Basic Information | |
---|---|
Family ID | F069914 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 123 |
Average Sequence Length | 38 residues |
Representative Sequence | SAVRGMVQGAQISAPQGRYSSAVDVLEALGSSKTATV |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 99.19 % |
% of genes from short scaffolds (< 2000 bps) | 88.62 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (55.285 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.821 % of family members) |
Environment Ontology (ENVO) | Unclassified (17.073 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.659 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.15% β-sheet: 0.00% Coil/Unstructured: 73.85% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF02609 | Exonuc_VII_S | 69.11 |
PF00348 | polyprenyl_synt | 5.69 |
PF00072 | Response_reg | 1.63 |
PF04264 | YceI | 1.63 |
PF04616 | Glyco_hydro_43 | 1.63 |
PF13798 | PCYCGC | 0.81 |
PF02687 | FtsX | 0.81 |
PF09925 | DUF2157 | 0.81 |
PF13650 | Asp_protease_2 | 0.81 |
PF12706 | Lactamase_B_2 | 0.81 |
PF13620 | CarboxypepD_reg | 0.81 |
PF07650 | KH_2 | 0.81 |
PF01546 | Peptidase_M20 | 0.81 |
PF03621 | MbtH | 0.81 |
PF00903 | Glyoxalase | 0.81 |
PF02674 | Colicin_V | 0.81 |
PF10546 | P63C | 0.81 |
PF00190 | Cupin_1 | 0.81 |
PF02585 | PIG-L | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG1722 | Exonuclease VII small subunit | Replication, recombination and repair [L] | 69.11 |
COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 5.69 |
COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 1.63 |
COG1286 | Colicin V production accessory protein CvpA, regulator of purF expression and biofilm formation | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.81 |
COG3251 | MbtH family protein, regulates adenylation domains of NRPSs | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 55.28 % |
Unclassified | root | N/A | 44.72 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886012|MBSR1b_contig_13276248 | Not Available | 1095 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105003762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 888 | Open in IMG/M |
3300000789|JGI1027J11758_12594721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 599 | Open in IMG/M |
3300001546|JGI12659J15293_10154438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 502 | Open in IMG/M |
3300004479|Ga0062595_100348273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
3300005534|Ga0070735_10928203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 510 | Open in IMG/M |
3300005538|Ga0070731_10380674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 938 | Open in IMG/M |
3300005552|Ga0066701_10195166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1239 | Open in IMG/M |
3300005555|Ga0066692_10886169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 547 | Open in IMG/M |
3300005557|Ga0066704_10039368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2935 | Open in IMG/M |
3300005560|Ga0066670_10699220 | Not Available | 614 | Open in IMG/M |
3300005568|Ga0066703_10461558 | Not Available | 760 | Open in IMG/M |
3300005578|Ga0068854_100112292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2057 | Open in IMG/M |
3300005712|Ga0070764_10454425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 764 | Open in IMG/M |
3300005921|Ga0070766_10216056 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300005995|Ga0066790_10162918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 954 | Open in IMG/M |
