| Basic Information | |
|---|---|
| Family ID | F069764 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 45 residues |
| Representative Sequence | TRTDPARNAMALLDSYTTLLPAALESSLQELKPLFDAWRGAPI |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.50 % |
| % of genes from short scaffolds (< 2000 bps) | 87.80 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.748 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (14.634 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.967 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF01656 | CbiA | 11.38 |
| PF00254 | FKBP_C | 4.07 |
| PF00216 | Bac_DNA_binding | 2.44 |
| PF01168 | Ala_racemase_N | 1.63 |
| PF11892 | DUF3412 | 1.63 |
| PF00072 | Response_reg | 0.81 |
| PF02325 | YGGT | 0.81 |
| PF14793 | DUF4478 | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF14748 | P5CR_dimer | 0.81 |
| PF12695 | Abhydrolase_5 | 0.81 |
| PF00528 | BPD_transp_1 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 2.44 |
| COG0762 | Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT family | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.75 % |
| Unclassified | root | N/A | 3.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003861|Ga0031654_10000116 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16295 | Open in IMG/M |
| 3300004013|Ga0055465_10336217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300004080|Ga0062385_10728688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 642 | Open in IMG/M |
| 3300004082|Ga0062384_101130277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 566 | Open in IMG/M |
| 3300004082|Ga0062384_101464719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 504 | Open in IMG/M |
| 3300005712|Ga0070764_10895232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 556 | Open in IMG/M |
| 3300005995|Ga0066790_10467768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 539 | Open in IMG/M |
| 3300006059|Ga0075017_100673193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 795 | Open in IMG/M |
| 3300006893|Ga0073928_10240459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1391 | Open in IMG/M |
| 3300007255|Ga0099791_10442663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 628 | Open in IMG/M |
| 3300009038|Ga0099829_11145518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 644 | Open in IMG/M |
| 3300009624|Ga0116105_1153568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 611 | Open in IMG/M |
| 3300009633|Ga0116129_1207946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 555 | Open in IMG/M |
| 3300009635|Ga0116117_1043890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1101 | Open in IMG/M |
| 3300009683|Ga0116224_10352539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 700 | Open in IMG/M |
| 3300009701|Ga0116228_10792822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 636 | Open in IMG/M |
| 3300009787|Ga0116226_11005995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 802 | Open in IMG/M |
| 3300009787|Ga0116226_11189296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 723 | Open in IMG/M |
| 3300010339|Ga0074046_10323751 | Not Available | 943 | Open in IMG/M |
| 3300010341|Ga0074045_10965971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 537 | Open in IMG/M |
| 3300010343|Ga0074044_10653602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 686 | Open in IMG/M |
| 3300010877|Ga0126356_10535890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 618 | Open in IMG/M |
| 3300010880|Ga0126350_10323011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 764 | Open in IMG/M |
| 3300011271|Ga0137393_11406134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 587 | Open in IMG/M |
| 3300012189|Ga0137388_10882796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 827 | Open in IMG/M |
| 3300012361|Ga0137360_11614226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 554 | Open in IMG/M |
| 3300012925|Ga0137419_11278512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 616 | Open in IMG/M |
| 3300012927|Ga0137416_10142910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1862 | Open in IMG/M |
| 3300012927|Ga0137416_10812052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 828 | Open in IMG/M |
| 3300012930|Ga0137407_11043082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 775 | Open in IMG/M |
| 3300014168|Ga0181534_10229296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 979 | Open in IMG/M |
| 3300014489|Ga0182018_10129787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1453 | Open in IMG/M |
| 3300014499|Ga0182012_10395761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 912 | Open in IMG/M |
| 3300014499|Ga0182012_10820851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 589 | Open in IMG/M |
| 3300014501|Ga0182024_10285397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2191 | Open in IMG/M |
| 3300014501|Ga0182024_11222990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 877 | Open in IMG/M |
| 3300014838|Ga0182030_10860025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 819 | Open in IMG/M |
| 3300015245|Ga0137409_11555655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 511 | Open in IMG/M |
| 3300017948|Ga0187847_10853507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 517 | Open in IMG/M |
| 3300018044|Ga0187890_10322374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 867 | Open in IMG/M |
| 3300018046|Ga0187851_10008292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7904 | Open in IMG/M |
| 3300018057|Ga0187858_10177596 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1403 | Open in IMG/M |
| 3300018057|Ga0187858_10441791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 802 | Open in IMG/M |
| 3300018085|Ga0187772_11386662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 521 | Open in IMG/M |
| 3300019890|Ga0193728_1002194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 10080 | Open in IMG/M |
| 3300020021|Ga0193726_1012969 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4416 | Open in IMG/M |
| 3300020022|Ga0193733_1113779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 751 | Open in IMG/M |
| 3300020027|Ga0193752_1026204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2718 | Open in IMG/M |
| 3300020061|Ga0193716_1157190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300020579|Ga0210407_10339888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1174 | Open in IMG/M |
| 3300020579|Ga0210407_10770364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 743 | Open in IMG/M |
| 3300020581|Ga0210399_11329076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 565 | Open in IMG/M |
| 3300020582|Ga0210395_10055233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2910 | Open in IMG/M |
| 3300020583|Ga0210401_11615872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 506 | Open in IMG/M |
