| Basic Information | |
|---|---|
| Family ID | F069904 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LVKAIEGLDSDRLRAMAKASAAAGRRDAAQRVLAVLREVARR |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 86.18 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.520 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.098 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF08245 | Mur_ligase_M | 58.54 |
| PF01225 | Mur_ligase | 30.08 |
| PF02873 | MurB_C | 4.88 |
| PF01820 | Dala_Dala_lig_N | 2.44 |
| PF01565 | FAD_binding_4 | 1.63 |
| PF08478 | POTRA_1 | 0.81 |
| PF06947 | DUF1290 | 0.81 |
| PF07478 | Dala_Dala_lig_C | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 30.08 |
| COG0770 | UDP-N-acetylmuramyl pentapeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 30.08 |
| COG0773 | UDP-N-acetylmuramate-alanine ligase MurC and related ligases, MurC/Mpl family | Cell wall/membrane/envelope biogenesis [M] | 30.08 |
| COG0812 | UDP-N-acetylenolpyruvoylglucosamine reductase | Cell wall/membrane/envelope biogenesis [M] | 4.88 |
| COG1181 | D-alanine-D-alanine ligase or related ATP-grasp enzyme | Cell wall/membrane/envelope biogenesis [M] | 2.44 |
| COG1589 | Cell division septal protein FtsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.81 |
| COG3856 | Small basic protein Sbp (function unknown), DUF1290 domain | Function unknown [S] | 0.81 |
| COG4775 | Outer membrane protein assembly factor BamA | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459007|GJ61VE201DNMLC | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 500 | Open in IMG/M |
| 3300001154|JGI12636J13339_1007707 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300001661|JGI12053J15887_10219415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 957 | Open in IMG/M |
| 3300001661|JGI12053J15887_10634674 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005175|Ga0066673_10019697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3085 | Open in IMG/M |
| 3300005176|Ga0066679_10043185 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300005186|Ga0066676_10802852 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005187|Ga0066675_10438830 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300005406|Ga0070703_10032253 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300005435|Ga0070714_101795097 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005468|Ga0070707_101740307 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005471|Ga0070698_102188298 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005534|Ga0070735_10672594 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005537|Ga0070730_10341604 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300005538|Ga0070731_10595196 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300005542|Ga0070732_10032370 | All Organisms → cellular organisms → Bacteria | 2981 | Open in IMG/M |