3300006059|Ga0075017_101273139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300006102|Ga0075015_100002816 | All Organisms → cellular organisms → Bacteria | 6866 | Open in IMG/M |
3300006162|Ga0075030_101253486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 582 | Open in IMG/M |
3300006795|Ga0075520_1269137 | Not Available | 705 | Open in IMG/M |
3300006800|Ga0066660_10511760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1009 | Open in IMG/M |
3300009143|Ga0099792_10524301 | Not Available | 745 | Open in IMG/M |
3300009162|Ga0075423_11669443 | Not Available | 686 | Open in IMG/M |
3300009525|Ga0116220_10098149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
3300009545|Ga0105237_10108580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2766 | Open in IMG/M |
3300009545|Ga0105237_11019425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
3300009628|Ga0116125_1039704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
3300009635|Ga0116117_1060237 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300009636|Ga0116112_1022658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2105 | Open in IMG/M |
3300009683|Ga0116224_10222121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
3300009700|Ga0116217_10807429 | Not Available | 577 | Open in IMG/M |
3300009792|Ga0126374_11800637 | Not Available | 512 | Open in IMG/M |
3300010046|Ga0126384_10881768 | Not Available | 807 | Open in IMG/M |
3300010304|Ga0134088_10114427 | Not Available | 1275 | Open in IMG/M |
3300010341|Ga0074045_10006223 | All Organisms → cellular organisms → Bacteria | 10269 | Open in IMG/M |
3300010343|Ga0074044_10309621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
3300010371|Ga0134125_11405650 | Not Available | 760 | Open in IMG/M |
3300011076|Ga0138574_1108637 | Not Available | 930 | Open in IMG/M |
3300011120|Ga0150983_10173841 | Not Available | 820 | Open in IMG/M |
3300011269|Ga0137392_10077669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2571 | Open in IMG/M |
3300012189|Ga0137388_10743548 | Not Available | 910 | Open in IMG/M |
3300012189|Ga0137388_11372389 | Not Available | 646 | Open in IMG/M |
3300012208|Ga0137376_10931980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 745 | Open in IMG/M |
3300012209|Ga0137379_10713757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
3300012354|Ga0137366_10072650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2620 | Open in IMG/M |
3300012356|Ga0137371_10036523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3794 | Open in IMG/M |
3300012931|Ga0153915_10610197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1255 | Open in IMG/M |
3300012960|Ga0164301_11917539 | Not Available | 501 | Open in IMG/M |
3300012986|Ga0164304_11487331 | Not Available | 560 | Open in IMG/M |
3300013100|Ga0157373_10167356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1547 | Open in IMG/M |
3300014154|Ga0134075_10574486 | Not Available | 510 | Open in IMG/M |
3300014159|Ga0181530_10230656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1002 | Open in IMG/M |
3300015372|Ga0132256_100993195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
3300016294|Ga0182041_11591273 | Not Available | 603 | Open in IMG/M |
3300016371|Ga0182034_11273858 | Not Available | 641 | Open in IMG/M |
3300016422|Ga0182039_10370103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1208 | Open in IMG/M |
3300017933|Ga0187801_10291229 | Not Available | 663 | Open in IMG/M |
3300017995|Ga0187816_10036086 | Not Available | 2026 | Open in IMG/M |
3300018007|Ga0187805_10422910 | Not Available | 620 | Open in IMG/M |
