| Basic Information | |
|---|---|
| Family ID | F069891 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTFDDILDQVIALLKRQGRVSYGAMKRRFDLDDAYLEDLK |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 93.33 % |
| % of genes near scaffold ends (potentially truncated) | 85.37 % |
| % of genes from short scaffolds (< 2000 bps) | 94.31 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.545 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (20.325 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.268 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.902 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF01726 | LexA_DNA_bind | 4.07 |
| PF01494 | FAD_binding_3 | 3.25 |
| PF00903 | Glyoxalase | 2.44 |
| PF13374 | TPR_10 | 2.44 |
| PF01070 | FMN_dh | 2.44 |
| PF13424 | TPR_12 | 1.63 |
| PF13669 | Glyoxalase_4 | 1.63 |
| PF13700 | DUF4158 | 1.63 |
| PF04909 | Amidohydro_2 | 1.63 |
| PF13714 | PEP_mutase | 1.63 |
| PF02615 | Ldh_2 | 1.63 |
| PF00582 | Usp | 1.63 |
| PF10049 | DUF2283 | 0.81 |
| PF00561 | Abhydrolase_1 | 0.81 |
| PF13384 | HTH_23 | 0.81 |
| PF13452 | MaoC_dehydrat_N | 0.81 |
| PF00296 | Bac_luciferase | 0.81 |
| PF04952 | AstE_AspA | 0.81 |
| PF05107 | Cas_Cas7 | 0.81 |
| PF12681 | Glyoxalase_2 | 0.81 |
| PF13358 | DDE_3 | 0.81 |
| PF07721 | TPR_4 | 0.81 |
| PF07883 | Cupin_2 | 0.81 |
| PF12974 | Phosphonate-bd | 0.81 |
| PF03400 | DDE_Tnp_IS1 | 0.81 |
| PF03683 | UPF0175 | 0.81 |
| PF01844 | HNH | 0.81 |
| PF13522 | GATase_6 | 0.81 |
| PF03372 | Exo_endo_phos | 0.81 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.81 |
| PF14279 | HNH_5 | 0.81 |
| PF00211 | Guanylate_cyc | 0.81 |
| PF04986 | Y2_Tnp | 0.81 |
| PF01609 | DDE_Tnp_1 | 0.81 |
| PF07992 | Pyr_redox_2 | 0.81 |
| PF01966 | HD | 0.81 |
| PF03050 | DDE_Tnp_IS66 | 0.81 |
| PF01738 | DLH | 0.81 |
| PF03781 | FGE-sulfatase | 0.81 |
| PF05443 | ROS_MUCR | 0.81 |
| PF12862 | ANAPC5 | 0.81 |
| PF00106 | adh_short | 0.81 |
| PF13191 | AAA_16 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 6.50 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 3.25 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 3.25 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 3.25 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 2.44 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 2.44 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 1.63 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.81 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG4957 | Predicted transcriptional regulator | Transcription [K] | 0.81 |
| COG3649 | CRISPR-Cas system type I effector complex subunit Cas7, RAMP superfamily | Defense mechanisms [V] | 0.81 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.81 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG2886 | Predicted antitoxin, contains HTH domain | General function prediction only [R] | 0.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.81 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.54 % |
