| Basic Information | |
|---|---|
| Family ID | F069858 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MANKNGRKGSQFETDVMKWLRNAGAMAERLTKAGAKDEGDMV |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 87.70 % |
| % of genes near scaffold ends (potentially truncated) | 97.56 % |
| % of genes from short scaffolds (< 2000 bps) | 83.74 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (48.780 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (26.016 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.472 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13481 | AAA_25 | 18.70 |
| PF03796 | DnaB_C | 6.50 |
| PF02467 | Whib | 4.07 |
| PF12705 | PDDEXK_1 | 3.25 |
| PF01370 | Epimerase | 1.63 |
| PF01807 | zf-CHC2 | 0.81 |
| PF01402 | RHH_1 | 0.81 |
| PF09250 | Prim-Pol | 0.81 |
| PF04545 | Sigma70_r4 | 0.81 |
| PF00227 | Proteasome | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 6.50 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 6.50 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.81 |
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 51.22 % |
| Unclassified | root | N/A | 48.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000756|JGI12421J11937_10175734 | Not Available | 513 | Open in IMG/M |
| 3300001950|GOS2227_1054146 | Not Available | 1097 | Open in IMG/M |
| 3300002161|JGI24766J26685_10054120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 896 | Open in IMG/M |
| 3300002408|B570J29032_109459246 | Not Available | 780 | Open in IMG/M |
| 3300003497|JGI25925J51416_10079474 | Not Available | 810 | Open in IMG/M |
| 3300005417|Ga0068884_1489813 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300005419|Ga0068883_1538883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 870 | Open in IMG/M |
| 3300005420|Ga0068879_1451259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
| 3300005517|Ga0070374_10350744 | Not Available | 745 | Open in IMG/M |
| 3300005517|Ga0070374_10433254 | Not Available | 659 | Open in IMG/M |
| 3300005525|Ga0068877_10148721 | All Organisms → Viruses → Predicted Viral | 1433 | Open in IMG/M |
| 3300005527|Ga0068876_10724495 | Not Available | 530 | Open in IMG/M |
| 3300005528|Ga0068872_10402790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
| 3300005565|Ga0068885_1855659 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300005581|Ga0049081_10158330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
| 3300005582|Ga0049080_10099988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides massiliensis | 987 | Open in IMG/M |
| 3300006802|Ga0070749_10007721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7029 | Open in IMG/M |
| 3300007304|Ga0102689_1491932 | All Organisms → Viruses → Predicted Viral | 1318 | Open in IMG/M |
| 3300007321|Ga0102692_1008780 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
| 3300007523|Ga0105052_10016156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6091 | Open in IMG/M |
| 3300007523|Ga0105052_10425251 | Not Available | 868 | Open in IMG/M |
| 3300007540|Ga0099847_1028851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides massiliensis | 1786 | Open in IMG/M |
| 3300008107|Ga0114340_1263161 | Not Available | 518 | Open in IMG/M |