3300018034|Ga0187863_10817961 | Not Available | 528 | Open in IMG/M |
3300018046|Ga0187851_10484284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 703 | Open in IMG/M |
3300018046|Ga0187851_10530206 | Not Available | 668 | Open in IMG/M |
3300018468|Ga0066662_10985208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
3300019158|Ga0184580_112304 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300019240|Ga0181510_1384536 | Not Available | 531 | Open in IMG/M |
3300019278|Ga0187800_1831453 | Not Available | 553 | Open in IMG/M |
3300020034|Ga0193753_10139146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1168 | Open in IMG/M |
3300020582|Ga0210395_10020876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4820 | Open in IMG/M |
3300021086|Ga0179596_10649569 | Not Available | 535 | Open in IMG/M |
3300021180|Ga0210396_10451084 | Not Available | 1128 | Open in IMG/M |
3300021180|Ga0210396_10545347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
3300021181|Ga0210388_11132656 | Not Available | 666 | Open in IMG/M |
3300021402|Ga0210385_11213160 | Not Available | 579 | Open in IMG/M |
3300021404|Ga0210389_10223323 | Not Available | 1471 | Open in IMG/M |
3300021406|Ga0210386_11110094 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 671 | Open in IMG/M |
3300021407|Ga0210383_10532858 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300021420|Ga0210394_10337169 | Not Available | 1324 | Open in IMG/M |
3300021420|Ga0210394_11487144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300021559|Ga0210409_10273704 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
3300021559|Ga0210409_11702607 | Not Available | 507 | Open in IMG/M |
3300021560|Ga0126371_13354244 | Not Available | 541 | Open in IMG/M |
3300021560|Ga0126371_13799617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Allochromatium → Allochromatium tepidum | 509 | Open in IMG/M |
3300022505|Ga0242647_1011092 | Not Available | 808 | Open in IMG/M |
3300023091|Ga0224559_1326131 | Not Available | 505 | Open in IMG/M |
3300025404|Ga0208936_1045433 | Not Available | 594 | Open in IMG/M |
3300025650|Ga0209385_1106852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 897 | Open in IMG/M |
3300025916|Ga0207663_11318481 | Not Available | 581 | Open in IMG/M |
3300025928|Ga0207700_10592720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
3300026552|Ga0209577_10152919 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1813 | Open in IMG/M |
3300026557|Ga0179587_10475985 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300027545|Ga0209008_1128310 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300027591|Ga0209733_1156321 | Not Available | 551 | Open in IMG/M |
3300027842|Ga0209580_10514915 | Not Available | 595 | Open in IMG/M |
3300027854|Ga0209517_10434192 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 730 | Open in IMG/M |
3300027869|Ga0209579_10288520 | Not Available | 884 | Open in IMG/M |
3300027869|Ga0209579_10309943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
3300028036|Ga0265355_1018741 | Not Available | 594 | Open in IMG/M |
3300028798|Ga0302222_10035230 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
3300028855|Ga0302257_1158377 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300029943|Ga0311340_10279263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1607 | Open in IMG/M |
3300030007|Ga0311338_10049248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5632 | Open in IMG/M |
3300030058|Ga0302179_10396592 | Not Available | 607 | Open in IMG/M |