| Unclassified | root | N/A | 28.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459021|G14TP7Y01ENX0Z | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 657 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0638149 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100335918 | Not Available | 1108 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100838313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1735 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105522221 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300000787|JGI11643J11755_11779324 | Not Available | 722 | Open in IMG/M |
| 3300000858|JGI10213J12805_10242072 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300004268|Ga0066398_10114920 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005331|Ga0070670_101158332 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300005332|Ga0066388_103249735 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300005332|Ga0066388_104830427 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005332|Ga0066388_105369172 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005447|Ga0066689_10701379 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005598|Ga0066706_11108728 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005719|Ga0068861_100337132 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300006058|Ga0075432_10093657 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300006796|Ga0066665_11191410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| 3300006845|Ga0075421_100467004 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300006846|Ga0075430_100164955 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300006852|Ga0075433_11187120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 663 | Open in IMG/M |
| 3300006853|Ga0075420_100081874 | All Organisms → cellular organisms → Bacteria | 2856 | Open in IMG/M |
| 3300006853|Ga0075420_100411103 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300006853|Ga0075420_100478457 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300006853|Ga0075420_101043540 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7 | 703 | Open in IMG/M |
| 3300006854|Ga0075425_101512078 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300006954|Ga0079219_12111027 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300007255|Ga0099791_10336800 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300007265|Ga0099794_10404647 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Handelsmanbacteria → Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10 | 713 | Open in IMG/M |
| 3300009012|Ga0066710_101721067 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300009038|Ga0099829_10364469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1191 | Open in IMG/M |
| 3300009089|Ga0099828_10390071 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
| 3300009090|Ga0099827_11471028 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009098|Ga0105245_10175133 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300009137|Ga0066709_100518770 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300009137|Ga0066709_101469047 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300009147|Ga0114129_13258728 | Not Available | 526 | Open in IMG/M |
| 3300009156|Ga0111538_11258773 | Not Available | 934 | Open in IMG/M |
| 3300009162|Ga0075423_11222489 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300009444|Ga0114945_10509107 | Not Available | 725 | Open in IMG/M |
| 3300009610|Ga0105340_1542970 | Not Available | 519 | Open in IMG/M |
