| Basic Information | |
|---|---|
| Family ID | F069840 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQ |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 13.82 % |
| % of genes near scaffold ends (potentially truncated) | 30.08 % |
| % of genes from short scaffolds (< 2000 bps) | 82.11 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (58.537 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (29.268 % of family members) |
| Environment Ontology (ENVO) | Unclassified (58.537 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.537 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.19% β-sheet: 10.64% Coil/Unstructured: 36.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF10926 | DUF2800 | 35.77 |
| PF00271 | Helicase_C | 10.57 |
| PF08774 | VRR_NUC | 4.07 |
| PF10991 | DUF2815 | 1.63 |
| PF13481 | AAA_25 | 0.81 |
| PF08291 | Peptidase_M15_3 | 0.81 |
| PF00239 | Resolvase | 0.81 |
| PF00145 | DNA_methylase | 0.81 |
| PF01555 | N6_N4_Mtase | 0.81 |
| PF04851 | ResIII | 0.81 |
| PF00166 | Cpn10 | 0.81 |
| PF05037 | DUF669 | 0.81 |
| PF13443 | HTH_26 | 0.81 |
| PF07120 | DUF1376 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.81 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.81 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.81 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.86 % |
| Unclassified | root | N/A | 21.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002274|B570J29581_103771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 957 | Open in IMG/M |
| 3300002835|B570J40625_101378557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
| 3300003277|JGI25908J49247_10098198 | Not Available | 707 | Open in IMG/M |
| 3300003393|JGI25909J50240_1056175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300004240|Ga0007787_10002518 | All Organisms → Viruses | 6625 | Open in IMG/M |
| 3300004240|Ga0007787_10086802 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
| 3300004282|Ga0066599_100291545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300004481|Ga0069718_14959362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 881 | Open in IMG/M |
| 3300005581|Ga0049081_10054884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1506 | Open in IMG/M |
| 3300005581|Ga0049081_10067130 | All Organisms → Viruses → Predicted Viral | 1350 | Open in IMG/M |
| 3300005581|Ga0049081_10198559 | Not Available | 720 | Open in IMG/M |
| 3300005582|Ga0049080_10000277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16939 | Open in IMG/M |
| 3300005584|Ga0049082_10092749 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
| 3300005584|Ga0049082_10119228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 922 | Open in IMG/M |
| 3300005584|Ga0049082_10190611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300005805|Ga0079957_1038571 | All Organisms → Viruses → Predicted Viral | 3060 | Open in IMG/M |
| 3300006803|Ga0075467_10557082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
| 3300006805|Ga0075464_10370411 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300006805|Ga0075464_11095649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300006920|Ga0070748_1100478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1103 | Open in IMG/M |
| 3300006920|Ga0070748_1282353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
| 3300007276|Ga0070747_1198923 | Not Available | 707 | Open in IMG/M |
| 3300007538|Ga0099851_1035212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1996 | Open in IMG/M |
| 3300007542|Ga0099846_1009330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3901 | Open in IMG/M |
| 3300007559|Ga0102828_1011755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1806 | Open in IMG/M |
| 3300008107|Ga0114340_1019923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8080 | Open in IMG/M |