3300030991|Ga0073994_10041577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1160 | Open in IMG/M |
3300031057|Ga0170834_112164419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1324 | Open in IMG/M |
3300031231|Ga0170824_111730121 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300031231|Ga0170824_116800132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1637 | Open in IMG/M |
3300031234|Ga0302325_10448070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1981 | Open in IMG/M |
3300031446|Ga0170820_14143730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
3300031474|Ga0170818_108913023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
3300031474|Ga0170818_111261057 | Not Available | 536 | Open in IMG/M |
3300031679|Ga0318561_10245010 | Not Available | 977 | Open in IMG/M |
3300031718|Ga0307474_11054155 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Hanamia → Hanamia caeni | 643 | Open in IMG/M |
3300031724|Ga0318500_10107844 | Not Available | 1274 | Open in IMG/M |
3300031820|Ga0307473_10048230 | Not Available | 1997 | Open in IMG/M |
3300031820|Ga0307473_11524954 | Not Available | 507 | Open in IMG/M |
3300031852|Ga0307410_10269441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
3300031947|Ga0310909_10470692 | Not Available | 1054 | Open in IMG/M |
3300032119|Ga0316051_1004910 | Not Available | 977 | Open in IMG/M |
3300032160|Ga0311301_10644866 | Not Available | 1509 | Open in IMG/M |
3300032515|Ga0348332_10682200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1335 | Open in IMG/M |
3300032770|Ga0335085_11842099 | Not Available | 619 | Open in IMG/M |
3300033004|Ga0335084_11306487 | Not Available | 722 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.32% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.88% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.06% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.06% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.06% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.25% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.25% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.25% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.44% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.44% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.44% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.44% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.44% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.63% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.63% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.63% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.63% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011076 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019158 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019240 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022505 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028855 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_4 | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032119 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MBSR1b_0041.00000010 | 2162886012 | Miscanthus Rhizosphere | RDMVQGAQISAPMGRYATAVDVLEALGSSRPAATA |
INPhiseqgaiiFebDRAFT_1050037621 | 3300000364 | Soil | MVQGAQISAPQGRYSSAVDVLEALGSFQPATTGEN* |
JGI1027J11758_125947212 | 3300000789 | Soil | REIVQGAQISAPMGKYSAAVDVLEALGVNARPTAPA* |
JGI12659J15293_101544382 | 3300001546 | Forest Soil | VRHTVQGAQISAPQGRYSSAVDVLEALGGEASATA* |
Ga0062595_1003482731 | 3300004479 | Soil | MLTAVRDMVQGAQISAPMSRYSTAVDVLEALGTNRPTTTA* |