| 3300009792|Ga0126374_10545496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 845 | Open in IMG/M |
| 3300009821|Ga0105064_1111650 | Not Available | 566 | Open in IMG/M |
| 3300010047|Ga0126382_12102018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300010359|Ga0126376_10580335 | Not Available | 1056 | Open in IMG/M |
| 3300010359|Ga0126376_12465552 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010360|Ga0126372_10434393 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300010360|Ga0126372_11651982 | Not Available | 681 | Open in IMG/M |
| 3300010360|Ga0126372_12322372 | Not Available | 586 | Open in IMG/M |
| 3300010362|Ga0126377_10726381 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300010362|Ga0126377_10900568 | Not Available | 947 | Open in IMG/M |
| 3300010362|Ga0126377_13051244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 541 | Open in IMG/M |
| 3300010366|Ga0126379_10794699 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300010366|Ga0126379_12270191 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300010366|Ga0126379_12831452 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 580 | Open in IMG/M |
| 3300010366|Ga0126379_13233232 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 545 | Open in IMG/M |
| 3300010376|Ga0126381_102866955 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300010398|Ga0126383_10314349 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300010398|Ga0126383_10371250 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300010398|Ga0126383_13440605 | Not Available | 517 | Open in IMG/M |
| 3300011269|Ga0137392_11116009 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012199|Ga0137383_11041436 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012202|Ga0137363_11600862 | Not Available | 543 | Open in IMG/M |
| 3300012206|Ga0137380_10787943 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300012359|Ga0137385_10998090 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 690 | Open in IMG/M |
| 3300012361|Ga0137360_10408822 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina | 1145 | Open in IMG/M |
| 3300012361|Ga0137360_10527090 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1007 | Open in IMG/M |
| 3300012685|Ga0137397_10573317 | Not Available | 840 | Open in IMG/M |
| 3300012917|Ga0137395_10511499 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300012917|Ga0137395_10540912 | Not Available | 840 | Open in IMG/M |
| 3300012925|Ga0137419_11903382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 | 510 | Open in IMG/M |
| 3300012927|Ga0137416_10955777 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Handelsmanbacteria → Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10 | 764 | Open in IMG/M |
| 3300012929|Ga0137404_11101219 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300012930|Ga0137407_12167565 | Not Available | 531 | Open in IMG/M |
| 3300012948|Ga0126375_10619243 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300012948|Ga0126375_11411562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 591 | Open in IMG/M |
| 3300012948|Ga0126375_11443789 | Not Available | 585 | Open in IMG/M |
| 3300012948|Ga0126375_11654167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 553 | Open in IMG/M |