| 3300005542|Ga0070732_10646591 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300005552|Ga0066701_10302502 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300005557|Ga0066704_10099362 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300005559|Ga0066700_10227812 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300005561|Ga0066699_10345305 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005569|Ga0066705_10096527 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300005575|Ga0066702_10214039 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300005575|Ga0066702_10956497 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005586|Ga0066691_10009394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4484 | Open in IMG/M |
| 3300005586|Ga0066691_10097651 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300005764|Ga0066903_108011205 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006041|Ga0075023_100292570 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006046|Ga0066652_100083357 | All Organisms → cellular organisms → Bacteria | 2530 | Open in IMG/M |
| 3300006796|Ga0066665_10547687 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300006797|Ga0066659_11296836 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006800|Ga0066660_10941073 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006800|Ga0066660_11554310 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006804|Ga0079221_10482194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 798 | Open in IMG/M |
| 3300007258|Ga0099793_10292007 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300007265|Ga0099794_10156024 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300009038|Ga0099829_11457883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 565 | Open in IMG/M |
| 3300009088|Ga0099830_10302825 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300009088|Ga0099830_10401843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 1108 | Open in IMG/M |
| 3300009088|Ga0099830_11223597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 624 | Open in IMG/M |
| 3300009088|Ga0099830_11486462 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009089|Ga0099828_10831519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 826 | Open in IMG/M |
| 3300009090|Ga0099827_10090198 | All Organisms → cellular organisms → Bacteria | 2415 | Open in IMG/M |
| 3300009137|Ga0066709_101853005 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300010303|Ga0134082_10328816 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010320|Ga0134109_10242369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 677 | Open in IMG/M |
| 3300010333|Ga0134080_10347205 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010337|Ga0134062_10021014 | All Organisms → cellular organisms → Bacteria | 2499 | Open in IMG/M |
| 3300011271|Ga0137393_10204332 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300011999|Ga0120148_1044963 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300012189|Ga0137388_10662680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 970 | Open in IMG/M |
| 3300012189|Ga0137388_11773770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 550 | Open in IMG/M |
| 3300012202|Ga0137363_10539625 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012203|Ga0137399_10166181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1773 | Open in IMG/M |