Ga0070735_109282031 | 3300005534 | Surface Soil | VRSIVQGAQISAPQGRYTSAVDVLEALGGASAAAEQAAVR* |
Ga0070731_103806741 | 3300005538 | Surface Soil | REMVNAVQGMVQGVQVSAPLGRYTSAADVLEALGTSSSTSA* |
Ga0066701_101951664 | 3300005552 | Soil | LVQGAQISAPQGRYSSAVDVLEALGSARKSTVQVGS* |
Ga0066692_108861691 | 3300005555 | Soil | VRGMVQGAQISAPLGKYSSAVDVLEALGSTGAGAG* |
Ga0066704_100393681 | 3300005557 | Soil | VQGAQISAPQGRYSSAVDVLEALGSARKSTVQVGS* |
Ga0066670_106992202 | 3300005560 | Soil | LIAVRSMVQGAQISAPQSRYSSAVDVLEALGTSGIGAGALQ* |
Ga0066703_104615583 | 3300005568 | Soil | RDRVQGAQISAPQSRYSSAVDVLEALGSKRPRDSLILGKS* |
Ga0068854_1001122924 | 3300005578 | Corn Rhizosphere | AARAMVQGAQISAPLGRYSSAVDVLEALGSKSAPA* |
Ga0070764_104544253 | 3300005712 | Soil | LGALRDRVQGAQISAPQGRYASAVDVLEALGSKRPASV* |
Ga0070766_102160562 | 3300005921 | Soil | LVQGAQISAPNGKYSSAVDVLEALGVNARPTATA* |
Ga0066790_101629181 | 3300005995 | Soil | MLVAVRGMVQGAQISAPQGRYALAVDVLEALGGRSS* |
Ga0075017_1012731392 | 3300006059 | Watersheds | VRDLVQGAQISAPNGKYAAAVDVLEALGVNARPTA* |
Ga0075015_1000028161 | 3300006102 | Watersheds | IAARQMVQGAQISAPLGRYSSAVDVLEALGSPNTASV* |
Ga0075030_1012534862 | 3300006162 | Watersheds | AVRSMVQGAQISAPLRRYTSAVHVLEALGTSRSVAQ* |
Ga0075520_12691373 | 3300006795 | Arctic Peat Soil | AAVRHMVQGAQIAAPFGRYSCAVDVLEALGTGKRAAV* |
Ga0066660_105117601 | 3300006800 | Soil | REMLLSVRDMVQGAQISAPSGRYTSAADVLEALGTSPRATVQ* |
Ga0099792_105243012 | 3300009143 | Vadose Zone Soil | REMLVAARQLVQGAQISAPQGRYNLAVDVLEALG* |
Ga0075423_116694431 | 3300009162 | Populus Rhizosphere | AVRGMVQGAQISAPSGRYTSAADVLEALGTSPRATV* |
Ga0116220_100981491 | 3300009525 | Peatlands Soil | EMLVAVRHTVQGAQISAPQGRYSSAVDVLEALGTNSPATA* |
Ga0105237_101085801 | 3300009545 | Corn Rhizosphere | AVREMVQGAQISAPQGRYSSAVDVLEALGSDAARA* |
Ga0105237_110194251 | 3300009545 | Corn Rhizosphere | MLIAVREMVQGAQISAPQGRYSSAVDVLEALGGNAARA* |
Ga0116125_10397044 | 3300009628 | Peatland | AVRDRVQGAQISAPLGRYASAVDVLEALGTKRPASV* |
Ga0116117_10602373 | 3300009635 | Peatland | REMLIAVHSIVQGAQISAPNGRYTSAVDVLEALGGTSAATERAAVR* |
Ga0116112_10226581 | 3300009636 | Peatland | MLAAVRERVQGAQISAPLGRYASAVDVLEVLGSKRPLSV* |
Ga0116224_102221211 | 3300009683 | Peatlands Soil | EMLGALRDRVQGAQISAPQGRYTSAVDVLEALGSKPRASV* |
Ga0116217_108074292 | 3300009700 | Peatlands Soil | KAVRERVQGAQISAPQGRYSSAVDVLEALGSQRPASV* |
Ga0126374_118006372 | 3300009792 | Tropical Forest Soil | QMLTAVRQMARGAQISAPLGRYASAVDVLEALGSARPTTA* |
Ga0126384_108817681 | 3300010046 | Tropical Forest Soil | EMLVAVRDMVQGAQISAPQSRYSSAVDVLEALGSSGAGAGGTQ* |
Ga0134088_101144271 | 3300010304 | Grasslands Soil | RSMVQGAQISAPLARYASAVDVLEGLGTSHSASV* |
Ga0074045_100062231 | 3300010341 | Bog Forest Soil | MLAALRDRVQGAQISAPQGRYNSAVDVLEALGSKRPASV* |
Ga0074044_103096211 | 3300010343 | Bog Forest Soil | RHMVQGAQISAPFGRYSCAVDVLEALGTSKRAVV* |
Ga0134125_114056503 | 3300010371 | Terrestrial Soil | RHMVQGAQISAPQGKYAAAVDVLEALGSSGAGAGQ* |
Ga0138574_11086371 | 3300011076 | Peatlands Soil | VREMAQGAQISAPMGRYSLAVDVLEALGTSRPTSV* |
Ga0150983_101738411 | 3300011120 | Forest Soil | REMAQGAQISAPMGRYSLAVDVLEALGTSRPTSV* |
Ga0137392_100776695 | 3300011269 | Vadose Zone Soil | RDMVQGAQISAPLGRYTSAVDVLEALGSTRPAASV* |
Ga0137388_107435482 | 3300012189 | Vadose Zone Soil | RDMVQGAQISAPQGRYSAAVDVLEALGTSGAVGV* |
Ga0137388_113723893 | 3300012189 | Vadose Zone Soil | EMLVAVRQMVQGAQISAPQGKYSSAVDVLEALGSTGVGAD* |
Ga0137376_109319803 | 3300012208 | Vadose Zone Soil | MVQGAQISAPSGRYSSAADVLEALGGKLSASDSLRLK* |
Ga0137379_107137573 | 3300012209 | Vadose Zone Soil | LTAVRGMVQGTQISAPQSRYSSAVDVLEALGDSAAGA* |