| 3300012971|Ga0126369_11618366 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Limnoglobus → Limnoglobus roseus | 737 | Open in IMG/M |
| 3300012971|Ga0126369_12136083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 647 | Open in IMG/M |
| 3300014154|Ga0134075_10587809 | Not Available | 504 | Open in IMG/M |
| 3300014325|Ga0163163_11551776 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300015241|Ga0137418_10524276 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 943 | Open in IMG/M |
| 3300015371|Ga0132258_13349784 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1102 | Open in IMG/M |
| 3300016357|Ga0182032_10437605 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300017997|Ga0184610_1146713 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300018077|Ga0184633_10551142 | Not Available | 551 | Open in IMG/M |
| 3300018082|Ga0184639_10306267 | Not Available | 834 | Open in IMG/M |
| 3300018433|Ga0066667_12355650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300019238|Ga0180112_1281512 | Not Available | 624 | Open in IMG/M |
| 3300021073|Ga0210378_10352399 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300021560|Ga0126371_11937967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis sulfate-reducing endosymbiont | 708 | Open in IMG/M |
| 3300022195|Ga0222625_1175316 | Not Available | 1076 | Open in IMG/M |
| 3300025961|Ga0207712_10443413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | 1100 | Open in IMG/M |
| 3300025981|Ga0207640_11159520 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300026142|Ga0207698_12022821 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300027655|Ga0209388_1235988 | Not Available | 500 | Open in IMG/M |
| 3300027873|Ga0209814_10137122 | Not Available | 1047 | Open in IMG/M |
| 3300027874|Ga0209465_10454599 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027882|Ga0209590_10589675 | Not Available | 715 | Open in IMG/M |
| 3300027907|Ga0207428_10894395 | Not Available | 627 | Open in IMG/M |
| 3300027952|Ga0209889_1099800 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300028536|Ga0137415_10481712 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300028536|Ga0137415_10527573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Handelsmanbacteria → Candidatus Handelsmanbacteria bacterium RIFCSPLOWO2_12_FULL_64_10 | 990 | Open in IMG/M |
| 3300028608|Ga0247819_10394886 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 797 | Open in IMG/M |
| 3300030006|Ga0299907_10306860 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300030006|Ga0299907_11346694 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis | 505 | Open in IMG/M |
| 3300030570|Ga0247647_1000564 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 2357 | Open in IMG/M |
| 3300030570|Ga0247647_1003629 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300031573|Ga0310915_11267895 | Not Available | 508 | Open in IMG/M |
| 3300031740|Ga0307468_101779494 | Not Available | 583 | Open in IMG/M |
| 3300031912|Ga0306921_10128277 | All Organisms → cellular organisms → Bacteria | 2959 | Open in IMG/M |
| 3300031946|Ga0310910_11316819 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031965|Ga0326597_12081431 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300032075|Ga0310890_10209874 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300032075|Ga0310890_10788915 | Not Available | 751 | Open in IMG/M |