| 3300012203|Ga0137399_10291275 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300012204|Ga0137374_10075601 | All Organisms → cellular organisms → Bacteria | 3291 | Open in IMG/M |
| 3300012206|Ga0137380_10370904 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300012206|Ga0137380_10950254 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300012207|Ga0137381_10354066 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300012211|Ga0137377_11306984 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012285|Ga0137370_10135777 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300012350|Ga0137372_10411917 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300012351|Ga0137386_10996916 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012361|Ga0137360_10032886 | All Organisms → cellular organisms → Bacteria | 3605 | Open in IMG/M |
| 3300012917|Ga0137395_10117454 | All Organisms → cellular organisms → Bacteria | 1787 | Open in IMG/M |
| 3300012917|Ga0137395_11265298 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012918|Ga0137396_10298419 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300012918|Ga0137396_10482365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 919 | Open in IMG/M |
| 3300012925|Ga0137419_10162772 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300012925|Ga0137419_10999659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 693 | Open in IMG/M |
| 3300012927|Ga0137416_10044294 | All Organisms → cellular organisms → Bacteria | 3074 | Open in IMG/M |
| 3300012927|Ga0137416_10145680 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300012927|Ga0137416_11250565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 670 | Open in IMG/M |
| 3300012930|Ga0137407_10867764 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300012986|Ga0164304_11777197 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300013763|Ga0120179_1089660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 682 | Open in IMG/M |
| 3300014823|Ga0120170_1050233 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300014829|Ga0120104_1085457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 622 | Open in IMG/M |
| 3300015079|Ga0167657_1015672 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300018433|Ga0066667_10221398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 1410 | Open in IMG/M |
| 3300018468|Ga0066662_12949329 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300018482|Ga0066669_10483058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 1070 | Open in IMG/M |
| 3300018482|Ga0066669_11828445 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300020581|Ga0210399_10988088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 679 | Open in IMG/M |
| 3300021046|Ga0215015_10299567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 502 | Open in IMG/M |
| 3300021559|Ga0210409_10774511 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300021559|Ga0210409_11192170 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300021559|Ga0210409_11435504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 566 | Open in IMG/M |
| 3300021560|Ga0126371_11542417 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300025885|Ga0207653_10036893 | All Organisms → cellular organisms → Bacteria | 1593 | Open in IMG/M |
