| Basic Information | |
|---|---|
| Family ID | F069831 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MIDPITAFATAQAAIKGVQAAIKMGKDIHAIGGEMMKFFEAKD |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 80.77 % |
| % of genes near scaffold ends (potentially truncated) | 20.33 % |
| % of genes from short scaffolds (< 2000 bps) | 17.89 % |
| Associated GOLD sequencing projects | 76 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.488 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (27.642 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.732 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (72.358 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.93% β-sheet: 0.00% Coil/Unstructured: 45.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF16080 | Phage_holin_2_3 | 5.69 |
| PF13884 | Peptidase_S74 | 4.07 |
| PF16778 | Phage_tail_APC | 3.25 |
| PF13392 | HNH_3 | 3.25 |
| PF13759 | 2OG-FeII_Oxy_5 | 2.44 |
| PF07460 | NUMOD3 | 1.63 |
| PF08291 | Peptidase_M15_3 | 0.81 |
| PF00959 | Phage_lysozyme | 0.81 |
| PF13550 | Phage-tail_3 | 0.81 |
| PF02945 | Endonuclease_7 | 0.81 |
| PF09636 | XkdW | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.49 % |
| All Organisms | root | All Organisms | 19.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100269324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1756 | Open in IMG/M |
| 3300004771|Ga0007797_1193453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300004776|Ga0007800_10018872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1682 | Open in IMG/M |
| 3300007559|Ga0102828_1080456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 781 | Open in IMG/M |
| 3300007606|Ga0102923_1236418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300008266|Ga0114363_1003072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15627 | Open in IMG/M |
| 3300008266|Ga0114363_1028753 | All Organisms → Viruses → Predicted Viral | 2871 | Open in IMG/M |
| 3300009163|Ga0114970_10783382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300013005|Ga0164292_10607031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300015050|Ga0181338_1041586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300017774|Ga0181358_1015805 | All Organisms → Viruses → Predicted Viral | 3059 | Open in IMG/M |
| 3300017780|Ga0181346_1238690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300017785|Ga0181355_1214719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 750 | Open in IMG/M |
| 3300027756|Ga0209444_10067476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1554 | Open in IMG/M |
| 3300027756|Ga0209444_10082358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1359 | Open in IMG/M |
| 3300027772|Ga0209768_10224742 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300027808|Ga0209354_10190444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 833 | Open in IMG/M |
| 3300031758|Ga0315907_10330077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1246 | Open in IMG/M |