| 3300008116|Ga0114350_1197143 | Not Available | 500 | Open in IMG/M |
| 3300008117|Ga0114351_1140025 | All Organisms → Viruses → Predicted Viral | 1832 | Open in IMG/M |
| 3300008120|Ga0114355_1008486 | Not Available | 7109 | Open in IMG/M |
| 3300008120|Ga0114355_1153695 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
| 3300008266|Ga0114363_1154733 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300008266|Ga0114363_1212176 | Not Available | 583 | Open in IMG/M |
| 3300008266|Ga0114363_1226285 | Not Available | 549 | Open in IMG/M |
| 3300008266|Ga0114363_1247690 | Not Available | 503 | Open in IMG/M |
| 3300008267|Ga0114364_1122399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 771 | Open in IMG/M |
| 3300008450|Ga0114880_1092033 | Not Available | 1189 | Open in IMG/M |
| 3300008450|Ga0114880_1214368 | Not Available | 633 | Open in IMG/M |
| 3300008450|Ga0114880_1277776 | Not Available | 503 | Open in IMG/M |
| 3300009082|Ga0105099_10283990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides massiliensis | 967 | Open in IMG/M |
| 3300009082|Ga0105099_10977899 | Not Available | 538 | Open in IMG/M |
| 3300009158|Ga0114977_10776858 | Not Available | 505 | Open in IMG/M |
| 3300009163|Ga0114970_10060194 | Not Available | 2427 | Open in IMG/M |
| 3300009163|Ga0114970_10585954 | Not Available | 601 | Open in IMG/M |
| 3300009165|Ga0105102_10187246 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
| 3300009165|Ga0105102_10563182 | Not Available | 626 | Open in IMG/M |
| 3300009180|Ga0114979_10266962 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300009183|Ga0114974_10089841 | All Organisms → Viruses → Predicted Viral | 1991 | Open in IMG/M |
| 3300009469|Ga0127401_1019747 | All Organisms → Viruses → Predicted Viral | 1980 | Open in IMG/M |
| 3300009474|Ga0127390_1003011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5437 | Open in IMG/M |
| 3300010157|Ga0114964_10283156 | Not Available | 787 | Open in IMG/M |
| 3300010885|Ga0133913_11361387 | Not Available | 1808 | Open in IMG/M |
| 3300010970|Ga0137575_10002234 | All Organisms → Viruses → Predicted Viral | 3817 | Open in IMG/M |
| 3300011268|Ga0151620_1084892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1009 | Open in IMG/M |
| 3300013372|Ga0177922_11330954 | Not Available | 707 | Open in IMG/M |
| 3300017701|Ga0181364_1003321 | Not Available | 2853 | Open in IMG/M |
| 3300017723|Ga0181362_1121224 | Not Available | 512 | Open in IMG/M |
| 3300017736|Ga0181365_1012796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2094 | Open in IMG/M |
| 3300017747|Ga0181352_1194474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
| 3300017777|Ga0181357_1206775 | Not Available | 698 | Open in IMG/M |
| 3300017784|Ga0181348_1208257 | Not Available | 697 | Open in IMG/M |
| 3300017785|Ga0181355_1028607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2410 | Open in IMG/M |
| 3300019122|Ga0188839_1020096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 697 | Open in IMG/M |
| 3300019784|Ga0181359_1132212 | Not Available | 878 | Open in IMG/M |
| 3300019784|Ga0181359_1175151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300020220|Ga0194119_10745574 | Not Available | 586 | Open in IMG/M |