| 3300008107|Ga0114340_1129660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
| 3300008107|Ga0114340_1222584 | Not Available | 605 | Open in IMG/M |
| 3300008110|Ga0114343_1099753 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300008448|Ga0114876_1008525 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6071 | Open in IMG/M |
| 3300008448|Ga0114876_1037761 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2293 | Open in IMG/M |
| 3300008448|Ga0114876_1101367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1146 | Open in IMG/M |
| 3300008448|Ga0114876_1119522 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300008448|Ga0114876_1127792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
| 3300008450|Ga0114880_1013389 | All Organisms → cellular organisms → Bacteria | 3976 | Open in IMG/M |
| 3300008450|Ga0114880_1098147 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300008450|Ga0114880_1120721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
| 3300009026|Ga0102829_1050340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
| 3300009081|Ga0105098_10230909 | Not Available | 866 | Open in IMG/M |
| 3300009082|Ga0105099_10042759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2367 | Open in IMG/M |
| 3300009146|Ga0105091_10610251 | Not Available | 564 | Open in IMG/M |
| 3300009159|Ga0114978_10598499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 637 | Open in IMG/M |
| 3300009164|Ga0114975_10023963 | Not Available | 3685 | Open in IMG/M |
| 3300009165|Ga0105102_10266292 | Not Available | 877 | Open in IMG/M |
| 3300009165|Ga0105102_10743556 | Not Available | 554 | Open in IMG/M |
| 3300009168|Ga0105104_10067699 | All Organisms → Viruses → Predicted Viral | 1931 | Open in IMG/M |
| 3300009169|Ga0105097_10561808 | Not Available | 641 | Open in IMG/M |
| 3300009169|Ga0105097_10779506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300009170|Ga0105096_10321264 | Not Available | 791 | Open in IMG/M |
| 3300010885|Ga0133913_10205837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5243 | Open in IMG/M |
| 3300010885|Ga0133913_12463637 | All Organisms → Viruses → Predicted Viral | 1270 | Open in IMG/M |
| 3300011338|Ga0153699_1219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 24415 | Open in IMG/M |
| 3300013006|Ga0164294_10068076 | All Organisms → Viruses → Predicted Viral | 2706 | Open in IMG/M |
| 3300013372|Ga0177922_10731815 | Not Available | 776 | Open in IMG/M |
| 3300013372|Ga0177922_11159562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 932 | Open in IMG/M |
| 3300017701|Ga0181364_1026258 | Not Available | 948 | Open in IMG/M |
| 3300017701|Ga0181364_1049880 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300017716|Ga0181350_1070599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
| 3300017722|Ga0181347_1123609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300017723|Ga0181362_1063414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
| 3300017736|Ga0181365_1080868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300017754|Ga0181344_1086666 | Not Available | 916 | Open in IMG/M |
| 3300017761|Ga0181356_1108271 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300017774|Ga0181358_1271293 | Not Available | 526 | Open in IMG/M |
| 3300017777|Ga0181357_1155808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 839 | Open in IMG/M |
| 3300017778|Ga0181349_1204638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300017778|Ga0181349_1259149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300017778|Ga0181349_1293622 | Not Available | 529 | Open in IMG/M |
| 3300017778|Ga0181349_1303069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300017780|Ga0181346_1198203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
| 3300017780|Ga0181346_1329305 | Not Available | 511 | Open in IMG/M |