| 3300025922|Ga0207646_10332203 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
| 3300025922|Ga0207646_10550714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 1037 | Open in IMG/M |
| 3300025922|Ga0207646_11763159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 530 | Open in IMG/M |
| 3300026271|Ga0209880_1011986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae | 2268 | Open in IMG/M |
| 3300026296|Ga0209235_1237821 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300026308|Ga0209265_1237202 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300026313|Ga0209761_1276960 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300026317|Ga0209154_1125641 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300026320|Ga0209131_1066053 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
| 3300026322|Ga0209687_1019705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae | 2216 | Open in IMG/M |
| 3300026323|Ga0209472_1153138 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300026331|Ga0209267_1264780 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300026335|Ga0209804_1283971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
| 3300026524|Ga0209690_1161168 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300026532|Ga0209160_1000568 | All Organisms → cellular organisms → Bacteria | 30781 | Open in IMG/M |
| 3300026547|Ga0209156_10396509 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300026551|Ga0209648_10458851 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300027565|Ga0209219_1010500 | All Organisms → cellular organisms → Bacteria | 2136 | Open in IMG/M |
| 3300027643|Ga0209076_1194545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 558 | Open in IMG/M |
| 3300027725|Ga0209178_1017354 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300027846|Ga0209180_10463225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 713 | Open in IMG/M |
| 3300027862|Ga0209701_10311328 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300027862|Ga0209701_10634786 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300027986|Ga0209168_10457260 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300028536|Ga0137415_10105165 | All Organisms → cellular organisms → Bacteria | 2673 | Open in IMG/M |
| 3300028536|Ga0137415_10137255 | All Organisms → cellular organisms → Bacteria | 2286 | Open in IMG/M |
| 3300028536|Ga0137415_10373250 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300028807|Ga0307305_10080184 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300028906|Ga0308309_11077389 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300029636|Ga0222749_10480822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_2_65_11 | 669 | Open in IMG/M |
| 3300031561|Ga0318528_10329062 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300032180|Ga0307471_100939812 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300032180|Ga0307471_102592729 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 33.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.14% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.88% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.25% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.25% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.81% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L02_05248910 | 2170459007 | Grass Soil | GLTAERLQEMAKASAAVGRRDAAQRVLSVLKEVVGA |