| 3300020603|Ga0194126_10732560 | Not Available | 573 | Open in IMG/M |
| 3300021519|Ga0194048_10359219 | Not Available | 518 | Open in IMG/M |
| 3300021963|Ga0222712_10668921 | Not Available | 589 | Open in IMG/M |
| 3300022179|Ga0181353_1086100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides massiliensis | 788 | Open in IMG/M |
| 3300022190|Ga0181354_1130198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 802 | Open in IMG/M |
| 3300022190|Ga0181354_1169023 | Not Available | 672 | Open in IMG/M |
| 3300022198|Ga0196905_1024032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1882 | Open in IMG/M |
| 3300022407|Ga0181351_1113212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1029 | Open in IMG/M |
| 3300024480|Ga0255223_1005385 | All Organisms → Viruses → Predicted Viral | 1845 | Open in IMG/M |
| 3300024531|Ga0255228_1003408 | All Organisms → Viruses → Predicted Viral | 2551 | Open in IMG/M |
| 3300024566|Ga0256309_1010868 | All Organisms → Viruses → Predicted Viral | 2501 | Open in IMG/M |
| 3300025647|Ga0208160_1156444 | Not Available | 547 | Open in IMG/M |
| 3300025896|Ga0208916_10386184 | Not Available | 611 | Open in IMG/M |
| 3300027608|Ga0208974_1160402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300027659|Ga0208975_1199502 | Not Available | 535 | Open in IMG/M |
| 3300027689|Ga0209551_1082629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides massiliensis | 1047 | Open in IMG/M |
| 3300027733|Ga0209297_1250416 | Not Available | 680 | Open in IMG/M |
| 3300027734|Ga0209087_1043829 | Not Available | 2075 | Open in IMG/M |
| 3300027741|Ga0209085_1216642 | Not Available | 769 | Open in IMG/M |
| 3300027749|Ga0209084_1329429 | Not Available | 566 | Open in IMG/M |
| 3300027756|Ga0209444_10027489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2751 | Open in IMG/M |
| 3300027756|Ga0209444_10134465 | Not Available | 965 | Open in IMG/M |
| 3300027759|Ga0209296_1276991 | Not Available | 677 | Open in IMG/M |
| 3300027772|Ga0209768_10292248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 688 | Open in IMG/M |
| 3300027793|Ga0209972_10373968 | Not Available | 611 | Open in IMG/M |
| 3300027806|Ga0209985_10405470 | Not Available | 590 | Open in IMG/M |
| 3300028025|Ga0247723_1023041 | Not Available | 2065 | Open in IMG/M |
| 3300028025|Ga0247723_1046924 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300028027|Ga0247722_10107474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides massiliensis | 1028 | Open in IMG/M |
| 3300028108|Ga0256305_1168206 | Not Available | 520 | Open in IMG/M |
| 3300029930|Ga0119944_1004198 | All Organisms → Viruses → Predicted Viral | 2370 | Open in IMG/M |
| 3300031578|Ga0307376_10376447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides massiliensis | 937 | Open in IMG/M |
| 3300031746|Ga0315293_11038740 | Not Available | 581 | Open in IMG/M |
| 3300031758|Ga0315907_10022651 | Not Available | 5798 | Open in IMG/M |
| 3300031758|Ga0315907_10428944 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300031784|Ga0315899_10938978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides massiliensis | 776 | Open in IMG/M |