| 3300017784|Ga0181348_1307436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300017785|Ga0181355_1061460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1586 | Open in IMG/M |
| 3300019784|Ga0181359_1003300 | All Organisms → Viruses → Predicted Viral | 4916 | Open in IMG/M |
| 3300019784|Ga0181359_1053078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1561 | Open in IMG/M |
| 3300019784|Ga0181359_1082515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1203 | Open in IMG/M |
| 3300019784|Ga0181359_1094214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1106 | Open in IMG/M |
| 3300019784|Ga0181359_1140027 | Not Available | 843 | Open in IMG/M |
| 3300020549|Ga0207942_1010081 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300021961|Ga0222714_10450211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300022063|Ga0212029_1010494 | Not Available | 1134 | Open in IMG/M |
| 3300022179|Ga0181353_1009515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2417 | Open in IMG/M |
| 3300022190|Ga0181354_1040977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1535 | Open in IMG/M |
| 3300022190|Ga0181354_1053888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1338 | Open in IMG/M |
| 3300022190|Ga0181354_1182074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300022190|Ga0181354_1183880 | Not Available | 633 | Open in IMG/M |
| 3300022200|Ga0196901_1011252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3769 | Open in IMG/M |
| 3300022407|Ga0181351_1209035 | Not Available | 644 | Open in IMG/M |
| 3300024346|Ga0244775_10615817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300025652|Ga0208134_1096714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kunmingvirus → Kunmingvirus kv4D05 | 824 | Open in IMG/M |
| 3300025896|Ga0208916_10451981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
| 3300027586|Ga0208966_1054121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
| 3300027608|Ga0208974_1003822 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5354 | Open in IMG/M |
| 3300027608|Ga0208974_1007033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3792 | Open in IMG/M |
| 3300027659|Ga0208975_1210329 | Not Available | 516 | Open in IMG/M |
| 3300027764|Ga0209134_10079410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1111 | Open in IMG/M |
| 3300027785|Ga0209246_10190881 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300027792|Ga0209287_10037715 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1762 | Open in IMG/M |
| 3300027798|Ga0209353_10342646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 625 | Open in IMG/M |
| 3300027969|Ga0209191_1151766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 945 | Open in IMG/M |
| 3300028025|Ga0247723_1000475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 27691 | Open in IMG/M |
| 3300031746|Ga0315293_10261034 | All Organisms → Viruses → Predicted Viral | 1403 | Open in IMG/M |
| 3300031857|Ga0315909_10574697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300031952|Ga0315294_10751356 | Not Available | 848 | Open in IMG/M |
| 3300031999|Ga0315274_11296803 | Not Available | 711 | Open in IMG/M |
| 3300031999|Ga0315274_11783121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300032053|Ga0315284_12155378 | Not Available | 558 | Open in IMG/M |
| 3300032093|Ga0315902_11145098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 566 | Open in IMG/M |
| 3300032156|Ga0315295_10276736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1699 | Open in IMG/M |
| 3300032401|Ga0315275_11660049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 682 | Open in IMG/M |
| 3300032516|Ga0315273_11992497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300032516|Ga0315273_12021734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
| 3300033233|Ga0334722_10098770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2220 | Open in IMG/M |