| JGI12636J13339_10077073 | 3300001154 | Forest Soil | IASLDDDRLRAMAKASAATGRRDAAKRVLAVLHEVARKT* |
| JGI12053J15887_102194152 | 3300001661 | Forest Soil | TLVAALDSLTPERLRAMAKASAAVGRRDAAKRVLAVLHEVAGR* |
| JGI12053J15887_106346742 | 3300001661 | Forest Soil | AELTGPSLVATINSLDDQRLRAMAMASTAAGRRDAARRVLAILHEVARR* |
| Ga0066673_100196974 | 3300005175 | Soil | LVKAIEGLDSDRLRAMAKASAAAGRRDAAQRVLAVLREVARR* |
| Ga0066679_100431851 | 3300005176 | Soil | LTGDSLVKAIEGLDSDRLRAMAKASAAAGRRDAAQRVLTVLREVARR* |
| Ga0066676_108028521 | 3300005186 | Soil | DDDLTGDSLVKAIEGLDSDRLRAMAKASAAAGRRDAAQRVLAVLREVARR* |
| Ga0066675_104388301 | 3300005187 | Soil | TGEALVGAIESLDDGRLRTMAAASARTGRRDAAQRVLSVLHEVARK* |
| Ga0070703_100322531 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | AGAAAQIADDDLTASTLVNTIDGLDADRLHAMAKASAASGRRDAAQRVLAVLHEVVRR* |
| Ga0070714_1017950971 | 3300005435 | Agricultural Soil | ATIKALDSDRFRAMAQASAAAGRRDAADRVLRVLRDVARK* |
| Ga0070707_1017403072 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ATLDGLSAERLRAMAKASAGAGRRDAAQRVLAVLHEMAGT* |
| Ga0070698_1021882981 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TIDGLDADRLRAMAKASAASGRRDAAQRVLAVLHEVVRR* |
| Ga0070735_106725942 | 3300005534 | Surface Soil | AAIRIADGELSGETLLQAIDSLEPERLRAMADASSAAGRRDAAERVLGVLREVARR* |
| Ga0070730_103416041 | 3300005537 | Surface Soil | LDDARLRAMAHASAAAGRRDAAERVLHVLHEVAMR* |
| Ga0070731_105951962 | 3300005538 | Surface Soil | TSETLLRALDSLRPQDLRAMAAASARLGRPDAAQRVLEVLRSVA* |
| Ga0070732_100323704 | 3300005542 | Surface Soil | DTLDEAKVRAMAQASAAAGRRDAARRVLAVLREVAAR* |
| Ga0070732_106465912 | 3300005542 | Surface Soil | IANAELTGPSLVTAIANLDEPRLRAMAKASAAAGRRDAAQRVLGLLHEVTGR* |
| Ga0066701_103025021 | 3300005552 | Soil | ENAAAMVSAGAAVTIADHELDGDSLLRTIDGLEADRIRAMARASAAAGRHDAAQRVLAVLHEVVSR* |
| Ga0066704_100993621 | 3300005557 | Soil | STLVAALDSLTPERLRAMAKASAAVGRRDAAKRVLAVLHEVAAR* |
| Ga0066700_102278122 | 3300005559 | Soil | ESLDGDRLRAMAKASAAAGRRDAAKRVLAVLHEVANR* |
| Ga0066699_103453052 | 3300005561 | Soil | DDLTGETLVNAIAGLDGDRLRGMAAASARTGRRDAAKRVLAVLHEVARK* |
| Ga0066705_100965273 | 3300005569 | Soil | ELSGEALMRAVESLDGDRLRAMAKASAAAGRRDAAKRVLAVLHEVANR* |
| Ga0066702_102140392 | 3300005575 | Soil | DGLDAERLRAMAKASAAAGRRDAAQRVLAVLREVVGK* |
| Ga0066702_109564972 | 3300005575 | Soil | IESLDDGRLRTMAAASARTGRRDAAQRVLSVLHEVARK* |
| Ga0066691_100093941 | 3300005586 | Soil | ALRIADEELTGESLVRAIASLDASRLRAMAKASAASGRRDAAQRVLRVLHEAVRR* |
| Ga0066691_100976511 | 3300005586 | Soil | AIESLDGDRLRAMAKASAAAGRRDAAKRVLAVLHEVANR* |
| Ga0066903_1080112051 | 3300005764 | Tropical Forest Soil | DDELTGARLVATIASLDDAKLRAMASASAAAGKPDAAKRVLAVLREVAKK* |
| Ga0075023_1002925702 | 3300006041 | Watersheds | LNGASLVATIKGLDGDRLRAMARASASLGRRDAAQRVLRVLREVARS* |
| Ga0066652_1000833571 | 3300006046 | Soil | GAAVRIADDDLSGETLLRTLEGLDAERLRAMAGASAAAGRRDAAQRVLAVLHEVVNRT* |
| Ga0066665_105476872 | 3300006796 | Soil | VRAIAGLEDARLRAMAAASARSGRLDAAKRVLAVLHEVARK* |