| 3300031784|Ga0315899_10963670 | Not Available | 762 | Open in IMG/M |
| 3300031786|Ga0315908_11579011 | Not Available | 509 | Open in IMG/M |
| 3300031787|Ga0315900_10243867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1542 | Open in IMG/M |
| 3300031857|Ga0315909_10303124 | Not Available | 1193 | Open in IMG/M |
| 3300031951|Ga0315904_10275614 | All Organisms → Viruses → Predicted Viral | 1593 | Open in IMG/M |
| 3300031951|Ga0315904_10312309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1467 | Open in IMG/M |
| 3300031951|Ga0315904_10318481 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| 3300031951|Ga0315904_11169424 | Not Available | 593 | Open in IMG/M |
| 3300031963|Ga0315901_10566104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300031963|Ga0315901_11034370 | Not Available | 570 | Open in IMG/M |
| 3300032093|Ga0315902_10181399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2143 | Open in IMG/M |
| 3300032116|Ga0315903_10148878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2153 | Open in IMG/M |
| 3300032116|Ga0315903_10942740 | Not Available | 611 | Open in IMG/M |
| 3300033418|Ga0316625_101121066 | Not Available | 713 | Open in IMG/M |
| 3300033981|Ga0334982_0371013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 657 | Open in IMG/M |
| 3300034012|Ga0334986_0524502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 577 | Open in IMG/M |
| 3300034020|Ga0335002_0666261 | Not Available | 528 | Open in IMG/M |
| 3300034022|Ga0335005_0178407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1331 | Open in IMG/M |
| 3300034062|Ga0334995_0065758 | All Organisms → Viruses → Predicted Viral | 2878 | Open in IMG/M |
| 3300034092|Ga0335010_0460007 | Not Available | 679 | Open in IMG/M |
| 3300034106|Ga0335036_0183730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1463 | Open in IMG/M |
| 3300034106|Ga0335036_0217606 | All Organisms → Viruses → Predicted Viral | 1313 | Open in IMG/M |
| 3300034120|Ga0335056_0498521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 642 | Open in IMG/M |
| 3300034122|Ga0335060_0179722 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 26.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 13.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.76% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.06% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.25% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.25% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.25% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.63% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.81% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.81% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.81% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.81% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.81% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.81% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.81% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001950 | Marine microbial communities from Delaware Bay, New Jersey, USA - GS011 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005419 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005565 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007523 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009474 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 3m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300028108 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_101757342 | 3300000756 | Freshwater And Sediment | MANPNGRKGSQFETDVMRWLRNAGAFCEKLALAGKA |