| 3300033993|Ga0334994_0044150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2815 | Open in IMG/M |
| 3300033993|Ga0334994_0125508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1475 | Open in IMG/M |
| 3300033993|Ga0334994_0185477 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300033995|Ga0335003_0333555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
| 3300034062|Ga0334995_0357338 | Not Available | 932 | Open in IMG/M |
| 3300034093|Ga0335012_0490751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300034101|Ga0335027_0338044 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1001 | Open in IMG/M |
| 3300034102|Ga0335029_0046334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3207 | Open in IMG/M |
| 3300034102|Ga0335029_0285055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
| 3300034106|Ga0335036_0249496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodomicrobium | 1203 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 29.27% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.76% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 8.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.13% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.13% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.06% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.44% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.63% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.63% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.81% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.81% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.81% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.81% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011338 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Haengju | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29581_1037713 | 3300002274 | Freshwater | MITMTPTQRVQALRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK* |
| B570J40625_1013785573 | 3300002835 | Freshwater | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQ |
| JGI25908J49247_100981983 | 3300003277 | Freshwater Lake | MTPTQRVQLLRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK* |
| JGI25909J50240_10561753 | 3300003393 | Freshwater Lake | MTTTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALVSKLTKEQHAAH* |
| Ga0007787_1000251814 | 3300004240 | Freshwater Lake | MITMTPTQRVQLLRQRRKALGLTRVEFYLSLEHAAKVRGYVSKLTKEKTK* |
| Ga0007787_100868021 | 3300004240 | Freshwater Lake | QRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALISKLTKQMQ* |
| Ga0066599_1002915453 | 3300004282 | Freshwater | MTTTNTQRVAALRQRRKAAGLVRVEYYLTPELAKKVRELINQLKAQQ* |
| Ga0069718_149593622 | 3300004481 | Sediment | MTPTQRVQALRERRKALGLTRVEFYLTPEHATKVRAYISKLTKEKAK* |
| Ga0049081_100548845 | 3300005581 | Freshwater Lentic | MTTTPTQRVAALRQRRKNAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAH* |
| Ga0049081_100671302 | 3300005581 | Freshwater Lentic | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAH* |
| Ga0049081_101985593 | 3300005581 | Freshwater Lentic | MTATTTERVAALRQRRKALGLVRVEFYLTPEHAAKVRGYVSKLTKEKSK* |
| Ga0049080_1000027732 | 3300005582 | Freshwater Lentic | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAHHP* |
| Ga0049082_100927493 | 3300005584 | Freshwater Lentic | MTATTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVRALISKLTKEQHAAH* |
| Ga0049082_101192284 | 3300005584 | Freshwater Lentic | MTATTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAH* |
| Ga0049082_101906113 | 3300005584 | Freshwater Lentic | VTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAH* |
| Ga0079957_10385719 | 3300005805 | Lake | MTNTPTQRVQALRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK* |
| Ga0075467_105570821 | 3300006803 | Aqueous | MTATPTQRVQALRQRRKALGLIRVEFYLTPSHAAQVKELIYKLTKETK* |