| 3300032075|Ga0310890_11846449 | Not Available | 503 | Open in IMG/M |
| 3300032076|Ga0306924_10954006 | Not Available | 945 | Open in IMG/M |
| 3300032211|Ga0310896_10262678 | Not Available | 878 | Open in IMG/M |
| 3300032261|Ga0306920_100549246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1712 | Open in IMG/M |
| 3300033551|Ga0247830_10220717 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 20.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.25% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.44% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.44% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.63% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.63% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.81% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019238 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030570 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 4NP_00910220 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MTFDEILEQVIALLKRQGRVSYPALKIRFSLDDEYLEALKAELLYV |
| ICChiseqgaiiDRAFT_06381491 | 3300000033 | Soil | MTFDDILDQILDLLRRQGRVSYWALKRRFDLHDDDIAGLKD |
| INPhiseqgaiiFebDRAFT_1003359181 | 3300000364 | Soil | MSFDDILEQVITLLKRQGRVSYPDLKIRFTLDDEY |
| INPhiseqgaiiFebDRAFT_1008383131 | 3300000364 | Soil | MDFADILEQTIALLQHQGRISYGALKRRFGLDDAYLD |
| INPhiseqgaiiFebDRAFT_1055222212 | 3300000364 | Soil | MTFDDLLAQVLTLLQQQGRVSYGALKRRFGLDDAYLDDLKAELIDA |
| JGI11643J11755_117793241 | 3300000787 | Soil | MTFDEIHAQITDLLKRQGRVSYGALKRRYDLDDAYL |
| JGI10213J12805_102420722 | 3300000858 | Soil | MTFDEILEQVLALLKRQGRVSYSAIKRRFDLNDDYL |
| Ga0066398_101149202 | 3300004268 | Tropical Forest Soil | MSFDEILAQIIEVLKTQGRVSYGALKRRYNLEDAYLDDLKDEIIHA |
| Ga0070670_1011583322 | 3300005331 | Switchgrass Rhizosphere | MEFDEILTQAIELLQRQGRISYGALKRRFHLDDEHLADLK |
| Ga0066388_1032497352 | 3300005332 | Tropical Forest Soil | MEFEDVLAQTIALLQRQGRISYSALKRRFQLDDTYLDDLKVELIEGV* |
| Ga0066388_1048304271 | 3300005332 | Tropical Forest Soil | MTFDDILDQILDLLRRQGRVSYWALKRRFALHDDDIAGLK |
| Ga0066388_1053691721 | 3300005332 | Tropical Forest Soil | MEFEAVLEQIIALLQSQGRVSYGALKRRFKLDDAYLEDLK |
| Ga0066689_107013791 | 3300005447 | Soil | MEFEAVLEQTIALLQRQGRISYGALKRRFNLDDAYLEDLK |
| Ga0066695_108203832 | 3300005553 | Soil | MTFDEILDQVRDLRQQRGRVSSQALKRRFELDDAYLD |
| Ga0066706_111087282 | 3300005598 | Soil | MEFEAVLEQTIALLQRQGRISYGALKRRFNLDDAYLEDL |
| Ga0068861_1003371322 | 3300005719 | Switchgrass Rhizosphere | MTFDEILEQVIALLWCQKRVAYGALQRRFNLDDAYLEDPKADLILL* |
| Ga0075024_1009035081 | 3300006047 | Watersheds | MSFDEILDQVRELLRQRGRLSYGALKRRFDLDDAYVE |
| Ga0075432_100936571 | 3300006058 | Populus Rhizosphere | MTFDDILDQILDLLRRQGRVSYWALKRRFDLHDDDIVGLK |
| Ga0066665_111914102 | 3300006796 | Soil | MTFDEILDQIITLLKRQGRVSYSALKRRFDLNDDYLNDLK |
| Ga0075421_1004670041 | 3300006845 | Populus Rhizosphere | MTFDDVLEQLVTLLKRQGRVSYRALKMRFNLDDEY |
| Ga0075430_1001649551 | 3300006846 | Populus Rhizosphere | MTFDDILDQVITLLKRQGRVSYRALKMRFNLDDEY |
| Ga0075433_111871202 | 3300006852 | Populus Rhizosphere | MTFDEILDQGITLLKRQGRVSYTALKIRFSLDDDSS* |
| Ga0075420_1000818741 | 3300006853 | Populus Rhizosphere | MTFDEILEQVITLLKRQGRVLYPALKIRFSLDDEYLEALK |