| GOS2227_10541465 | 3300001950 | Marine | LKRGLKISNPNGRKGSGFEIAIMKFLRTLGIFVERLVKAGKNDEG |
| JGI24766J26685_100541201 | 3300002161 | Freshwater And Sediment | MANKNGRKGSQFETDVMKWLRNAGVMAERLTKAGAKDEGDMVVIISGET |
| B570J29032_1094592461 | 3300002408 | Freshwater | MANPNGRKGAAFETAVLKFFRSAGVLAERLTKAGARDEGD |
| JGI25925J51416_100794741 | 3300003497 | Freshwater Lake | MANPNGRKGAQFETDVMRWLRSAGALCERLVKAGKNDEGDLVAIIAGKQY |
| Ga0068884_14898134 | 3300005417 | Freshwater Lake | MANKNGRKGSLFETTVLKWLRSKNVVAERLTKAGAKDEGDIVVMANGKTYIL |
| Ga0068883_15388833 | 3300005419 | Freshwater Lake | MANKNGRKGSLFETTVLKWLRSKNVVAERLTKAGAKDEGDIV |
| Ga0068879_14512593 | 3300005420 | Freshwater Lake | MANKNGRKGSLFETTVLKWLRSKNVVAERLTKAGAKDEGDIVVMANGKT |
| Ga0070374_103507443 | 3300005517 | Freshwater Lake | MANPNGRKGSQFETDVMRWLRSAGALCERLVKAGKHDEGDLVAIIAGKQYI |
| Ga0070374_104332541 | 3300005517 | Freshwater Lake | MANPNGRKGAQFETDVMRWLRSAGALCERLVKAGKHDEGDLVAIIAGKQYI |
| Ga0068877_101487211 | 3300005525 | Freshwater Lake | MANKNGRKGSQFETDVMKWLRSKSVIAERLTKAGAKDEGDMVVI |
| Ga0068876_107244951 | 3300005527 | Freshwater Lake | MANKNGRKGSVFETDVMKWLRGAGVTAERLTKAGA |
| Ga0068872_104027901 | 3300005528 | Freshwater Lake | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGAKDEGDLYVFLQG |
| Ga0068885_18556594 | 3300005565 | Freshwater Lake | MANKNGRKGSLFETTVLKWLRSKNVVAERLTKAGAKDEGDIVVMA |
| Ga0049081_101583301 | 3300005581 | Freshwater Lentic | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGAKDEGDLYVFL |
| Ga0049080_100999881 | 3300005582 | Freshwater Lentic | MANSNGRKGSKFETDVLKWLRQMGVLAERLTKAGSKDEGDMVAIIA |
| Ga0070749_1000772113 | 3300006802 | Aqueous | MANPNGRKGAQFETDVMKWLRSVGAICERLTKAGAK |
| Ga0102689_14919321 | 3300007304 | Freshwater Lake | MANKNGRKGSLFETTVLKWLRSKNVVAERLTKAGAKDEGDIVVMANGKTYI |
| Ga0102692_10087804 | 3300007321 | Freshwater Lake | MANKNGRKGSLFETTVLKWLRSKNVVAERLTKAGAKDEGDIVVMANGKTYILE |
| Ga0105052_100161561 | 3300007523 | Freshwater | MAKNQRIGSKFETDVMRWFRSVGVAAERLTKAGSKDEGDLVVVVAGQ |
| Ga0105052_104252511 | 3300007523 | Freshwater | MSQYSKAKGAKFETDVMRWFRSAGVLAERLTKAGSKDEGDLVCIIA |
| Ga0099847_10288515 | 3300007540 | Aqueous | MASKYNRVKGSIFETDVMKWLRKSGVLAERLTKAGSKD |
| Ga0114340_12631611 | 3300008107 | Freshwater, Plankton | VANPNGRKGSQFETDVMKWLRKMGAMAERLTKAGAKD |
| Ga0114350_11971433 | 3300008116 | Freshwater, Plankton | MANPNGRKGAQFETDVMKWFRAMGAVCERLTKTGAKDEGDLVAVVAGKT |
| Ga0114351_11400255 | 3300008117 | Freshwater, Plankton | VANPNGRKGSQFETDVMRFLRSVGLLAERLTKAGSKDEGDIVCVVAG |
| Ga0114351_11638213 | 3300008117 | Freshwater, Plankton | MANKNGRKGSQFETDVMKWLRKCGVMAERLTKAGAKDEGDMVAIIAGKTYILEL |
| Ga0114355_10084862 | 3300008120 | Freshwater, Plankton | MANPNGRKGSQFETDVMKWLRKCGVMAERLTKAGAKDEGDMVAIIAGKTYIL* |
| Ga0114355_11536955 | 3300008120 | Freshwater, Plankton | VANPNGRKGSQFETDVMRFLRSVGLLAERLTKAGSKDEGDIVCVVA |
