Peatlands SoilMRRVILAVTGTIAGLVALLSFKSHVPSVPVAATTGGSGGSSSSSA
Ga0116216_1011708623300009698Peatlands SoilMRRVILAVTGTIAGLVALLSFKSHDPTMPVAATTGTGGGSTTSSSSS
Ga0116216_1076715413300009698Peatlands SoilMRRVILAVVGTIAGLVALLSFKSHSPVLPVASTSGTGGGSSASSTSS
Ga0134082_1022325723300010303Grasslands SoilMRRVILAVAGTIAGLVALLSFKSHVPSAPVAATTGGAGGT
Ga0126383_1101476813300010398Tropical Forest SoilMRRVILAVTGTIAGLVALLSFKSHAPALPVAATSGTG
Ga0126350_1236832333300010880Boreal Forest SoilMRRVILTIAGTVAGLVALLSFKSHVPSVSSASTATTSGASS
Ga0137362_1105178113300012205Vadose Zone SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGSGGTSS
Ga0164301_1020990413300012960SoilMRRVILAVAGTIAGLVTLLSFKSHVPSAPVAVTTGGAGGTSS
Ga0164305_1024883613300012989SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTST
Ga0164305_1101463513300012989SoilMRRVILAVTGTIAGLAALLSFKSHVPSSPLAATASGSGGTSAAGASP
Ga0181531_1006677013300014169BogMRRVILAVTATIAGLVALLSFKSHVPAIAAATSGTGVSSGGTSGSGSGS
Ga0182016_1058038823300014493BogMRRVILTIAGTIAGLVALLSFKSHVPSVPSASAATTGGT
Ga0182008_1072317913300014497RhizosphereMRRAILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGTS
Ga0181522_1046892113300014657BogMRRVILAVTGTIAGLVALLSFKSHDPTMPVAATSGTGGASSSS
Ga0132257_10286384023300015373Arabidopsis RhizosphereMRRVILAVTGTIAGLVALLSFKSHIPSAPVAATAGGS
Ga0182041_1109178523300016294SoilMRRVILAVTGTVAGLVALLSFKSHSPTVPVAATTGT
Ga0182039_1116864913300016422SoilMRRVILAVTGTIAGLVALLSFKSHSPTMPVAATTGTVSGSSS
Ga0187820_113240923300017924Freshwater SedimentMRRVILAVTGTIAGLVALLSFKTHAPSLSAAATSGT
Ga0187807_100457213300017926Freshwater SedimentMRRVILAVTGTIAGLVALLSFKSHVPSIPVAATTGGSGSSS
Ga0187783_1129540913300017970Tropical PeatlandMRRVILAITGTVAGLVALLSFKAHVPAVPSASAATTGSGG
Ga0187815_1006858033300018001Freshwater SedimentMRRVILAVTGTIAGLVALLSFKSHVPSIPVAATTGGSGSSSSSPT
Ga0187884_1045833023300018009PeatlandMRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGG
Ga0187885_1047128613300018025PeatlandMRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGSSGTGGT
Ga0187855_1091121113300018038PeatlandMRRVILAVVGTVAGLVALLSFKSHLPTVPSAAVSTTGGTSGTSGT
Ga0187765_1108241623300018060Tropical PeatlandMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGS
Ga0187773_1118632823300018064Tropical PeatlandMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGTAGAVSVA
Ga0187769_1123496513300018086Tropical PeatlandMRRVILAVTGTFAGLVALLSFKSHAPSLPVAATSGTSGGSLLSSSPTAPGEFPT
Ga0193722_109114023300019877SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGTSSSSSS
Ga0210407_1029627223300020579SoilMRRVILAVAGTIAGLVALLSFKSHVPSAPVAATTGGAGGPSPS
Ga0210399_1106253813300020581SoilMRRVILAVAGTIAGLVALLSFKSHVPSAPVAVTTGGAGGTSSSS
Ga0210395_1123201513300020582SoilMRRVILAVTGTIAGLLALLGFRSHVPTSAAAVSARTAPGGTGGTPSAA
Ga0193719_1041977923300021344SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPLAATTGGTGS
Ga0213881_1001083413300021374Exposed RockMRRVILAVTGTVAGLVALLSFKSHAPSVAVAATGGPGGASSSP
Ga0210383_1013278913300021407SoilMRRVILAVTATIAGLVALLSFKSHAPTLAAATGTTGGS
Ga0213871_1025921223300021441RhizosphereMRRVILAVTGTIAGLVALLSFKSHSPTVPVASTSGTSGGSSS
Ga0210392_1141879413300021475SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGT
Ga0210398_1157053023300021477SoilMRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGSSSTGGTSA
Ga0210409_1144970923300021559SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGAAS
Ga0126371_1077518013300021560Tropical Forest SoilMRRAIIAITGTIAGLVALLSFKSHVPSVPSAAAAGGT
Ga0126371_1151928113300021560Tropical Forest SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGG
Ga0126371_1191955113300021560Tropical Forest SoilMRRVILAVTGTIAGLAALLSFKSHVPSSPLASTASGAGGTSA
Ga0242668_100632523300022529SoilMRRVILAVTGTIAGLVALLSFKAHVPTVPVASTSGTGGSSTSS
Ga0224549_101018613300022840SoilMRRVILAVTGTIAGLVALLSFKSHDPTMPVAATSGT
Ga0247666_101552223300024323SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGAGGTSSS
Ga0207713_113144523300025735Switchgrass RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSTSP
Ga0207695_1114030013300025913Corn RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSSTSPSSSGG
Ga0207649_1013685123300025920Corn RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGT
Ga0207646_1138115213300025922Corn, Switchgrass And Miscanthus RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGG
Ga0207650_1099130813300025925Switchgrass RhizosphereMRRVILAVTGTIAGLAALLSFKSHVPSSPLAVTASGSGGTPAAGASPSA
Ga0207700_1073898513300025928Corn, Switchgrass And Miscanthus RhizosphereMRRVILAVAGTIAGLVALLSFKSHVPSAPVAATTGGAGG
Ga0207709_1051032713300025935Miscanthus RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGT
Ga0207711_1108766713300025941Switchgrass RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSPSSSGGGQ
Ga0207667_1031515413300025949Corn RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGISTSSTSGGGQTE
Ga0207703_1150187713300026035Switchgrass RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSSTSPS
Ga0207702_1080391223300026078Corn RhizosphereMRRVILAVTGTIAGLAALLSFKSHVPSSPLAATASGSGGTSAAG
Ga0209648_1042193613300026551Grasslands SoilMRRVILAVTGTIAGLVALLSFKAHVPTVPVAATSGT
Ga0207806_103698123300027049Tropical Forest SoilMRRVILAVTGTIAGLVALLSFKSHAPSLSAAATGGTS
Ga0207777_104725013300027330Tropical Forest SoilMRRVILAVTGTIAGLVALLSFKSHAPSLSAAATGGTSGG
Ga0209218_113374523300027505Forest SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGGTSTSSTSTSPS
Ga0209007_102683923300027652Forest SoilMRRAILAVVSTIAGLVALLSFKSHVPAIAAATKCPGQCP
Ga0209178_108632823300027725Agricultural SoilMRRVILAVTGTIAGLAALLSFKSHVPSSPLAVTASGSGGTPAAGAS
Ga0209275_1019415513300027884SoilMRRVIIAIVATVAGLVALLSFKSHTPATVADTGTTTGGTATSEP
Ga0209006_1011758913300027908Forest SoilMRRVILAVTGTIAGLVALLSFKAHVPTVPVAATTGTGGGSSTS
Ga0268265_1028122423300028380Switchgrass RhizosphereMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGGTGG
Ga0302226_1013855423300028801PalsaMRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGT
Ga0302221_1039061323300028806PalsaMRRVVLTIVVTIAGLVALLSFKSHLPTAPSAAVSTTGGTS
Ga0307292_1041178213300028811SoilMRRVILAVTGTIAGLVALLSFKSHVPAAPVAATTGGTGGTSAS
Ga0307314_1026216123300028872SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPLAATTGGTGSTST
Ga0307308_1039755423300028884SoilMRRVILAVAGTIAGLVALLSFKSHVPSAPVAATTGGSGGTSSSSS
Ga0311369_1081744813300029910PalsaMRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGTSGTSGTGGTP
Ga0311340_1052656023300029943PalsaMRRVILTIVGTIAGLVALLSFKSHLPTAPSASVSTAGGS