| Ga0066659_112968361 | 3300006797 | Soil | IADDELDGDSLLRTIDGLDADRLRAMAKASAEAGRRDAAQRVLAVLREVVRK* |
| Ga0066660_109410732 | 3300006800 | Soil | DEDLTGDSLMKTIAGLDNHRLQAMAKASAALGRRDAAQRVLRVLHEVVGS* |
| Ga0066660_115543102 | 3300006800 | Soil | LVRTLDSLDEARLVAMAKASAAAGGRDAAGRVLQVLREVVRR* |
| Ga0079221_104821941 | 3300006804 | Agricultural Soil | LQPDQLRSMAAASAKSGRRDAAQRVLEVVREVARR* |
| Ga0099793_102920071 | 3300007258 | Vadose Zone Soil | IDGLDADRLRTMAKASAEAGRRDAAQRVLVVLREVVRK* |
| Ga0099794_101560241 | 3300007265 | Vadose Zone Soil | TGPTLVATINGLDDQRLRAMARASTAAGRRDAAKRVLAILHEVARR* |
| Ga0099829_114578831 | 3300009038 | Vadose Zone Soil | TLDSLNADRLRAMAKASAGAGRRDAAQRVLAVLREVART* |
| Ga0099830_103028252 | 3300009088 | Vadose Zone Soil | AVRIDDADLSGESLVAAIDRLDPERLRSMAKASAAAGRRDGAQRVLAVLHEVAGK* |
| Ga0099830_104018432 | 3300009088 | Vadose Zone Soil | ALTPDRLRAMATASASAGRRDAAEHVLAVVHEVVAGR* |
| Ga0099830_112235972 | 3300009088 | Vadose Zone Soil | AMVDVGAAVRIAYGDLSPATLLTAIDGLSDERLIAMAKASAATGRRDAAQRVLAVLHRVAGK* |
| Ga0099830_114864621 | 3300009088 | Vadose Zone Soil | IKALSSEQLRAMAKASNTAGRRDAAQRVLRVLHEVARR* |
| Ga0099828_108315191 | 3300009089 | Vadose Zone Soil | EAGAAERIGDAELSGESLVAAIDRLDPERLRSMARASAAAGRRDGAQQVLAVLHEVAGR* |
| Ga0099827_100901984 | 3300009090 | Vadose Zone Soil | ALSSEQLRAMAKASNSAGRRDAAQLVLRVLHEVARR* |
| Ga0066709_1018530052 | 3300009137 | Grasslands Soil | VASLESLTDARLREMAAASAKVGRRDAARRVLAVLHEVLGR* |
| Ga0134082_103288162 | 3300010303 | Grasslands Soil | EAMVAAGTAIRISDDALTGDSLLRALDGLDGERLRGMARASAAAGRRDAAQRVVAVLHEVAENQMDKS* |
| Ga0134109_102423691 | 3300010320 | Grasslands Soil | ADEELTGDTLMRAIASLDEGRLRAMAKASAATGRRDAAQSVLRVLHQVSGK* |
| Ga0134080_103472051 | 3300010333 | Grasslands Soil | PAIARRRSASRPSDDDLSGETLLRTLEGLDAERLRAMAGASAAAGRRDAAQRVLAVLHEVVNRT* |
| Ga0134062_100210141 | 3300010337 | Grasslands Soil | DAITGDSLLRALDGLDGERLRAMARASAAAGRRDAAQRVVAVLHEVAENQMDKS* |
| Ga0137393_102043321 | 3300011271 | Vadose Zone Soil | LDRLSTDRLRAMAKASAGAGRRDAAQRVLAVLHEVARK* |
| Ga0120148_10449631 | 3300011999 | Permafrost | VATIAGLDDDRLRAMAKASASAGRRDAAARVLAVLREVAKH* |
| Ga0137388_106626801 | 3300012189 | Vadose Zone Soil | SDERLSAMAKASAATGRRDAAERVLAVLHRVAGK* |
| Ga0137388_117737702 | 3300012189 | Vadose Zone Soil | DLNPTSLVTAIDGLDAERLRAMAKASSAAGRRDAAERVLAVLHRVAGK* |
| Ga0137363_105396251 | 3300012202 | Vadose Zone Soil | IKALNREQLRAMAKASNAAGRRDAAQRVLRVLHEVARR* |
| Ga0137399_101661813 | 3300012203 | Vadose Zone Soil | DSLLRTIDGLDADRIRAMAKASAAAGRHDAAQRVLAVLREVVSR* |
| Ga0137399_102912752 | 3300012203 | Vadose Zone Soil | AVRIADRDLNPSTLVAALDSLTPERLRAMAKASAAAGRRDAAKRVLAVLHEVAGR* |
| Ga0137374_100756011 | 3300012204 | Vadose Zone Soil | LDGLTPERLQAMARASSAAGRRDAAQQVLAVLHQVARK* |
| Ga0137380_103709041 | 3300012206 | Vadose Zone Soil | LDNLTSAQLRAMAQASSAAGRRDAAQRVLEVVREVAHR* |
| Ga0137380_109502542 | 3300012206 | Vadose Zone Soil | SLLRALDSLDGERLRAMARASAAAGRRDAAQRVVAVLHEVAENQMDKS* |
| Ga0137381_103540662 | 3300012207 | Vadose Zone Soil | ATAMVNAGAAMRIADDELSGETLLKAIEGLDPDHLRAMAKASAATGRRDAAQRVLAVLHEVVKK* |
| Ga0137377_113069842 | 3300012211 | Vadose Zone Soil | AMRIADDELSGETLLKAIEGLDPDHLRAMAKASAATGRRDAAQRVLAVLHEVVKK* |