| 3300031758|Ga0315907_10726745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
| 3300031772|Ga0315288_10904793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
| 3300031951|Ga0315904_10422901 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1200 | Open in IMG/M |
| 3300031999|Ga0315274_11426889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300032173|Ga0315268_11151856 | Not Available | 784 | Open in IMG/M |
| 3300032177|Ga0315276_11543404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300034062|Ga0334995_0049046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3465 | Open in IMG/M |
| 3300034168|Ga0335061_0534302 | Not Available | 595 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 27.64% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 26.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.13% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.32% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 5.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.69% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.06% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.63% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.63% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.63% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.63% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.81% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.81% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.81% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.81% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004771 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2.5M | Environmental | Open in IMG/M |
| 3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
| 3300004776 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14M | Environmental | Open in IMG/M |
| 3300004805 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300016776 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020556 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025616 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA6M (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1002693245 | 3300002835 | Freshwater | MLDPITAFATAQAAVAGIQKAIKLGKDINGLVGEFGKFFDAKDVVQKAANDNGKKGQ |
| JGI25908J49247_100035227 | 3300003277 | Freshwater Lake | MIDPITAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKDKVAKE |
| Ga0066177_105354952 | 3300004096 | Freshwater Lake | MDPLTAFAVAQGAIKGIQAAIKMGKDIQGITGDVMKFFDAKDKVA |
| Ga0066222_11096321 | 3300004460 | Marine | MIDPVTAFATAQAAIKGVQAAIKMGKDIHAISADVMKFFDAK |
| Ga0007797_11934531 | 3300004771 | Freshwater | VIDPVTAFATAQAAIKGVQAAIKMGKDIHAISGEMMRFFEAKDIVQREASK |
| Ga0007794_100507184 | 3300004774 | Freshwater | MLDPITAFATAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQKAAS |
| Ga0007794_100775015 | 3300004774 | Freshwater | MDPITAFAAAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQRAASK |
| Ga0007800_100188721 | 3300004776 | Freshwater | MLDPITAFATAQAAIKGVQAAIKMGKDIHAIGGEMMKFFEAKDVVQKAASKPK |