| Ga0114363_11547334 | 3300008266 | Freshwater, Plankton | MANPNGRKGAQYETDVMRWFREHEAVAERLTKAGAKDEGDG* |
| Ga0114363_12121763 | 3300008266 | Freshwater, Plankton | MANPNGRKGALFETDVMKWLRSVGAIAERLTKAGSKDEGDI |
| Ga0114363_12262852 | 3300008266 | Freshwater, Plankton | MANPNGRKGAQFETDVMKWFRAMGAVCERLTKTGAKDEGDLVAVVAGKTY |
| Ga0114363_12476903 | 3300008266 | Freshwater, Plankton | MANKNGRKGSQFETDVMKWLRNAGAMAERLTKAGAKDE |
| Ga0114364_11223991 | 3300008267 | Freshwater, Plankton | MANKNGRKGSQFETDVMKWLRKAGVAAERLTKAGAKDEGDMVAVI |
| Ga0114880_10920331 | 3300008450 | Freshwater Lake | MANPNGRKGALFETDVMRWLRSVGAIAERLTKAGS |
| Ga0114880_12143683 | 3300008450 | Freshwater Lake | MANPNGRKGSQFETDVMRFLRSVGLLAERLTKAGSKDEGDIV |
| Ga0114880_12777761 | 3300008450 | Freshwater Lake | MANPNGRKGAQYETDVMRWFREHEAVAERLTKAGAKDEGDLYVFLQGKTYI |
| Ga0105099_102839902 | 3300009082 | Freshwater Sediment | MANKNGRKGSQFETDVMKWLRSKSVIAERLTKAGAKDEGDMVVIISGETYIL |
| Ga0105099_109778992 | 3300009082 | Freshwater Sediment | MANPNGRKGAQFETDVMRWLRSAGALCERLVKAGSADEGDLCAVVAG |
| Ga0114977_107768581 | 3300009158 | Freshwater Lake | MANKNGRKGSQFETDVMKWLRNKGVIAERLTKAGAKDEGDMVVIVSGET |
| Ga0114970_1006019410 | 3300009163 | Freshwater Lake | MANPNGRKGALFETAVMKWLRSVGATAERLTKAGSKDEGDIVCIISG |
| Ga0114970_105859543 | 3300009163 | Freshwater Lake | MANPNGRKGALFETDVMRWLRSVGAMAERLTKAGSKDEGDIVAIVAG |
| Ga0105102_101872461 | 3300009165 | Freshwater Sediment | MANPNGRKGSQFETDVMKWFRSMGAMAERLTKAGAKDEGDMVVIISGETYILE |
| Ga0105102_105631822 | 3300009165 | Freshwater Sediment | MANPNGRKGAQFETDVMRWLRSAGALCERLVKAGKNDE |
| Ga0114979_102669621 | 3300009180 | Freshwater Lake | MANKNGRKGSQFETDVMKWLRNAGAMAERLTKAGAKD |
| Ga0114974_100898415 | 3300009183 | Freshwater Lake | MANKNGRKGSQFETDVMKWFRKAGIIAERLTKAGAKDEGDMV |
| Ga0127401_10197471 | 3300009469 | Meromictic Pond | LANPNGRKGAQFETDVMKWLRKAGAMAERLTKAGAKDEGDMV |
| Ga0127390_100301111 | 3300009474 | Meromictic Pond | MANPNGRKGAQFETDVMKWFRAMGAVCERLTKTGAKDEGDLV |
| Ga0114964_102831564 | 3300010157 | Freshwater Lake | MANPNGRKGAQYETDVMRWLRSAGALCERLVRAGKADEGDLVAIIAG |
| Ga0133913_113613875 | 3300010885 | Freshwater Lake | LANPNGRKGAAFETAVMKWLRSVGVLAERLTKTGAKD |
| Ga0137575_100022349 | 3300010970 | Pond Fresh Water | MANPNGRKGSKFETDVLKWLRQTKDVLAERLTKAGAKDEGDLV |
| Ga0151620_10848923 | 3300011268 | Freshwater | LANKNGRKGSVFETDVMKWLRGAGVTAERLTKAGAKD |
| Ga0177922_113309543 | 3300013372 | Freshwater | VANPNGRKGALFETSVMKWLREHGVSAERLTKAGS |
| Ga0181364_10033211 | 3300017701 | Freshwater Lake | MANPNGRKGALFETAVMKWLRSVGANAERLSKAGSNDEGDI |
| Ga0181362_11212241 | 3300017723 | Freshwater Lake | MANPNGRKGSQFETDVMRWLRSAGALCERLVKAGKHDEGDLVAIIAGKQYIL |
| Ga0181365_10127961 | 3300017736 | Freshwater Lake | MANKNGRKGSLFETTVLKWLRSKSVVAERLTKAGAKDEGDIVVMVNGKTYILE |
| Ga0181352_11944742 | 3300017747 | Freshwater Lake | MANPNGRKGSKFEIDVLKFFRKMGLWIERLTKAGA |
| Ga0181357_12067754 | 3300017777 | Freshwater Lake | MANPNGRKGAQFETDVMKWFRAMGAVCERLTKTGAKD |
| Ga0181348_12082571 | 3300017784 | Freshwater Lake | MANPNGRKGAAFETAVLKFFRAAGVVAERLTKAGARDEGD |
| Ga0181355_10286079 | 3300017785 | Freshwater Lake | MANPNGRKGSQFETDVMRWLRSAGALCERLVKAGKHDEGDLVAIIAG |