| Ga0137370_101357771 | 3300012285 | Vadose Zone Soil | LITVLDGLPTEYLRSMAGASAAIGRRDAAQRVLRVLHEVVGS* |
| Ga0137372_104119172 | 3300012350 | Vadose Zone Soil | SGETLLKAIEGLDPDHLRAMAKASAATGRRDAAQRVLAVLHEVVKK* |
| Ga0137386_109969161 | 3300012351 | Vadose Zone Soil | IADDDLTGDSLVKSIEGLDSDRLRAMAKASAAAGRRDAAQRVLTVLREVARR* |
| Ga0137360_100328865 | 3300012361 | Vadose Zone Soil | TSAQLRAMAQASSGAGRRDAAQRVLEVVREVARR* |
| Ga0137395_101174543 | 3300012917 | Vadose Zone Soil | RIADGDLSPATLLRTIDGLSDERLRAMAKASAATGRRDAAQRVMAVLHRVASK* |
| Ga0137395_112652981 | 3300012917 | Vadose Zone Soil | GATLVATINGLDDERLRAMAKSSAAAGRRDAAKRVLAILHEVARR* |
| Ga0137396_102984192 | 3300012918 | Vadose Zone Soil | VRIGDADLNPASLVAAIDALTPERLRAMVRASAATGRRDAAKRVLAVLREVARK* |
| Ga0137396_104823651 | 3300012918 | Vadose Zone Soil | LSPASLVAAIDRLSAESLRAMAKASSAAGRRDAAQRVLAVLHEISGK* |
| Ga0137419_101627723 | 3300012925 | Vadose Zone Soil | VRLGDAELTGPSLVATINGLDDQRLRSMANASATAGRRDAAKRVLAILHEVARR* |
| Ga0137419_109996591 | 3300012925 | Vadose Zone Soil | DSLTSAQLRAMAQASSGAGRRDAAQRVLEVVREVARR* |
| Ga0137416_100442944 | 3300012927 | Vadose Zone Soil | RIGDADLNPSSLVAAIDALTPARLRAMARASAATGRRDAAKRVLAVLHEVARK* |
| Ga0137416_101456803 | 3300012927 | Vadose Zone Soil | LSAESLRAMAKASSAAGRRDAAQRVLAVLHEIAGK* |
| Ga0137416_112505652 | 3300012927 | Vadose Zone Soil | GAAVRIADRDLSPSTLVAALDSLTPERLRAMAKASAAVGRRDAAKRVLAVLHEVAGR* |
| Ga0137407_108677641 | 3300012930 | Vadose Zone Soil | LMSAINGLDDERLRAMAKASAAAGRRDAAKRVLAILHEVARR* |
| Ga0164304_117771972 | 3300012986 | Soil | VAALESLSDGRLREMAAASARVGRRDAAQRVLAVLHEVLGK* |
| Ga0120179_10896601 | 3300013763 | Permafrost | DGLTPDRLRARAKASAGAGRRDAAQRVLGVLREVMRG* |
| Ga0120170_10502332 | 3300014823 | Permafrost | VTSTGPRLVATIKGLDDERLRAMAKASASAGLRDAAQRVLAVLREVALNK* |
| Ga0120104_10854572 | 3300014829 | Permafrost | LSGRSLVATIAGLDDDRLRAMAKASASAGRRDAAARVLAVLREVAKH* |
| Ga0167657_10156722 | 3300015079 | Glacier Forefield Soil | RLVATIKGLDDDRLREMAKASARAGLRDAAQRVLQVLREVVPAGRAQGA* |
| Ga0066667_102213982 | 3300018433 | Grasslands Soil | IDALQPAQLEAMARASATAGRRDAAQRVLGVLREVGNRK |
| Ga0066662_129493291 | 3300018468 | Grasslands Soil | HELDGDSLLRTIDGLEADRIRAMARASAAAGRHDAAQRVLAVLHEVVSR |
| Ga0066669_104830582 | 3300018482 | Grasslands Soil | VAAIDALQPAQLEAMARASATAGRRDAAQRVLGVLREVGNRK |
| Ga0066669_118284451 | 3300018482 | Grasslands Soil | LPAAQVEAMARASAAAGRRDAAERVLGVLREVVKTA |
| Ga0210399_109880881 | 3300020581 | Soil | AIDGLSAERLRAMAKASAGAGRRDAAQRVLAVLHEVAGK |
| Ga0215015_102995671 | 3300021046 | Soil | LSPAGLVAALDDLSAERLRAMAKASAGAGRRDAAARVLAVLHEAAGK |
| Ga0210409_107745112 | 3300021559 | Soil | GDKLVATLGGLDDERLSAMARASRAAGRHDAAQRVLAVLHEVAGR |
| Ga0210409_111921702 | 3300021559 | Soil | DLTGASLISAIESLDEERLTAMAKASSAAGRRDAAQRVLKVLHEVARK |
| Ga0210409_114355041 | 3300021559 | Soil | DSELSPTSLVATIDDLGEERLRAMAKASSGAGRHDAAQRVLAVLHEVVGK |
| Ga0126371_115424172 | 3300021560 | Tropical Forest Soil | EALVRCIEDLDANRLRAMAAASASNGRSDAARRVLAVLREVAAR |
| Ga0207653_100368931 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | RHGAAAQIADDDLTASTLVNTIDGLDADRLHAMAKASAASGRRDAAQRVLAVLHEVVRR |
| Ga0207646_103322031 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DGLDADRLHAMAKASAASGRRDAAQRVLAVLHEVVRR |