| Ga0075464_103704113 | 3300006805 | Aqueous | MTASPTQRVQALRQRRKALGLIRVEFYLTPSHAAQVKELIYKLTKEKK* |
| Ga0075464_110956492 | 3300006805 | Aqueous | MTTTPTQRVAALRQRRKDAGLVRVEYYLTKLQAEKVKALITKLTKEQHAAH* |
| Ga0070748_11004783 | 3300006920 | Aqueous | MTPYQRVQALRQRRKTLGLIRVEFYLTPDHAAQVKELIYKLTKEQNAAH* |
| Ga0070748_12823532 | 3300006920 | Aqueous | MTTTPTQRVAALRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKSK* |
| Ga0070747_11989232 | 3300007276 | Aqueous | MTTTPTQRVAALRQRRKDAGLVRVEYYRTKPQAEKVKALISKRTKEQHAAH* |
| Ga0099851_10352124 | 3300007538 | Aqueous | MTTTNTQRVAALRQRRKAAGLVRVEYYLTPELAKKVKEFINQLKAQQ* |
| Ga0099846_10093309 | 3300007542 | Aqueous | MTTTNTQRVAALRQRRKAAGLVRVEYYLTPDVAKKVKEFINQLKAQQ* |
| Ga0102828_10117554 | 3300007559 | Estuarine | MTTTPTQRVQALRQRRKALGLIRVEFYLTPSHAAQVKELIYKLTK |
| Ga0114340_10199234 | 3300008107 | Freshwater, Plankton | MTTNNTQRVAALRQRRKAAGLVRVEHYLTPAQAAKVKEFVNQLKAQK* |
| Ga0114340_11296602 | 3300008107 | Freshwater, Plankton | TTNNTQRVAALRQRRKAAGLVRVEHYLTPAQAAKVKEFINQLKAQK* |
| Ga0114340_12225844 | 3300008107 | Freshwater, Plankton | MTTNNTQRVAALRQRRKAAGLVRVEHYLTPAQAAKVKE |
| Ga0114343_10997532 | 3300008110 | Freshwater, Plankton | VTTTNTQRVAALRQRRKAAGLVRVEYYLTPELAKKVRELINQLKAQQ* |
| Ga0114876_10085254 | 3300008448 | Freshwater Lake | MTTTNTQRVAALRQRRKAAGLVRVEYYLTPELAKKVRELINQLKTKQ* |
| Ga0114876_10377611 | 3300008448 | Freshwater Lake | MTTNNTQRVQALRQRRKAAGLVRVEHYLTPAQAAKVKEFINQLKAQK* |
| Ga0114876_11013671 | 3300008448 | Freshwater Lake | MTTNNTQRVAALRQRRKAAGLVRVEHYLTPAQAAKVKEFINQLKAQ |
| Ga0114876_11195222 | 3300008448 | Freshwater Lake | VAALRQRRKAAGLVRVEHYLTPAQAAKVKEFINQLKAQK* |
| Ga0114876_11277921 | 3300008448 | Freshwater Lake | TTNNTQRVAALRQRRKAAGLVRVEHYLTPAQAAKVKEFINQLKAQQ* |
| Ga0114880_10133892 | 3300008450 | Freshwater Lake | MTTNNTQRVAALRQRRKAAGLVRVEHYLTPAQAAKVKEFINQLKAQK* |
| Ga0114880_10981472 | 3300008450 | Freshwater Lake | MTTNNTQRVAALRQRRKAAGLVRVEHYLTPAQAAKVKEFINQLKAQQ* |
| Ga0114880_11207211 | 3300008450 | Freshwater Lake | MTTTNTQRVAALRQRRKAAGLVRVEYYLTPELAKKVKEFINQLKTKQ* |
| Ga0102829_10503404 | 3300009026 | Estuarine | MTTTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVRALISKLTKEQHAAH* |
| Ga0105098_102309094 | 3300009081 | Freshwater Sediment | MTPTQRVQALRQRRKALGLIRVEFYLSLEHATKVRAYVSKLTK |
| Ga0105099_100427592 | 3300009082 | Freshwater Sediment | MTPTPTQRVQALRQRRKALGLIRVEFYLTPSHAAQVKELIYKLTKEVK* |
| Ga0105091_106102511 | 3300009146 | Freshwater Sediment | NASMTPTQRAQALRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK* |
| Ga0114978_105984991 | 3300009159 | Freshwater Lake | PTQRVQALRQRRKDAGLMRFEFYLLPSHAVAVKKFIIKLTKEKNEPT* |
| Ga0114975_100239639 | 3300009164 | Freshwater Lake | MTPTQRVQALRERRKALGLTRVEFYLTPAHAAKVKELIYKLTKEKK* |
| Ga0105102_102662921 | 3300009165 | Freshwater Sediment | MTPTQRVQALRQRRKALGLIRVEFYLTPSHAAQVKELIYKLTKEKK* |
| Ga0105102_107435561 | 3300009165 | Freshwater Sediment | LRQRRKAAGLVRVEHYLTPAQAAKVKEFINQLKAQQ* |
| Ga0105104_100676997 | 3300009168 | Freshwater Sediment | MTPTQRVQALRQRRKALGLIRVEFYLSLEHATKVRAYVSKLTKEKTK* |
| Ga0105097_105618082 | 3300009169 | Freshwater Sediment | MTPTQRVQALRQRRKALGLTRVEFYLTQEHATKVRGYVSKLTKEKAK* |
| Ga0105097_107795062 | 3300009169 | Freshwater Sediment | MTPTQRVQALRQRRKALGLIRVEFYLTPSHAAQVKELIYKLTKEKQ* |
| Ga0105096_103212642 | 3300009170 | Freshwater Sediment | MTTTERVAALRQRRKALGLVRVEFYLTQEHAAKVRVYVSKLTKEKSK* |
| Ga0133913_102058373 | 3300010885 | Freshwater Lake | MTTTPTQRVQALRQRRKDAGLMRFEFYLLPSHAVAVKKFIIKLTKEKNEPT* |
| Ga0133913_124636375 | 3300010885 | Freshwater Lake | MTTTERVAALRQRRKALGLVRVEFYLTPEHAAKVRGYVSKLTKEKSK* |
| Ga0153699_121914 | 3300011338 | Freshwater | MTLTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALISKLTKEQHAAH* |
| Ga0164294_100680764 | 3300013006 | Freshwater | MTPTQRVAALRQRRKALGLTRVEFYLTPEHAAKVRGYVSKLTKEKTK* |
| Ga0177922_107318153 | 3300013372 | Freshwater | MTPTQRVQALRQRRKDAGLMRFEFYLLPSHAVAVKKFISKLTKEKNEPT* |