| Ga0188839_10200961 | 3300019122 | Freshwater Lake | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGA |
| Ga0181359_11322124 | 3300019784 | Freshwater Lake | MANPNGRKGSQFETDVMRWLRSAGALCERLVKAGKHDEGDLVAII |
| Ga0181359_11751513 | 3300019784 | Freshwater Lake | MANKNGRKGSQFETDVMKWLRSKGVIAERLTKAGAKD |
| Ga0194119_107455744 | 3300020220 | Freshwater Lake | MANPSGRKGAQFETDVMKWFRTMGVICERLTKVGTKDEGDLVATIA |
| Ga0194126_107325601 | 3300020603 | Freshwater Lake | MANPNGRKGAQFETDVMKWFRTMGVICERLTKVGTKDEGDLVATIAGKTYI |
| Ga0194048_103592193 | 3300021519 | Anoxic Zone Freshwater | MANPNGRKGSKFETDVLKWLRLTKGVLAERLTKAGAKDEGDLVVI |
| Ga0222712_106689213 | 3300021963 | Estuarine Water | MANPNGRKGALFETDVMRWLRSVGAIAERLTKAGSKDEGDIVAIVA |
| Ga0181353_10861002 | 3300022179 | Freshwater Lake | MANKNGRKGSQFETDVMKWLRNAGVMAERLTKAGAKDEGDMVVIISGETYILD |
| Ga0181354_11301981 | 3300022190 | Freshwater Lake | MANPNGRKGAQFETDVMRWLREHEAVAERLTKAGAKDEGDLYVFL |
| Ga0181354_11690231 | 3300022190 | Freshwater Lake | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGAKDEGDL |
| Ga0196905_10240321 | 3300022198 | Aqueous | MANPNGRKGAQFETDVMKWLRSKGVIAERLTKAGAKD |
| Ga0181351_11132121 | 3300022407 | Freshwater Lake | MANPNGRKGAQFETDVMRWLRDNEAVAERLTKAGAKDEGDLYVFVRGKT |
| Ga0255223_10053855 | 3300024480 | Freshwater | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGAKD |
| Ga0255228_10034087 | 3300024531 | Freshwater | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGAKDEGDLYVFLQGKTY |
| Ga0256309_10108681 | 3300024566 | Freshwater | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGAKDEGDLY |
| Ga0208160_11564441 | 3300025647 | Aqueous | MVNKNGRKGSQFETDVMKWLRNAGVMAERLTKAGA |
| Ga0208916_103861843 | 3300025896 | Aqueous | MANPNGRKGAAFETAVLKFFRAAGVVAERLTKAGARDEGDLVV |
| Ga0208974_11604021 | 3300027608 | Freshwater Lentic | MANKNGRKGSQFETDVMKWLRSKGVIAERLTKAGAKDEGD |
| Ga0208975_11995023 | 3300027659 | Freshwater Lentic | MANPNGRKGSQFETDVMKWLRKAGAVAERLTKAGAKDEGDMVCIVAG |
| Ga0209551_10826291 | 3300027689 | Freshwater Lake | MANKNGRKGSQFETDVMKWLRNAGAMAERLTKAGAKDEGDM |
| Ga0209297_12504161 | 3300027733 | Freshwater Lake | MANPNGRKGALFETDVMRWLRSVGAIAERLTKAGSKDEGDIVAIV |
| Ga0209087_10438291 | 3300027734 | Freshwater Lake | MANPNGRKGALFETDVMRWLRSVGAIAERLTKAGSKDEGDIVA |
| Ga0209085_12166421 | 3300027741 | Freshwater Lake | MANPNGRKGAQFETDVMRWLRAAGALCERLVKAGVN |
| Ga0209084_13294291 | 3300027749 | Freshwater Lake | VNSMANPNGRKGSQFETDVMKWLRKMGAMAERLTKAGAKDEG |
| Ga0209444_1002748910 | 3300027756 | Freshwater Lake | MANPNGRKGAQFETDVMRWLRSAGALCERLVKAGKHDEGDLVAI |
| Ga0209444_101344654 | 3300027756 | Freshwater Lake | MANPNGRKGSQFETDVMRWLRSAGALCERLVKAGKHDEGDLVAI |
| Ga0209296_12769911 | 3300027759 | Freshwater Lake | VANPNGRKGAQFETDVMRWLRTAGALCERLVKAGKNDEGDLVAIIA |
| Ga0209768_102922483 | 3300027772 | Freshwater Lake | MANKNGRKGSQFETDVMKWLRNAGAMAERLTKAGAKDEGDMV |
| Ga0209972_103739681 | 3300027793 | Freshwater Lake | MANPNGRKGAQYETDVMRWFREHEAVAERLTKAGAKDEGDLYV |
| Ga0209985_104054701 | 3300027806 | Freshwater Lake | MANPNGRKGAQFETDVMRWLRTAGALCERLVKAGKNDEGDLVAIIAG |
| Ga0247723_10230411 | 3300028025 | Deep Subsurface Sediment | VANPNGRKGALFETSVMKWLREHGVSAERLTKAGSK |