Ga0137366_100726501 | 3300012354 | Vadose Zone Soil | VRGMVQGAQISAPLGKYSSAVDVLEALGSTGAGAS* |
Ga0137371_100365237 | 3300012356 | Vadose Zone Soil | AVRGMVQGAQISAPNGRYSSAVDVLEALGSTGAGAG* |
Ga0153915_106101974 | 3300012931 | Freshwater Wetlands | MVEGVQISAPLGRYAAAVDVLEALGTKSSDTASA* |
Ga0164301_119175391 | 3300012960 | Soil | RDMVQGAQISAPSGRYSSAADVLEALGASPRATA* |
Ga0164304_114873312 | 3300012986 | Soil | MLNAARAMVQGAQISAPLGRYSSAVDVLEALGSKSAPA* |
Ga0157373_101673563 | 3300013100 | Corn Rhizosphere | IAVREMVQGAQISAPQGRYSSAVDVLEALGGNAARA* |
Ga0134075_105744862 | 3300014154 | Grasslands Soil | MACRQMTQGAQISAPMGRYSSAVDVLEALGTEPAASR* |
Ga0181530_102306563 | 3300014159 | Bog | VRGRVQGAQISAPQGRYTSAVDVLEALGSKRPASV* |
Ga0132256_1009931953 | 3300015372 | Arabidopsis Rhizosphere | RDIVQGAQISAPMGKYSAAVDVLEALGVNARPTASA* |
Ga0182041_115912732 | 3300016294 | Soil | VREMLQGAQISAPNGKYSAAVDVLEALGSVGTRPAQTV |
Ga0182034_112738583 | 3300016371 | Soil | SAVRGMVQGAQISAPQGRYSSAVDVLEALGSSKTATV |
Ga0182039_103701033 | 3300016422 | Soil | LVAARQMVQGAQISAPLGRYGCAVDVLEALGTQPAASV |
Ga0187801_102912292 | 3300017933 | Freshwater Sediment | EMLLACRQMTQGAQISAPMGRYSSAVDVLEALGGGGTAATA |
Ga0187816_100360861 | 3300017995 | Freshwater Sediment | MLIAVREMAQGAQISAPMGRYSLAVDVLEALGGKGAGAD |
Ga0187805_104229101 | 3300018007 | Freshwater Sediment | LIAARQMVQGAQISAPLGRYSSAVDVLEALGSANTAAV |
Ga0187863_108179611 | 3300018034 | Peatland | MLLAVRHTVQGAQISAPQGRYSSAVDVLEALGTKSPAPA |
Ga0187851_104842842 | 3300018046 | Peatland | FAVKDMVQGAQISAPFGRYSCAVDVLEALGTSKRTAV |
Ga0187851_105302062 | 3300018046 | Peatland | MLIAARQMAQGAQISAPLGRYSSAVDVLEALGGDQQPRTA |
Ga0066662_109852083 | 3300018468 | Grasslands Soil | LVQGAQISAPQGRYSSAVDVLEALGSARKSTVQVGS |
Ga0184580_1123044 | 3300019158 | Soil | EMLLAVRHTVQGAQISAPQGRYSSAVDVLEALGTNAPAAD |
Ga0181510_13845363 | 3300019240 | Peatland | LTAVSSMVQGAQISAPQGRYSTAVDVLEALGSSRSASVS |
Ga0187800_18314532 | 3300019278 | Peatland | LVAVRNLVQGVQISAPLGRYSSAVDVLEALGTKSPANA |
Ga0193753_101391461 | 3300020034 | Soil | VQGAQISAPQGRYTSAVDVLEALGTSKPAATATPSN |
Ga0210395_100208769 | 3300020582 | Soil | LIAAKQMAQGAQISAPQGRYSSAVDVLEALGGKGSQATA |
Ga0179596_106495691 | 3300021086 | Vadose Zone Soil | MLLAVRDRLQGAQISAPLGRYSLAVDVLEVLGEGGTAVA |
Ga0210396_104510842 | 3300021180 | Soil | VKDMVQGAQISAPFGRYSCAVDVLEALGGTSKSAVV |
Ga0210396_105453471 | 3300021180 | Soil | LSAVRDRVQGAQISAPLGRYTSAIDVLEALGSNRPTSV |
Ga0210388_111326561 | 3300021181 | Soil | VAVRHAVQGAQISAPQGRYSSAVDVLEALGTNTPAPA |
Ga0210385_112131602 | 3300021402 | Soil | EMLVAVRAMAQGAQISAPMGRYSLAVDVLEALGGRGASAS |
Ga0210389_102233234 | 3300021404 | Soil | EMLTAVRERVQGAQISAPQGRYSSAVDVLEALGSKPLR |
Ga0210386_111100941 | 3300021406 | Soil | AVRQLVQGAQISAPNGKYAAAVDVLEALGGSSGASATA |
Ga0210383_105328581 | 3300021407 | Soil | LLAVRQTVQGAQVSAPQGRYSSAVDVLEALGTNGAK |
Ga0210394_103371694 | 3300021420 | Soil | EMVIAVREMAQGAQISAPLGRYALAVDVLEALGTSRPTSV |
Ga0210394_114871442 | 3300021420 | Soil | RDLVQGAQISAPNGKYSSAVDVLEALGVNARPTATA |
Ga0210409_102737044 | 3300021559 | Soil | AHQMVQGAQISAPMGRYSSAVDVLEALGEPPTAASA |
Ga0210409_117026071 | 3300021559 | Soil | LLAVRNTVQGAQISAPQGRYSSAVDVLEALGTKSPTPA |
Ga0126371_133542441 | 3300021560 | Tropical Forest Soil | VAVCGMVQGAQISAPQGRYSSAVDVLEALGGDAARA |
Ga0126371_137996171 | 3300021560 | Tropical Forest Soil | LIAIRDLVQGAQISAPNGRYSSAVDVLEALGSGGTATGTAL |
Ga0242647_10110921 | 3300022505 | Soil | MLLAVRKAVQGAQISAPQGRYSSAVDVLEALGTSKPTAV |
Ga0224559_13261312 | 3300023091 | Soil | LAAVRERVQGAQISAPQGRYSSAVDVLEALGSKRPASV |