| Ga0075420_1004111031 | 3300006853 | Populus Rhizosphere | MEFEAVLEQTIALLQRQGRISYGALKRRFQLDDAY |
| Ga0075420_1004784573 | 3300006853 | Populus Rhizosphere | MTFDDILDQVITLLKRQGRVSYSALKRRFDLDDDYL |
| Ga0075420_1010435401 | 3300006853 | Populus Rhizosphere | MTFDEMLEQVITLLKRQERVSSSALKRRFDLGDDYLKDLKDELLHGG* |
| Ga0075425_1015120782 | 3300006854 | Populus Rhizosphere | MTFDDLLAQVLTLLQQQGRVSYGALKRRFGLDDAYLDDLKAELI |
| Ga0079219_121110272 | 3300006954 | Agricultural Soil | MTFDEILAQIIDLLKRQGRVSYPALKIRFSLDDDYLEALKA |
| Ga0099791_103368002 | 3300007255 | Vadose Zone Soil | MTFDELLEQVVDLLQRQDRVSYGALKRRFALDDDYLRI* |
| Ga0099794_104046473 | 3300007265 | Vadose Zone Soil | ADILEQTIVLLQHQGRISYGALKRRFSLDDAYLEDLTRLW* |
| Ga0066710_1017210673 | 3300009012 | Grasslands Soil | VNFDEMLEQVLALVQRQGRVSYRALKRRFDLDDAYLEGHWFS |
| Ga0099829_103644691 | 3300009038 | Vadose Zone Soil | MTFDEILTQVVELLQRQGRVSYGALKRRFALDDDY |
| Ga0099828_103900711 | 3300009089 | Vadose Zone Soil | MEFAEILEQTIALLQHQGRISYGALKRRFGLHDAYL |
| Ga0099827_114710282 | 3300009090 | Vadose Zone Soil | MTFDDILDQVIALLKRQGRVSYGAMKRRFDLDDAYLEDLK |
| Ga0105245_101751331 | 3300009098 | Miscanthus Rhizosphere | MTFDDILDQVIALLQRQGRVSYGAMKRRFALDDAYLEDLKGEILF |
| Ga0066709_1005187703 | 3300009137 | Grasslands Soil | MTFDELLTQVLDLLQRQGRVSYGARKRRFDLDGAYREYLKTEII* |
| Ga0066709_1014690473 | 3300009137 | Grasslands Soil | VNFDEMLEQVLALVQRQGRVSYRALKRRFDLDDAYLEGHWFS* |
| Ga0114129_132587282 | 3300009147 | Populus Rhizosphere | MTFDDILNQVIALLKRQGRVSYGAMKRRFDLDDAYLEDLK |
| Ga0111538_112587731 | 3300009156 | Populus Rhizosphere | MTFDEILAQIIDLLRYQGRVSYGALKYWYTLDNAYLEDLKDVIIK |
| Ga0075423_112224891 | 3300009162 | Populus Rhizosphere | VTFDDILAQVITLLKRQGRVSYPALKIRFSLDDEYLEALRAELL |
| Ga0114945_105091073 | 3300009444 | Thermal Springs | MTFDDTLDQILTLLRHQGRVSYWALKRRFDLHDDDIAGLK |
| Ga0105340_15429701 | 3300009610 | Soil | MDRGAAMTFMTFDEILEQVSMLLQRQKRVAYGALKRRFDLDEAYLEDLYERA* |
| Ga0126374_105454961 | 3300009792 | Tropical Forest Soil | MMFDEILEQVILLLKRQGRVSYPALKIRFSLDDEYLEALK |
| Ga0105064_11116502 | 3300009821 | Groundwater Sand | MTFDDVLAQVLALLQRQGRVSYGALKRRFDLDEAYLNDLKTELID |
| Ga0126382_121020182 | 3300010047 | Tropical Forest Soil | MTFDEILEQVIALLKHQGRVSYPALKIRFSLDDEYLEALK |
| Ga0126376_105803351 | 3300010359 | Tropical Forest Soil | MTFDELLAQVLDLLQRQGRVSYGALKRRFDLDDAYLASLKT |
| Ga0126376_124655521 | 3300010359 | Tropical Forest Soil | VTFDDILAQVIALLKRQGRVSYPALKIRFSLDDEY |
| Ga0126372_104343931 | 3300010360 | Tropical Forest Soil | MTFDDLLTQVLTLLQQQGRIAYGALKRRFGLDDAYLDDLKAELID |
| Ga0126372_116519822 | 3300010360 | Tropical Forest Soil | MTFDEILDQVITILKRQGRVSYPALKRRFALDDTYIEALK |
| Ga0126372_123223721 | 3300010360 | Tropical Forest Soil | GGSRMEFEDVLAQTIALLQRQGRISYSALKRRFQLDDTYLDDLKVELIEGV* |
| Ga0126377_107263811 | 3300010362 | Tropical Forest Soil | MEFEDILEQVIALLQHQGRVSYGALKRRLKLDDDYLED |
| Ga0126377_109005682 | 3300010362 | Tropical Forest Soil | VTVMTFDDILEQVIALLKRQGRVSYRALTMRFALDD |
| Ga0126377_130512442 | 3300010362 | Tropical Forest Soil | MTFDEILDQVITLLKRQGRVSYPALKIRFSLDDEYLEALKAEI |
| Ga0126379_107946991 | 3300010366 | Tropical Forest Soil | MTFEDILAQVLTLLQQQGRVSYGALKRRFGLDDAYLDDLKAELIDV* |
| Ga0126379_122701912 | 3300010366 | Tropical Forest Soil | VDFDTLLAQITALLQRQGRVSYGALKRRFALDGDYVQDL |