| Ga0247723_10469243 | 3300028025 | Deep Subsurface Sediment | MANKNGRKGSQFETDVMKWLRSKSVIAERLTKAGAKDEGDMV |
| Ga0247722_101074741 | 3300028027 | Deep Subsurface Sediment | MANPNGRKGAKFETDVMKWLRDKGVSAERLTKAGAKDEG |
| Ga0256305_11682061 | 3300028108 | Freshwater | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGAKDE |
| Ga0119944_10041986 | 3300029930 | Aquatic | MANPNGRKGAQFETDVMRWLREHEAVAERLTKAGAKDE |
| Ga0307376_103764471 | 3300031578 | Soil | MANPNGRKGSQFETDVMKWLRKCGVMAERLTKAGAKDEG |
| Ga0315293_110387403 | 3300031746 | Sediment | MANKNGRKGSQFETDVMKWLRNAGATAERLTKAGAKDEGDM |
| Ga0315907_1002265113 | 3300031758 | Freshwater | MANKNGRKGSQFETDVMKWLRNAGVIAERLTKAGAKDEGDMVVIISG |
| Ga0315907_104289443 | 3300031758 | Freshwater | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGAK |
| Ga0315899_109389781 | 3300031784 | Freshwater | MANKNGRKGSQFETDVMKWLRKAGVAAERLTKAGAKDEGDMVAVIAGETYILE |
| Ga0315899_109636703 | 3300031784 | Freshwater | VANPNGRKGALFETSVMKWLREHGVSAERLTKAGSKDEG |
| Ga0315908_115790112 | 3300031786 | Freshwater | MANPNGRKGAQFETDVMRWLRGAGALCERLVKAGKN |
| Ga0315900_102438675 | 3300031787 | Freshwater | MANPNGRKGAQFETDVMRWLRTAGALCERLVKAGKNDEGD |
| Ga0315909_103031241 | 3300031857 | Freshwater | MANPNGRKGALFETDVMRWLRSVGAIAERLTKAGSKDEG |
| Ga0315904_102756141 | 3300031951 | Freshwater | MANPNGRKGAQFETDTMRWLRENEAIAERLTKAGAKDEGDLYVFLK |
| Ga0315904_103123091 | 3300031951 | Freshwater | MANPNGRKGAQFETDVMRWLRTAGALCERLVKAGKNDEGDL |
| Ga0315904_103184813 | 3300031951 | Freshwater | MANKNGRKGSQFETDVMKWLRNAGAMAERLTKAGAKDEGDMVVII |
| Ga0315904_111694243 | 3300031951 | Freshwater | MANPNGRKGSQFETDVMRFLRSVGLLAERLTKAGSKDEGDIVCVVAGNTYI |
| Ga0315901_105661041 | 3300031963 | Freshwater | MANPNGRKGAQFETDVMRWLRDNNAVAERLTKAGAKDEGDLYVFLQ |
| Ga0315901_110343702 | 3300031963 | Freshwater | VANPNGRKGAQFETDVMKWLRSMGAVAERLTKAGA |
| Ga0315902_101813991 | 3300032093 | Freshwater | MANPNGRKGAQFETDVMRWLRGAGALCERLVKAGKHDEGDLVAIIGGKQYI |
| Ga0315903_101488781 | 3300032116 | Freshwater | MANPNGRKGAQFETDVMRWLRTAGALCERLVKAGKNDEGDLVAVIAG |
| Ga0315903_109427403 | 3300032116 | Freshwater | VANPNGRKGSQWEIDVLKLFRKIGLWIERLTKAGANDE |
| Ga0316625_1011210661 | 3300033418 | Soil | LANKNGRKGSQFETDVMKWLRKCGVVAERLTKAGAKDE |
| Ga0334982_0371013_3_137 | 3300033981 | Freshwater | MANKNGRKGSQFETDVMKWLRSKSVIAERLTKAGAKDEGDMVVII |
| Ga0334986_0524502_426_575 | 3300034012 | Freshwater | MANKNGRKGSQFETDVMKWLRNAGVMAERLTKAGAKDEGDMVVIISGETY |
| Ga0335002_0666261_416_526 | 3300034020 | Freshwater | MANPNGRKGALFETAVMKWLRSVGATAERLTKAGSKD |
| Ga0335005_0178407_1204_1329 | 3300034022 | Freshwater | MANPNGRKGAQFETDVMRWLRGAGALCERLVKAGKNDEGDLV |
| Ga0334995_0065758_1_126 | 3300034062 | Freshwater | MANKNGRKGSQFETDVMKWLRNAGVMAERLTKAGAKDEGDMV |
| Ga0335010_0460007_542_679 | 3300034092 | Freshwater | MSNKNGRKGSQFETDVMKWLRNAGAMAERLTKAGAKDEGDMVVIIS |
| Ga0335036_0183730_2_112 | 3300034106 | Freshwater | MANPNGRKGAQFETDVMRWLRNAGAFCEKLALAGKAD |
| Ga0335036_0217606_1185_1313 | 3300034106 | Freshwater | MANKNGRKGSQFETDVMKWLRSKSVIAERLTKAGAKDEGDMVV |
| Ga0335056_0498521_1_126 | 3300034120 | Freshwater | MANKNGRKGSQFETDVMKWLRSKGVIAERLTKAGAKDEGDMV |
| Ga0335060_0179722_2_121 | 3300034122 | Freshwater | MANKNGRKGSQFETDVMKWLRNAGAMAERLTKAGAKDEGD |
| ⦗Top⦘ |