Ga0208936_10454332 | 3300025404 | Peatland | AVRERVQGAQISAPQGRYSSAVDVLEALGSKRLPSV |
Ga0209385_11068522 | 3300025650 | Arctic Peat Soil | AVRHMVQGAQIAAPFGRYSCAVDVLEALGTGKRAAV |
Ga0207685_101244933 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIAIRDMVQGAQISAPNGRYSSAVDVLEALGVSGSASRTAV |
Ga0207663_113184813 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVAVREMAQGAQISAPLGRYTSAVDVIEALGTSRPASV |
Ga0207700_105927203 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLAVREMVQGAQISAPNGRYSSAVDVLEALGSSRQVASV |
Ga0209577_101529194 | 3300026552 | Soil | ALRDMVQGAQISAPLRRYTSAVDVLEALGSTRPAASV |
Ga0179587_104759851 | 3300026557 | Vadose Zone Soil | EMLAALRDRVQGAQISAPQSRYSSAVDVLEALGSKRPATV |
Ga0209008_11283101 | 3300027545 | Forest Soil | EMLVAVRHTVQGAQISAPQGRYSSAVDVLEALGGKVSATA |
Ga0209733_11563211 | 3300027591 | Forest Soil | LIAVRHTVQGAQISAPQGRYNLAVDVLEALGGEASATA |
Ga0209580_105149151 | 3300027842 | Surface Soil | EMLIAARQMVQGAQISAPSGRYSSAVDVLEALGTNAPAASS |
Ga0209517_104341921 | 3300027854 | Peatlands Soil | VKDMVQGAQISAPFGRYSCAVDVLEALGTSKRAAV |
Ga0209579_102885201 | 3300027869 | Surface Soil | REMVNAVQGMVQGVQVSAPLGRYTSAADVLEALGTSSSTSA |
Ga0209579_103099433 | 3300027869 | Surface Soil | EMLMAVRSLVQGAQISAPQGRYASAVDVLEALGGTDAATGTAAVS |
Ga0265355_10187411 | 3300028036 | Rhizosphere | LIAVREMAQGAQISAPLGRYALAVDVLEALGTSRPTSV |
Ga0302222_100352301 | 3300028798 | Palsa | EMLVAVRHTVRGAQISAPQGRYNLAVDVIEALGTNTSAPV |
Ga0302257_11583771 | 3300028855 | Fen | LASVRDMVQGAQISAPQGRYSSAMDVLEALGSSRRPTAERN |
Ga0311340_102792634 | 3300029943 | Palsa | REMLVAVRHTVRGAQISAPQGRYNLAVDVIEALGTNNSVAQ |
Ga0311338_100492481 | 3300030007 | Palsa | VAVRHTVRGAQISAPQGRYNLAVDVIEALGTNTSAPV |
Ga0302179_103965921 | 3300030058 | Palsa | LVAVRHTVRGAQISAPQGRYNLAVDVIEALGTNTSAPV |
Ga0073994_100415774 | 3300030991 | Soil | LRDRVQGAQISAPQGRYSSAVDVLEALGSKRPASV |
Ga0170834_1121644191 | 3300031057 | Forest Soil | EMLSAVQDRVQGAQISAPQGRYASAVDVLEALGTKRTVPS |
Ga0170824_1117301212 | 3300031231 | Forest Soil | SREMLIAARQMAQGAQISAPQGRYTSAVDVLEALGTKSPAAL |
Ga0170824_1168001324 | 3300031231 | Forest Soil | AAVKDIVQGAQISAPFGRYSCAVDVLEALGTSTGATV |
Ga0302325_104480704 | 3300031234 | Palsa | LAAVRERVQGAQISAPQGRYSSAVDVLEALGSKPAR |
Ga0170820_141437302 | 3300031446 | Forest Soil | MLIAAKQMAQGAQISAPQGRYSSAVDVLEALGGTASAAS |
Ga0170818_1089130234 | 3300031474 | Forest Soil | EMLIAAKQMAQGAQISAPSGRYTSAVDVLEALGGNQGTATA |
Ga0170818_1112610571 | 3300031474 | Forest Soil | AARQMAQGAQISAPQGRYTSAVDVLEALGTKSPAAL |
Ga0318561_102450104 | 3300031679 | Soil | ARDRVQGAQISAPLGKYAAAVDVLEALGSFPSAPV |
Ga0307474_110541551 | 3300031718 | Hardwood Forest Soil | MSVRQMVQGAQISAPNGKYAAAVDVLEALGVNARPTAPV |
Ga0318500_101078443 | 3300031724 | Soil | LVAVRGMVQGAQISAPQGRYGSALDVLEALGSYRPVAVETD |
Ga0307473_100482304 | 3300031820 | Hardwood Forest Soil | MLIAVREIVQGAQISAPMGKYSSAVDVLEALGVNERPTASA |
Ga0307473_115249542 | 3300031820 | Hardwood Forest Soil | MLLAVRDMVQGAQISAPQGRYSSAADVLEALGTPVREALQ |
Ga0307410_102694411 | 3300031852 | Rhizosphere | LIAVRDEVQGAQISAPFGRYNCATDVLDALGSQRKNATGQA |
Ga0310909_104706921 | 3300031947 | Soil | VAARDRVQGAQISAPLGKYAAAVDVLEALGSFPSAPV |
Ga0316051_10049103 | 3300032119 | Soil | IRGMAQGAQISAPMGRYSLAVDVLEALGGKSAGAD |
Ga0311301_106448661 | 3300032160 | Peatlands Soil | REMLVAVREMAQGAQISAPMGRYNLAVDVLEALGTAGTSAR |
Ga0348332_106822004 | 3300032515 | Plant Litter | LIAVRPLVQGALISAPQGRYSSAVDVLEALGGEASATA |
Ga0335085_118420991 | 3300032770 | Soil | LAAVRHMVQGAQIAAPFGRYSCAVDVLEALGTGKGGGA |
Ga0335084_113064871 | 3300033004 | Soil | AVRGMVQGAQISAPMGRYASAVDVLEALGTAKPAGD |
⦗Top⦘ |