| Ga0126379_128314522 | 3300010366 | Tropical Forest Soil | MTFDDVLDQVIILLKRQGRVSYPALKIRFSLDDEYLEALK |
| Ga0126379_132332321 | 3300010366 | Tropical Forest Soil | MTFDDVLEQVVTLLKRQGRVSYRALKMRFNLDDEYLD |
| Ga0126381_1028669553 | 3300010376 | Tropical Forest Soil | VTFDDILAQVIDLLKRQGRVSYPALKIRFGLDDEYLEAL |
| Ga0126383_103143492 | 3300010398 | Tropical Forest Soil | MTFDDILVQIIDLLKRQGRVSYGALKRRYHLDDAYLED |
| Ga0126383_103712501 | 3300010398 | Tropical Forest Soil | MTFDEILEQVIALLKHQGRVSYPALKIRFSLDDEYLE |
| Ga0126383_134406051 | 3300010398 | Tropical Forest Soil | MTFDELRAQILTLLQQQGRVSYGAVTRGYGLDEDYLDDLKAELID |
| Ga0137392_111160092 | 3300011269 | Vadose Zone Soil | MTFDELLEQVIDLLQRQGRVSYGALKRRFALDDDYLRI* |
| Ga0137383_110414362 | 3300012199 | Vadose Zone Soil | MTFDELLAQVLDLLQRQGRISYGALKRRFDLDDAYL |
| Ga0137363_116008621 | 3300012202 | Vadose Zone Soil | MEFADILEQTSVLLQHQGRISYGALKRRFSLDDAYLEDLTRL |
| Ga0137380_107879431 | 3300012206 | Vadose Zone Soil | MNGGAAMTFDDILEQVIVLLQRQRRVAYGALRRRFALDDAYLED |
| Ga0137385_109980901 | 3300012359 | Vadose Zone Soil | MTFDDILEQVIALLKRQGRVSYRALRICFDLADAYLD |
| Ga0137360_104088221 | 3300012361 | Vadose Zone Soil | MTFDEVLAQIIDVLKRQGRVSYGALKRRYALDDAY |
| Ga0137360_105270901 | 3300012361 | Vadose Zone Soil | MEFAYTLEQTIALLHHQGRISYGALKRRFGLDDAYLEDLTRLW* |
| Ga0137397_105733171 | 3300012685 | Vadose Zone Soil | MEFADVLEQTMALLEQQGRISYGALKRRFGLDDAYLDDLKIELI |
| Ga0137395_105114992 | 3300012917 | Vadose Zone Soil | MEFEVVLEQTIALLQRQGRISYGALKRRFQLDDAYLEDLKVE |
| Ga0137395_105409121 | 3300012917 | Vadose Zone Soil | MTFDEILVQIIDLLKSQGRVSYGAIKRRYHLDDAYLEDLK |
| Ga0137419_119033822 | 3300012925 | Vadose Zone Soil | MTFDELLAQVLELLQRQGRVSYGALKRRFDLDDAYLQDLKDE |
| Ga0137416_109557773 | 3300012927 | Vadose Zone Soil | ILEQTIVLLQHQGRISYGALKRRFSLDDAYLEDLTRLW* |
| Ga0137404_111012192 | 3300012929 | Vadose Zone Soil | MRGGAIVTFDDILAQIIDLLKRQGRVSYSALKRRF |
| Ga0137407_121675652 | 3300012930 | Vadose Zone Soil | MEFAEILTQVIELLQRQGRISYGALKRRFHLDAEYLQDLKDELI |
| Ga0126375_106192432 | 3300012948 | Tropical Forest Soil | MTFDEILVQIIDLLKRQGRVSYGALKRRFDLDDDYL |
| Ga0126375_114115621 | 3300012948 | Tropical Forest Soil | MTFDEILEHVITLLKRQGRVSYPALKIRFSLNDEYLEALKAELLYV |
| Ga0126375_114437891 | 3300012948 | Tropical Forest Soil | MTFDDMLAHIIDLLKRQGRISYGALKRRYNLDDAYLED |
| Ga0126375_116541672 | 3300012948 | Tropical Forest Soil | MTFDEILDQVITLLKRQGRVSYPALKIRFSLDDEYLE |
| Ga0126369_116183661 | 3300012971 | Tropical Forest Soil | MTFDDILAQIIDLLKRQGRVSYGALKRRFDLDDAY |
| Ga0126369_121360831 | 3300012971 | Tropical Forest Soil | MTFDEILEQVIALLKRQGRVSYPALKVRFSLDDEYLEALKAE |
| Ga0134075_105878091 | 3300014154 | Grasslands Soil | MTFDEILEQVITLLKRQGRVSYPALKIRFSLDDEYLEA |
| Ga0163163_115517761 | 3300014325 | Switchgrass Rhizosphere | MEFDEILTQAIELLQRQGRISYGALKRRFHLDDEY |
| Ga0137418_105242761 | 3300015241 | Vadose Zone Soil | MTFDEILAQIIDLLKRQGRVSYSALKLRFHLDDDYLNDL |
| Ga0132258_133497842 | 3300015371 | Arabidopsis Rhizosphere | MTFDEILAQITDLLKRQGRVSYGALKRRYDLDDAYLE |
| Ga0182032_104376052 | 3300016357 | Soil | MTFDDILAQIIDLLKRQGRVSYSALKRRFDLNDDYLN |
| Ga0184610_11467131 | 3300017997 | Groundwater Sediment | MEFDDILGQIIALLQSQGRVSYGALKRRFQLDDDYL |
| Ga0184633_105511421 | 3300018077 | Groundwater Sediment | MTFDELLAHVLELLQRQGRVSYGALKRRFDLDDAYLDDLKTEL |