Ga0311339_1042567213300029999PalsaMRRVILTIVGTVAGLVALLSFKSHLPTAASAAVSTTGGTGSTSGT
Ga0302181_1036678423300030056PalsaMRRVILAVTGTIAGLVALLSFKSHDPTMPVAATSGTGGASS
Ga0302179_1018207323300030058PalsaMRRVILTIAGTIAGLVALLSFKSHLPTIPSASVSTTGGSS
Ga0302179_1019531213300030058PalsaMRRVILTIVGTIAGLVALLSFKSHLPTVPSASVSN
Ga0311370_1145481123300030503PalsaMRRVILTIAGTIAGLVALLSFKSHVPTVPSASVSTTGGSGTAGT
Ga0311370_1197859123300030503PalsaMRRVILAVVGTVAGLVALLSFKSHLPTVPSAAVSTTGGTSGT
Ga0210280_103573713300030594SoilMRRVILTIVGTIAGLVALLSFKSHLPTAPSAAVSTTGGTGSAGGTPAASS
Ga0307482_115052613300030730Hardwood Forest SoilMRRAILAITATIAGLVALLTFKSHAPTIPTATVSGTGGGTSSSSSSG
Ga0302314_1123041313300030906PalsaMRRVILTIVGTIAGLVALLSFKSHLPTAPSASVSTAGG
Ga0302326_1265445923300031525PalsaMRRVILAVTGTIAGLVALLSFKSHDPTMPVAATSGTGGAS
Ga0318516_1021027813300031543SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATVGGSG
Ga0318571_1022677823300031549SoilMRRVILAVTGTVAGLVALLSFKSHSPTVPVAATTGTGGAS
Ga0318573_1011731923300031564SoilMRRVILAVTGTIAGLAALLSFKSHVPSAPVAATVGGSGGTA
Ga0318515_1055269013300031572SoilMRRVILAVTGTIAGLVALLSFKSHVPSVPAAATSGGSGG
Ga0318555_1063833913300031640SoilMRRVILAVTGTIAGLVALLSFKSHSPAVPVAATTGTAGGSSSSS
Ga0318496_1071750323300031713SoilMRRVILAVTGTIAGLVALLSFKSHVPSVPAAATSGGSGGSSS
Ga0318500_1015895923300031724SoilMRRVILAVTGTIAGLVALLSFKSHAPSLPAAATTGTSGGSSSSS
Ga0307475_1068485113300031754Hardwood Forest SoilMRRVILAVTGTIAGLVALLSFKAHVPTVPVAATSGTG
Ga0318509_1017300923300031768SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGTAA
Ga0318526_1013650113300031769SoilMRRVILAVTGTVAGLVALLSFKSHVPSVPVAATTGGSGGTSSSS
Ga0318547_1014951423300031781SoilMRRVILAVTGTIAGLVALLSFKSHAPSLSAAATSGTGAG
Ga0318576_1005964313300031796SoilMRRVILAVTGTIAGLVALLSFKSHAPSLSAAATSGTGAGSS
Ga0318497_1002730453300031805SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSG
Ga0318568_1024649323300031819SoilMRRVILAVTATIAGLVALLSFKSHAPALPAAATSGTGGGSSAAS
Ga0318568_1052232223300031819SoilMRRVIFAVTGTVAGLVALLSFKSHSPTVPVAATSG
Ga0318551_1032544813300031896SoilMRRVILAVTGTIAGLVALLSFRSHVPSAPVAVTTGGSGG
Ga0310916_1078093613300031942SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGPGGTSSSSA
Ga0310916_1138678523300031942SoilMRRVILAVTGTIAGLVALLSFKSHAPSLPAAATTGTSGGSSSSSTTVQGEFFT
Ga0310885_1088669123300031943SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGTGGTSTSSTSPSSSGGGQ
Ga0306922_1242025613300032001SoilMRRAILAITGTVAGLVALLSFKSHVPSIPSAAASGTGSGTGAAAPA
Ga0318569_1008653813300032010SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGSGGTAASS
Ga0310911_1077877323300032035SoilMRRVILAVTGTIAGLVALLSFKSHAPSLPAAATTG
Ga0318559_1031313333300032039SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGPGGTSSSSAPSSS
Ga0318505_1025777723300032060SoilMRRVILAVTGTVAGLVALLSFKSHSPTVPVTARIT
Ga0308173_1129016423300032074SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATTGG
Ga0307470_1139075423300032174Hardwood Forest SoilMRRVVLTVTGTIAGLVALLSFKSHVPSSPVAAASGSGGST
Ga0307472_10186720413300032205Hardwood Forest SoilMRRVILAVTGTIAGLVALLSFKSHVPSAPVAATAGGPG
Ga0306920_10146218823300032261SoilMRRVILAVTGTIAGLVALLSFKSHVPSVPAAATSGG
Ga0370515_0350485_2_1303300034163Untreated Peat SoilMRRVILTIAGTIAGLVALLSFKSHVPTIPSASVSTTGGTSSAS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.