| Ga0007792_102106252 | 3300004805 | Freshwater | VIDPITAFATAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQKAAS |
| Ga0075464_101266531 | 3300006805 | Aqueous | MIDPVTAFATAQAAIKGVQAAIKMGKDIHAVGAEAMKFFEAKD |
| Ga0102828_10804561 | 3300007559 | Estuarine | MIDPITTAFATAQAAIKGVQAAIKMGKDIHAIGGEMMKFFEAKDIV |
| Ga0102923_12364183 | 3300007606 | Estuarine | MIDPITAFATAQAAIKGVQAAIKMGKDIHAIGGEMMKFFEAKDIV |
| Ga0114355_10724586 | 3300008120 | Freshwater, Plankton | MDPITAFAAAQAAVAGIQKAIKLGKDNNGLVGEFGKFFDAKDV |
| Ga0114363_100307215 | 3300008266 | Freshwater, Plankton | MDPLTAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKDKVAKEA |
| Ga0114363_10287534 | 3300008266 | Freshwater, Plankton | MDPITAFAAAQAAVAGIQKAIKLGKDINGLVGQVF* |
| Ga0114364_10662534 | 3300008267 | Freshwater, Plankton | MIDPITAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAK |
| Ga0114364_11104501 | 3300008267 | Freshwater, Plankton | MDPLTAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAK |
| Ga0114876_11011861 | 3300008448 | Freshwater Lake | MDPITAFAAAQAAVLGIQKAIKLGKDINGLVGEFGKFFDAR |
| Ga0114880_10309925 | 3300008450 | Freshwater Lake | MDPITAFAAAQAAVAGIQKAIKLGKDINGLVGEFGKFFDAKDVVQKAANDK |
| Ga0114962_101450281 | 3300009151 | Freshwater Lake | MIDPITAFATAQAAIKGVQAAIKMGKDIHAIGGEMMKFFEA |
| Ga0114962_101688061 | 3300009151 | Freshwater Lake | MIDPFTAFATAQAAIKGVQAAIKMGKDIGAISGDL |
| Ga0114962_102360822 | 3300009151 | Freshwater Lake | MIDPVTAFATAQAAIKGVHVAIKMGKDIHAIGGEMTKFFEAKDIVQREASK |
| Ga0114962_102548571 | 3300009151 | Freshwater Lake | MLDPITAFATAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKD |
| Ga0114963_100275644 | 3300009154 | Freshwater Lake | MIDPITAFATAQAAIKGVKAAIALGKDIQAVSGDLMK* |
| Ga0114963_100371935 | 3300009154 | Freshwater Lake | MIDPITAFATAQAAIKGVQAAIKMGKDIGAISGDLMKFFE |
| Ga0114963_100696684 | 3300009154 | Freshwater Lake | MIDPITAFATAQAAIKGVQAAIKMGKDIHAIGGEMMKFFEAKD |
| Ga0114968_100239591 | 3300009155 | Freshwater Lake | MDPITAFAAAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQ |
| Ga0114970_101694401 | 3300009163 | Freshwater Lake | MIDPITAFATAQAAIKGVQAAIKMGKDIHAIGGEMMKFFEAKDIVQREA |
| Ga0114970_107833823 | 3300009163 | Freshwater Lake | MIDPLTAFAVAQGAIKGVQAAIKMGKDINAISGDLMKFFEAKDVVAKAAVKKKP |
| Ga0114975_100233836 | 3300009164 | Freshwater Lake | MLDPVTAFATAQAAIKGVQAAIKMGKDIHAIGGEMMKFFEAKDVV |
| Ga0114979_103269383 | 3300009180 | Freshwater Lake | MIDPVTAFATAQAAIKGVQAAIKMGKDIHAIGGEMMRFFEAKDVVQKAASQP |
| Ga0114969_100882865 | 3300009181 | Freshwater Lake | MIDPLTAFAVAQGAIKGVQAAIKMGKDINAISGDLMKFFEAKDVVAKEAVK |
| Ga0114969_103005391 | 3300009181 | Freshwater Lake | MVDPVTAFMAAQAALKGIKAAIAMGKDIQGIAGDM |
| Ga0114971_103364802 | 3300009185 | Freshwater Lake | MIDPVTAFATAQAAIKAVQVAIKMGKDIHAIGGEM |
| Ga0114960_100925571 | 3300010158 | Freshwater Lake | MIDPITAFATAQAAIKGVKAAIALGKDIQAVSGDLMKFF |
| Ga0114967_101212225 | 3300010160 | Freshwater Lake | VEEGLIDPVTAFATAQAAIKGVKAAIALGKDIQAVSGDLMNFFEAKDVV |