| Ga0177922_111595621 | 3300013372 | Freshwater | MTATTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEK |
| Ga0181364_10262581 | 3300017701 | Freshwater Lake | TQRVQLLRQRRKALGLTRVEFYLSLEHAAKVRGYVSKLTKEKTK |
| Ga0181364_10498803 | 3300017701 | Freshwater Lake | MTPTQRVQLLRQRRKALGLTRVEFYLSLEHAAKVRGYVSKLTK |
| Ga0181350_10705991 | 3300017716 | Freshwater Lake | TTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALVSKLTKEQHAAH |
| Ga0181347_11236092 | 3300017722 | Freshwater Lake | MTTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAH |
| Ga0181362_10634143 | 3300017723 | Freshwater Lake | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALVSKLTKEQHAAH |
| Ga0181365_10808681 | 3300017736 | Freshwater Lake | QRVQLLRQRRKALGLTRVEFYLSLEHAAKVRGYVCKLTKEKTK |
| Ga0181344_10866662 | 3300017754 | Freshwater Lake | MTATTPTQRVQALRQRRKALGLIRVEFYLTQEHAAKVRGYVSKLTKEKTK |
| Ga0181356_11082711 | 3300017761 | Freshwater Lake | MTPTQRVQLLRQRRKALGLTRVEFYLSLEHAAKVRGYVSKLTKEKT |
| Ga0181358_12712932 | 3300017774 | Freshwater Lake | VTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAH |
| Ga0181357_11558083 | 3300017777 | Freshwater Lake | MTTTTAQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALISKLTKEQHAAH |
| Ga0181349_12046382 | 3300017778 | Freshwater Lake | VTTTTAQRVQALRQRRKDAGLVRVEYYLTKSQAEKVKALITKLTKEQHAAH |
| Ga0181349_12591491 | 3300017778 | Freshwater Lake | MTTTTAQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITK |
| Ga0181349_12936221 | 3300017778 | Freshwater Lake | MTTTPTQRVQALRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK |
| Ga0181349_13030692 | 3300017778 | Freshwater Lake | PINMTTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAH |
| Ga0181346_11982033 | 3300017780 | Freshwater Lake | MTPTQRVQLLRQRRKALGLTRVEFYLSLEHAAKVRGYVSK |
| Ga0181346_13293052 | 3300017780 | Freshwater Lake | MTTTPTQRVAALRQRRKDAGLVRVEFYLTPSHAAKVKALINKLTKEQHAAH |
| Ga0181348_13074361 | 3300017784 | Freshwater Lake | NTQRVAALRQRRKAAGLVRVEHYLTPAQAAKVKEFINQLKAQK |
| Ga0181355_10614605 | 3300017785 | Freshwater Lake | MTATTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALI |
| Ga0181359_10033009 | 3300019784 | Freshwater Lake | MTPTQRVQLLRQRRKALGLTRVEFYLSLEHAAKVRGYVSKLTKEKTR |
| Ga0181359_10530781 | 3300019784 | Freshwater Lake | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPHAEKVKALITKLT |
| Ga0181359_10825153 | 3300019784 | Freshwater Lake | MTTTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALVSKLTKEQHAAH |
| Ga0181359_10942146 | 3300019784 | Freshwater Lake | LRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK |
| Ga0181359_11400273 | 3300019784 | Freshwater Lake | MTTTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAH |
| Ga0207942_10100813 | 3300020549 | Freshwater | MITMTPTQRVQALRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK |
| Ga0222714_104502112 | 3300021961 | Estuarine Water | MTTTNTQRVAALRQRRKAAGLVRVEYYLTPDAAKKVKEFINQLKAQA |
| Ga0212029_10104944 | 3300022063 | Aqueous | MTTTNTQRVAALRQRRKAAGLVRVEYYLTPELAKKVKEFINQLKAQQ |
| Ga0181353_10095153 | 3300022179 | Freshwater Lake | MTTTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALISKLTKEQPK |
| Ga0181354_10409774 | 3300022190 | Freshwater Lake | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPHAEKVKALITKLTKDKP |
| Ga0181354_10538882 | 3300022190 | Freshwater Lake | MTPTQRVQLLRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK |
| Ga0181354_11820741 | 3300022190 | Freshwater Lake | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALI |
| Ga0181354_11838804 | 3300022190 | Freshwater Lake | RVQLLRQRRKALGLTRVEFYLSLEHAAKVRGYVSKLTKEKTK |
| Ga0196901_10112527 | 3300022200 | Aqueous | MTTTNTQRVAALRQRRKAAGLVRVEYYLTPDVAKKVKEFINQLKAQQ |
| Ga0181351_12090353 | 3300022407 | Freshwater Lake | MTPTQRVQALRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK |
| Ga0244775_106158171 | 3300024346 | Estuarine | MTTTPTQRVQALRQRRKALGLIRVEFYLTPSHAAQVKELISKL |
| Ga0208134_10967143 | 3300025652 | Aqueous | MTPYQRVQALRQRRKTLGLIRVEFYLTPDHAAQVKELIYKLTKEQNAAH |
| Ga0208916_104519812 | 3300025896 | Aqueous | MTASPTQRVQALRQRRKALDLIRVEFYLTPSHAAQVKELIYKLTKEKK |
| Ga0208966_10541212 | 3300027586 | Freshwater Lentic | MTATTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVRALISKLTKEQHAAH |
| Ga0208974_10038229 | 3300027608 | Freshwater Lentic | MTTTPTQRVAALRQRRKNAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAH |
| Ga0208974_10070333 | 3300027608 | Freshwater Lentic | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAAHHP |
| Ga0208975_12103292 | 3300027659 | Freshwater Lentic | MTATTTERVAALRQRRKALGLVRVEFYLTPEHAAKVRGYVSKLTKEKSK |
| Ga0209134_100794102 | 3300027764 | Freshwater Lake | LTKRGYGPITMTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAA |
| Ga0209246_101908812 | 3300027785 | Freshwater Lake | MTQSTQRVTALRERRKALGLVRVEFYLTPEHAARARAYIKKLLKEKQ |
| Ga0209287_100377154 | 3300027792 | Freshwater Sediment | MTPTPTQRVQALRQRRKALGLIRVEFYLTPSHAAQVKELIYKLTKEVK |
| Ga0209353_103426461 | 3300027798 | Freshwater Lake | ASCRLINLVTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALVSKLTKEQHAAH |
| Ga0209191_11517662 | 3300027969 | Freshwater Lake | MTPTQRVQALRERRKALGLTRVEFYLTPAHAAKVKELIYKLTKEKK |
| Ga0247723_100047542 | 3300028025 | Deep Subsurface Sediment | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALISKLTKEQHAAH |
| Ga0315293_102610343 | 3300031746 | Sediment | MTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAT |
| Ga0315909_105746971 | 3300031857 | Freshwater | MTTTNTQRVAALRQRRKAAGLVRVEYYLTPELAKKVRELINQLKTKQ |
| Ga0315294_107513562 | 3300031952 | Sediment | MTTTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQPK |
| Ga0315274_112968032 | 3300031999 | Sediment | MTTTPTQRVAALRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLTKEKTK |
| Ga0315274_117831212 | 3300031999 | Sediment | MTTTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAT |
| Ga0315284_121553783 | 3300032053 | Sediment | MTATTPTQRVAALRQRRKALGLTRVEFYLSLEHAAKVRGYVSKLTKEKT |
| Ga0315902_111450982 | 3300032093 | Freshwater | VTTTNTQRVAALRQRRKAAGLVRVEYYLTPELAKKVRELINQLKAQQ |
| Ga0315295_102767368 | 3300032156 | Sediment | QRRKALGLTRVEFYLSLEHAAKVRGYVSKLTKEKTK |
| Ga0315275_116600492 | 3300032401 | Sediment | ATPCWARLLMTTTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAT |
| Ga0315273_119924971 | 3300032516 | Sediment | MTPTQRVQALRQRRKALGLTRVEFYLSLEHAAKVRGYVSKLTKE |
| Ga0315273_120217341 | 3300032516 | Sediment | RQSMTTTPTQRVAALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQHAT |
| Ga0334722_100987709 | 3300033233 | Sediment | MTTTPTQRVQALRQRRKALGLTRVEFYLSLEHAAKVRGYVSKLTKEKTK |
| Ga0334994_0044150_1515_1664 | 3300033993 | Freshwater | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQPK |
| Ga0334994_0125508_1253_1402 | 3300033993 | Freshwater | MTTTTAQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQTK |
| Ga0334994_0185477_600_749 | 3300033993 | Freshwater | MTPTQRVQALRQRRKDAGLVRVEYYLTKSQAEKVKALITKLTKEQHAAH |
| Ga0335003_0333555_534_668 | 3300033995 | Freshwater | TERVAALRQRRKALGLVRVEFYLTPEHAAKVRGYVSKLTKEKTK |
| Ga0334995_0357338_303_455 | 3300034062 | Freshwater | MTATTPTQRVQALRQRRKALGLTRVEFYLTQEHAAKVRGYVSKLIKEKTK |
| Ga0335012_0490751_50_193 | 3300034093 | Freshwater | MTTTERVAALRQRRKALGLVRVEFYLTPEHAAKVRGYVSKLTKEKTK |
| Ga0335027_0338044_96_245 | 3300034101 | Freshwater | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEQTK |
| Ga0335029_0046334_552_692 | 3300034102 | Freshwater | MTPTQRVQALRQRRKALGLIRVEFYLTASHAAKVKELIYKLTKEKQ |
| Ga0335029_0285055_237_386 | 3300034102 | Freshwater | MTTTPTQRVAALRQRRKALGLTRVEFYLTQEHAAKVRKYVSKLTKEKTK |
| Ga0335036_0249496_480_626 | 3300034106 | Freshwater | MTTTPTQRVQALRQRRKDAGLVRVEYYLTKPQAEKVKALITKLTKEKQ |
| ⦗Top⦘ |