| Ga0207646_105507142 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LVETIDALTPDRLRAMAKASSAAGRRDAATRVLAVLHRVVGR |
| Ga0207646_117631591 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IADGDLSPETLLAAIDGLTDEHLHALAKASSATGRRDAAQRVLAVLHRVAKK |
| Ga0209880_10119863 | 3300026271 | Soil | LNGASLVAAIDALDDDRLRAMAKASASAGLRDAAQRVLAVLHEVARPPGERRAH |
| Ga0209235_12378212 | 3300026296 | Grasslands Soil | SLLRTIDSLEADRIRAMAKASAAAGRHDAAQRVLAVLREVVSG |
| Ga0209265_12372022 | 3300026308 | Soil | GERLRGMARASAAAGRRDAAQRVVAVLHEVAENQMDKS |
| Ga0209761_12769602 | 3300026313 | Grasslands Soil | AAAMVSAGAALRIADDELEGDSLLRTIDSLEADRIRAMAKASAAAGRHDAAQRVLAVLREVASG |
| Ga0209154_11256411 | 3300026317 | Soil | ADDDLTGDSLVKAIEGLDSDRLRAMAKASAAAGRRDAAQRVLSVLREVARR |
| Ga0209131_10660533 | 3300026320 | Grasslands Soil | TIDGLSDERLRAMAKASAATGRRDAAQRVMAVLHRVAGQ |
| Ga0209687_10197051 | 3300026322 | Soil | IRAIESLDGDRLRAMAKASAAAGRRDAAKRVLAVLHEVANR |
| Ga0209472_11531382 | 3300026323 | Soil | DALTGDSLLRALDSLDGERLRAMARASAAAGRRDAAQRVVAVLHEVAENQMDKS |
| Ga0209267_12647802 | 3300026331 | Soil | SLLRALDGLDGERLRGMARASAAAGRRDAAQRVVAVLHEVAENQMDKS |
| Ga0209804_12839712 | 3300026335 | Soil | ADRDLTAESLVRTIESLDTDRLRGMAKASAAIGRRDAAQRVLRVLHEVVRR |
| Ga0209690_11611682 | 3300026524 | Soil | IADHELDGDSLLRTIDGLEADRIRAMARASAAAGRHDAAQRVLAVLHEVVSR |
| Ga0209160_10005681 | 3300026532 | Soil | DLSPASLLAAIDGLSAESLRAMAKASSAAGRRDAAQRVLAVLHEVAGK |
| Ga0209156_103965092 | 3300026547 | Soil | VAAGTAIRISDDAITGDSLLRALDGLDGERLRAMARASAAAGRRDAAQRVVAVLHEVAENQMDKS |
| Ga0209648_104588511 | 3300026551 | Grasslands Soil | LDDKRLRAMAAASAKAGLRDAAQRVLEVLHEVALA |
| Ga0209219_10105001 | 3300027565 | Forest Soil | GLDGDRLREMAKASASIGRRDAAQRVLRVLREVSRS |
| Ga0209076_11945451 | 3300027643 | Vadose Zone Soil | IDGLSGESLRAMAKASSAAGRRDAAQRVLAVLHEIAGK |
| Ga0209178_10173541 | 3300027725 | Agricultural Soil | ALSTLDADRLRAMARASAATGRGDAAQRVLGVLHEVAKR |
| Ga0209180_104632251 | 3300027846 | Vadose Zone Soil | SLTSAQLRAMAQASSATGRRDAAQRVLEVVREVARG |
| Ga0209701_103113282 | 3300027862 | Vadose Zone Soil | LVRTIESLDAAMLRAMAGASASVGRRDAAQRVLRVLHEVARK |
| Ga0209701_106347862 | 3300027862 | Vadose Zone Soil | KALSSEQLRAMAKASNTAGRRDAAQRVLRVLHEVARR |
| Ga0209168_104572602 | 3300027986 | Surface Soil | AGAAIRIADGELSGETLLQAIDSLEPERLRAMADASSAAGRRDAAERVLGVLREVARR |
| Ga0137415_101051654 | 3300028536 | Vadose Zone Soil | LAAIDGLSAERLREMAKASSAAGRRDAAQRVLAVLHRVVGK |
| Ga0137415_101372553 | 3300028536 | Vadose Zone Soil | VAAIDGLSGESLRAMAKASSAAGRRDAAQRVLAVLHEIAGK |
| Ga0137415_103732502 | 3300028536 | Vadose Zone Soil | DALTPDKLRAMAKASAASGRRDAAKRVLAVLHEVAHT |
| Ga0307305_100801841 | 3300028807 | Soil | DAELTGASLMATIAALDDERLRAMARASAAAGRRDAAKRVLAILHEVSRK |
| Ga0308309_110773891 | 3300028906 | Soil | TIKGLDGGRLREMARASASIGRRDAAQRVLLVLREVARS |
| Ga0222749_104808221 | 3300029636 | Soil | SLVAAIDGLSPERLRAMAKASAGIGRRDAAERVLQVLREVASKK |
| Ga0318528_103290622 | 3300031561 | Soil | AVRIADSELTADTLVRCIDGLTGDRLGAMATASAAIGRPDAAQRVLAVLHEVARS |
| Ga0307471_1009398121 | 3300032180 | Hardwood Forest Soil | LVAALESLSDGRLREMAAASARVGRRDAAQRVLAVLHEVLGK |
| Ga0307471_1025927292 | 3300032180 | Hardwood Forest Soil | ESLDADRLRAMAKASAATGRRDAAQRVLAVLHGVAKR |
| ⦗Top⦘ |