| Ga0114967_102827341 | 3300010160 | Freshwater Lake | MIDPLTAFAVAQGAIKGVQAAIKMGKDINAISGDLMKF |
| Ga0114967_104493231 | 3300010160 | Freshwater Lake | MIDPLTAFAVAQGAIKGVQAAIKMGKDINSISGDLMKF |
| Ga0136644_100593771 | 3300010334 | Freshwater Lake | MIDPITAFATAQAAIKGVQAAIKMGKDIGAISGDLMK |
| Ga0136644_102486434 | 3300010334 | Freshwater Lake | VIDPITAFATAQAAIKGVQAAIKMGKDIHAISGEMMRF |
| Ga0133913_102286727 | 3300010885 | Freshwater Lake | MIDPITAFATAQAAIKGVQAAIKMGKDIHAMSGDLMKFFEAKDVVA |
| Ga0133913_104812354 | 3300010885 | Freshwater Lake | MDPFTAFATAQAAIKGIQAAIKMGKDIGAISGDLM |
| Ga0133913_119944761 | 3300010885 | Freshwater Lake | VIDPVTAFMAAQAALKGIKAAIAMGKDIQGIAGDMVK |
| Ga0153801_10909593 | 3300012017 | Freshwater | MIDPITAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFD |
| Ga0164292_106070311 | 3300013005 | Freshwater | MIDPITAFAAARAAVSGIQAAIKLGKDLQGITGDVMKFFDAK |
| Ga0170791_145708813 | 3300013295 | Freshwater | MIDPITAFATAQAAIKGVKAAIALGKDIQAVSGDLMKFFD |
| Ga0181338_10415864 | 3300015050 | Freshwater Lake | MIDPITAFAAARAAVSGIQAAIKLGKDIQGITGDVMKFFDAK |
| Ga0182046_16497742 | 3300016776 | Salt Marsh | LIDPITAFATAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQKAASQP |
| Ga0181363_10083231 | 3300017707 | Freshwater Lake | MIDPITAFATAQAAVAGIQKAIKLGKDINGLVGEFGKF |
| Ga0181350_10695044 | 3300017716 | Freshwater Lake | MIDPLTAFAVAQGAIKGVQAAIKMGKDINAISGDLMKFF |
| Ga0181365_10243891 | 3300017736 | Freshwater Lake | MIDPLTAFAVAQGAIKGIQAAIKMGKDVQGITHDVM |
| Ga0181365_10572191 | 3300017736 | Freshwater Lake | MIDPVSAFIAAQAAVKGIQAAIKLGKDISGIASDLSKFFEAKDIV |
| Ga0181365_10627903 | 3300017736 | Freshwater Lake | MIDPISAFAIAQGAIKGIQAAIKMGKDVQGITGDVMKFFDAK |
| Ga0181344_10871042 | 3300017754 | Freshwater Lake | MIDPITAFATAQAAVAGIQKAIKLGKDINGLVGEFGKFFDAKDVVQK |
| Ga0181344_11564871 | 3300017754 | Freshwater Lake | MIDPISAFAIAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKD |
| Ga0181358_10146921 | 3300017774 | Freshwater Lake | MIDPITAFAVAQGAIKGIQAAIKMGKDINGISGDLMF |
| Ga0181358_10158058 | 3300017774 | Freshwater Lake | MIDPISAFAIAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKDKV |
| Ga0181358_10696436 | 3300017774 | Freshwater Lake | MIDPLTAFAVAQGAIKGVQAAMKMGKDINAISGDLMKFFEA |
| Ga0181358_12241771 | 3300017774 | Freshwater Lake | MIDPLTAFAVAQGAIKGVQAAIKMGKDINAISGDL |
| Ga0181357_11951911 | 3300017777 | Freshwater Lake | MTAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKEKVAKEAVK |
| Ga0181357_12048551 | 3300017777 | Freshwater Lake | VDPLTAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKDK |
| Ga0181349_11855323 | 3300017778 | Freshwater Lake | VIDPISAFAIAQGAIKGIQAAIKMGKDVQGLSPDRKS |
| Ga0181346_12386901 | 3300017780 | Freshwater Lake | MIDPLTAFAIAQGAIKGVQAAIKMGKDINAISGDL |
| Ga0181355_12147191 | 3300017785 | Freshwater Lake | MDPITAFAAAQAAVAGIQKAIKLGKDINGLVGEFGKFFDAKD |
| Ga0181355_12682671 | 3300017785 | Freshwater Lake | VIDPLTAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFF |
| Ga0208486_10342491 | 3300020556 | Freshwater | MIDPLTAFAVAQGAIKGIQAAIKMGKDINGISGDLM |
| Ga0194060_105838872 | 3300021602 | Anoxic Zone Freshwater | VIDPVTAFATAQAAIKGVQAAIKMGKDIHAISGEM |
| Ga0222714_105869372 | 3300021961 | Estuarine Water | MIDPITAFATAQAAVAGIQKALKLGKDITGCIKEFSALFESADVINK |
| Ga0222713_104319261 | 3300021962 | Estuarine Water | MIDPITAFAVAQGAIKGVQAAIKMGKDINAISGDL |
| Ga0181354_10029951 | 3300022190 | Freshwater Lake | MIDPITAFATAQAAVAGIQKALKLGKDITGCIKEFSQLFESADIVNKA |
| Ga0181354_10945165 | 3300022190 | Freshwater Lake | VIDPLTAFAIAQSAVKGIQAAIKLGKDVQGITGDVMKFFDAKEKVAKV |
| Ga0181354_11767884 | 3300022190 | Freshwater Lake | MIDPITAFAAARAAVSGIQAAIKLGKDIQGITGDVMKFFDAKDVV |
| Ga0181354_12374224 | 3300022190 | Freshwater Lake | MIDPLTAFAVAQGAIKGVQAAIKMGKDINAISGDLI |
| Ga0214919_100731661 | 3300023184 | Freshwater | MIDPITAFATAQAAIKGVQAAIKMGKDIHAIGAEAMKFFEAKDVVQRAAS |
| Ga0244775_105063863 | 3300024346 | Estuarine | MIDPITAFATAQAAIKGVQAAIKMGKDIGAISGDLMKFFEAKDVVS |
| Ga0208613_10136456 | 3300025616 | Freshwater | MLDPITAFATAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQKAASKPKGT |
| Ga0208644_11261441 | 3300025889 | Aqueous | MIDPITAFATAQAAIKGVQAAIKMGKDIHAIGGEMMKFFEAKDIVQR |
| Ga0208966_10754401 | 3300027586 | Freshwater Lentic | MIDPLTAFAVAQGAIKGVQAAIKMGKDINAISGDLMKFFDAKDVVAKEATK |
| Ga0208975_10290565 | 3300027659 | Freshwater Lentic | MIDPITAFAAARAAVSGIQAAIKLGKDLQGITGDVMKFF |
| Ga0209442_11763581 | 3300027732 | Freshwater Lake | VIDPITAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKEKV |
| Ga0209442_12918131 | 3300027732 | Freshwater Lake | VDPLTAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKEKVAKE |
| Ga0209297_12250431 | 3300027733 | Freshwater Lake | VIDPITAFATAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQRA |
| Ga0209087_100409713 | 3300027734 | Freshwater Lake | VIDPITAFATAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQRAA |
| Ga0209087_10609144 | 3300027734 | Freshwater Lake | VIDPITAFATAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKD |
| Ga0209085_11528481 | 3300027741 | Freshwater Lake | MIDPITAFATAQAAIKGVKAAIALGKDIQAVSGDLMK |
| Ga0209084_13076902 | 3300027749 | Freshwater Lake | MIDPITAFATAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQ |
| Ga0209444_100674764 | 3300027756 | Freshwater Lake | MIDPISAFAIAQGAIKGIQAAIKMGKDVQGITNDVM |
| Ga0209444_100823581 | 3300027756 | Freshwater Lake | MIDPITAFAVAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKDKVAKEAVK |
| Ga0209088_101363823 | 3300027763 | Freshwater Lake | MIDPVTAFATAQAAIKGVQAAIKMGKDIHAIGGEMMK |
| Ga0209088_102047103 | 3300027763 | Freshwater Lake | MIDPITAFATAQAAIKGIQAAIKMGKDIGAISGDLMKFFEAKDVV |
| Ga0209768_102247421 | 3300027772 | Freshwater Lake | VIDPITAFAVAQGAIKGIQAAIKMGKDIQGITGDVM |
| Ga0209353_101564285 | 3300027798 | Freshwater Lake | MIDPLTAFAAAQAAIKGVQAAIKMGKDIHAISGEMMK |
| Ga0209353_102203941 | 3300027798 | Freshwater Lake | VIDPITAFAVAQGAIKGIQAAIKMGKDIQGITGDVMK |