| Ga0184639_103062672 | 3300018082 | Groundwater Sediment | MTFDELLAQVVELLQHQGRVSYGALKRRFALGDDYLQDLKDELIDAQR |
| Ga0066667_123556501 | 3300018433 | Grasslands Soil | MTFDEILDQIITLLKRQGRVSYSALKRRFDLNDDYLNDLKDE |
| Ga0180112_12815122 | 3300019238 | Groundwater Sediment | MTFDAILDQILDVLRHQGRVSYWALKRRFDLHDDDIA |
| Ga0210378_103523992 | 3300021073 | Groundwater Sediment | MTFDDVLVQVIALLQRQGRVSYGALKRRFGLDEVYLDDLKTELIDA |
| Ga0126371_119379671 | 3300021560 | Tropical Forest Soil | MTFDEILEQVIALLKRQGRVSYGALKRRFDLDDTY |
| Ga0222625_11753162 | 3300022195 | Groundwater Sediment | MTFDELLAQVLELLQPQGRVSYGALKRRFSIDDAY |
| Ga0207712_104434132 | 3300025961 | Switchgrass Rhizosphere | MTFDEILEQVIALLWCQKRVAYGALQRRFNLDDAYLEDPKADLILL |
| Ga0207640_111595201 | 3300025981 | Corn Rhizosphere | MEFDEILAQVIELLQRQGRISYGALKRRFHLDDEY |
| Ga0207698_120228211 | 3300026142 | Corn Rhizosphere | MEFDEILTQAIELLQRQGRISYGALKRRFHLDDEYLQ |
| Ga0209388_12359881 | 3300027655 | Vadose Zone Soil | MTFDDILAQVIDLLKSQGRVSYGAIKRRYNLDDAYL |
| Ga0209814_101371221 | 3300027873 | Populus Rhizosphere | MSFDDILEQVITLLKRQGRVSYPALKIRFTLDDEYLEA |
| Ga0209465_104545993 | 3300027874 | Tropical Forest Soil | VTFDDILAQVIALLKRQGRVSYPALKIRFSLDDEYLEALKA |
| Ga0209590_105896752 | 3300027882 | Vadose Zone Soil | MEFEEVLEQTIALLQHQGRVSYGALKRRFKLDDTYL |
| Ga0207428_108943952 | 3300027907 | Populus Rhizosphere | MTFDELLSQITDLLQRQGRVSYGALRRRYALDDVYLQDL |
| Ga0209889_10998001 | 3300027952 | Groundwater Sand | MTFDDVLVQVIALLQRQGRVSYGALNRRFGLDEVYLDDLKTEL |
| Ga0137415_104817123 | 3300028536 | Vadose Zone Soil | MTFDEILAQIIDLLKRQGRVSYSALKRRFDLNDDYLNDLKDE |
| Ga0137415_105275731 | 3300028536 | Vadose Zone Soil | FAYSLQQPIALLQHQGRISYGALKRRFGLDDAYLEDLTRLW |
| Ga0247819_103948862 | 3300028608 | Soil | MEFADILEQIITLLQHQGRISYGALKRRFGLDDAYLDDLKIELIEA |
| Ga0299907_103068601 | 3300030006 | Soil | MNFDDILEQVITLLKRQGRVSYSALRRRFEIDEAYLN |
| Ga0299907_113466942 | 3300030006 | Soil | MNFDEILEQVIALLKRQGRVSYRALKMRFEEIDDEYLDVL |
| Ga0247647_10005645 | 3300030570 | Soil | MTCMTFDEILEQVIMLLQRQKRVAYGALKRRFDLDDAYLEDLYEQA |
| Ga0247647_10036294 | 3300030570 | Soil | MTFDDLLAHVLEILQRQGRVSYGALKRRFALDDAYLEDLK |
| Ga0310915_112678952 | 3300031573 | Soil | MTFDAILAQVLDLLQHQGRVAYRALKVRFNLDNDYLEAL |
| Ga0307468_1017794942 | 3300031740 | Hardwood Forest Soil | MEFEEVLEQTIALLQRQGRVSYGALKRRFKLDDAYLEDLK |
| Ga0306921_101282771 | 3300031912 | Soil | MTFDEILAQIIDLLKRQGRVSYPALKIRFSLDDEYLDSIGIFIFCD |
| Ga0310910_113168191 | 3300031946 | Soil | VTFDDILEQVIALLKRQGRVSYPALKIRFSLDDAYL |
| Ga0326597_120814312 | 3300031965 | Soil | MTFEEILNQAIALLQRQGRVSYRTLKRQVDLDEAYVEDIKLELIEGHQV |
| Ga0310890_102098742 | 3300032075 | Soil | MTFDELLSQITDLLQRQGRVSYGALRRRYALDDVYL |
| Ga0310890_107889151 | 3300032075 | Soil | VTFDEILEQIIALLKRQGRVSYSALKIRFNLTDAYLEAFK |
| Ga0310890_118464491 | 3300032075 | Soil | MEFEAVLEQTIALLQRQGRISYGALKRRFQLDDAYLE |
| Ga0306924_109540061 | 3300032076 | Soil | MTFDEILAQIIDLLKRQGRVSYPALKIRFSLDDEYLDSIGI |
| Ga0310896_102626781 | 3300032211 | Soil | MTFDELLSQITDLLQLQGRVSYGALRRRFDLDEDYLED |
| Ga0306920_1005492461 | 3300032261 | Soil | MTFDAILAQVLDLLQHQGRVAYRALKVRFNLDNDYLEALKDEL |
| Ga0214471_109196783 | 3300033417 | Soil | MTFDEILDQVRELLRQRGRLTYGAVKRRFDLDEAYLEDIKGELI |
| Ga0247830_102207171 | 3300033551 | Soil | MTFDDILDQILDVLRRQGRVSYWALKRRFDLHDDDIAGLK |
| ⦗Top⦘ |