| Ga0209354_100046071 | 3300027808 | Freshwater Lake | MDPFTAFATAQAAIKGIQAAIKMGKDIGAISGDLMKFF |
| Ga0209354_101904441 | 3300027808 | Freshwater Lake | MDPITAFAAAQAAVAGIQKAIKLGKDINGLVGEFGKFFDAKDVVQKAAN |
| Ga0209354_104263051 | 3300027808 | Freshwater Lake | MIDPISAFAIAQGAIKGIQAAIKMGKDVQGITGDVM |
| Ga0209400_10290574 | 3300027963 | Freshwater Lake | MDPITAFAAAQAAVKGVQAAIKLGKDIHAITGEAMKFFEAKDVVQR |
| Ga0209191_13214172 | 3300027969 | Freshwater Lake | MIDPITAFATAQAAIKGIQAAIKMGKDIHAMSGDIMKLFDARNEVAV |
| Ga0315291_112875391 | 3300031707 | Sediment | MIDPLTAFAVAQGAIKGVQAAIKMGKDINAISGDLMKFFEAKDVVAKAAVKP |
| Ga0315907_103300771 | 3300031758 | Freshwater | MDPITAFATAQAAVAGIQKALKLGKDIQGLVGEFGRFFDAKDAVQKAAN |
| Ga0315907_107267454 | 3300031758 | Freshwater | MDPITAFAAAQAAVAGIQKAIKLGKDINGLVGEFGKFFD |
| Ga0315288_109047931 | 3300031772 | Sediment | MIDPLTAFAAAQAAIKGVQAAIKMGKDIHAISGEMMKFFEAKD |
| Ga0315904_103637324 | 3300031951 | Freshwater | MIDPITAFATAQAAVAGIQKAIKLGKDINGLVGEFGKFFD |
| Ga0315904_104229014 | 3300031951 | Freshwater | MDPITAFATAQAAVAGIQKAIKLGKDIQGLVGEFGKFFDAKDVVQKAANDSGKT |
| Ga0315278_110493254 | 3300031997 | Sediment | MIDPLTAFAVAQGAIKGVQAAIKMGKDINAISGDLM |
| Ga0315274_114268893 | 3300031999 | Sediment | MIDPLTAFAAAQAAIKGVQAAIKMGKDIHAISGEMMKFFEA |
| Ga0315289_109967091 | 3300032046 | Sediment | MIDPLTAFAAAQAAIKGVQAAIKMGKDIHAISGEMMKFF |
| Ga0315906_101630061 | 3300032050 | Freshwater | MIDPITAFATAQAAVAGIQKAIKLGKDINGLVGEFGK |
| Ga0315906_105876714 | 3300032050 | Freshwater | MIDPITAFATAQAAVAGIQKAIKLGKDVNGLVGEFSRFFDARDAVQKAANDAG |
| Ga0315906_112329951 | 3300032050 | Freshwater | MVDPITAFATAQAAVAGIQKAIKLGKDINGLIGDFGKFFDAKD |
| Ga0315903_102259731 | 3300032116 | Freshwater | MDPITAFATAQAAVAGIQKALKLGKDIQGLVGEFGRFFDAKDAVQKAAND |
| Ga0315903_102795695 | 3300032116 | Freshwater | VIDPITAFATAQAAVAGIQKAIKLGKDIQGLVGEFGRFFDAKDAVQKAANDAGKK |
| Ga0315903_108531521 | 3300032116 | Freshwater | MLDPVTIGTAFATAQAAVAGIQKAIKLGKDINGLVGEFGKFFDARDVVQKA |
| Ga0315268_111518561 | 3300032173 | Sediment | VIDPITAFMAAKAALKGIKAAIAMGKDVQGIAGDLVKFFDFKDVVVKA |
| Ga0315276_115434044 | 3300032177 | Sediment | MIDPLTAFAVAQGAIKGVQAAIKMGKDINSISGDLMKFFEAKDVVAKE |
| Ga0316616_1014760712 | 3300033521 | Soil | MIDPITAFATAQAAVAGIQKAIKLGKDINGLVGEFGKFFDARDVVQKAANDN |
| Ga0334987_0202534_2_118 | 3300034061 | Freshwater | MIDPISAFAIAQGAIKGIQAAIKMGKDVQGITNDVMKFF |
| Ga0334995_0049046_3313_3465 | 3300034062 | Freshwater | MIDPISAFAIAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKDKVAKEAVK |
| Ga0335012_0047211_2393_2497 | 3300034093 | Freshwater | MIDPLTAFAVAQGAIKGVQAAIKMGKDINGISGDL |
| Ga0335061_0534302_1_156 | 3300034168 | Freshwater | MIDPISAFAIAQGAIKGIQAAIKMGKDVQGITNDVMKFFDAKDKVAKEAVKD |
| Ga0335061_0658915_2_163 | 3300034168 | Freshwater | MIDPITAFAVAQGAIKGIQAAIKMGKDINGISGDLMKFFEAKDVIAKESVKKKP |
| Ga0335007_0674257_1_144 | 3300034283 | Freshwater | MIDPITAFATAQAAVAGIQKAIKLGKDINQLVGEFGKFFDARDVVQKA |
| Ga0335048_0070031_3_110 | 3300034356 | Freshwater | MIDPLTAFAVAQGAIKGVQAAIKMGKDINGISGDLM |
| ⦗Top⦘ |