| 3300021168|Ga0210406_10472384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300021178|Ga0210408_11220952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 573 | Open in IMG/M |
| 3300021475|Ga0210392_10015293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 4225 | Open in IMG/M |
| 3300021475|Ga0210392_10120629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1754 | Open in IMG/M |
| 3300021477|Ga0210398_10468585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1026 | Open in IMG/M |
| 3300021478|Ga0210402_11609894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 576 | Open in IMG/M |
| 3300022523|Ga0242663_1038766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 800 | Open in IMG/M |
| 3300022726|Ga0242654_10327445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 571 | Open in IMG/M |
| 3300023046|Ga0233356_1048699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 528 | Open in IMG/M |
| 3300025527|Ga0208714_1043321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Tenggerimyces → Tenggerimyces flavus | 1001 | Open in IMG/M |
| 3300026291|Ga0209890_10221609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 599 | Open in IMG/M |
| 3300026555|Ga0179593_1305344 | Not Available | 2118 | Open in IMG/M |
| 3300027545|Ga0209008_1025836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1370 | Open in IMG/M |
| 3300027565|Ga0209219_1036774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 1220 | Open in IMG/M |
| 3300027590|Ga0209116_1081221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 710 | Open in IMG/M |
| 3300027619|Ga0209330_1081830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 736 | Open in IMG/M |
| 3300027660|Ga0209736_1136410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 656 | Open in IMG/M |
| 3300027737|Ga0209038_10069842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1053 | Open in IMG/M |
| 3300027853|Ga0209274_10556152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 594 | Open in IMG/M |
| 3300027860|Ga0209611_10262450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1028 | Open in IMG/M |
| 3300027867|Ga0209167_10054658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1969 | Open in IMG/M |
| 3300027895|Ga0209624_10963676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 554 | Open in IMG/M |
| 3300027902|Ga0209048_10000512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 41302 | Open in IMG/M |
| 3300027908|Ga0209006_10185577 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1813 | Open in IMG/M |
| 3300028021|Ga0265352_1006298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 705 | Open in IMG/M |
| 3300028773|Ga0302234_10510455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 514 | Open in IMG/M |
| 3300028789|Ga0302232_10076859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1729 | Open in IMG/M |
| 3300028801|Ga0302226_10203833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 847 | Open in IMG/M |
| 3300028806|Ga0302221_10254296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 767 | Open in IMG/M |
| 3300028906|Ga0308309_11701149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 535 | Open in IMG/M |
| 3300029913|Ga0311362_10252226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1918 | Open in IMG/M |
| 3300029922|Ga0311363_11344816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 587 | Open in IMG/M |
| 3300029943|Ga0311340_10623075 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
| 3300029943|Ga0311340_11517673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 524 | Open in IMG/M |
| 3300029945|Ga0311330_10568121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 898 | Open in IMG/M |
| 3300029952|Ga0311346_10870147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 748 | Open in IMG/M |
| 3300030051|Ga0302195_10443473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 558 | Open in IMG/M |
| 3300030057|Ga0302176_10404095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 551 | Open in IMG/M |
| 3300030503|Ga0311370_10632962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1273 | Open in IMG/M |
| 3300030503|Ga0311370_12417872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 508 | Open in IMG/M |
| 3300030518|Ga0302275_10002698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 18524 | Open in IMG/M |
| 3300030519|Ga0302193_10596152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 534 | Open in IMG/M |
| 3300030520|Ga0311372_10342405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2318 | Open in IMG/M |
| 3300030580|Ga0311355_10197723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2109 | Open in IMG/M |
| 3300030580|Ga0311355_11592863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 561 | Open in IMG/M |
| 3300030618|Ga0311354_10911670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 818 | Open in IMG/M |
| 3300030677|Ga0302317_10365969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 639 | Open in IMG/M |
| 3300030760|Ga0265762_1098805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 645 | Open in IMG/M |
| 3300030763|Ga0265763_1038499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 569 | Open in IMG/M |
| 3300030937|Ga0138302_1423299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 600 | Open in IMG/M |
| 3300031027|Ga0302308_10821584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 516 | Open in IMG/M |
| 3300031028|Ga0302180_10561821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 553 | Open in IMG/M |
| 3300031057|Ga0170834_111253104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 512 | Open in IMG/M |
| 3300031057|Ga0170834_111277205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 623 | Open in IMG/M |
| 3300031231|Ga0170824_106367578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 864 | Open in IMG/M |
| 3300031234|Ga0302325_12260210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 659 | Open in IMG/M |
| 3300031236|Ga0302324_103298223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 529 | Open in IMG/M |
| 3300031249|Ga0265339_10315951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 742 | Open in IMG/M |
| 3300031446|Ga0170820_12871101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 620 | Open in IMG/M |
| 3300031446|Ga0170820_13416394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter denitrificans | 977 | Open in IMG/M |
| 3300031595|Ga0265313_10247725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 727 | Open in IMG/M |
| 3300031708|Ga0310686_104455103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 964 | Open in IMG/M |
| 3300031708|Ga0310686_105883281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 577 | Open in IMG/M |
| 3300031718|Ga0307474_10701932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 799 | Open in IMG/M |
| 3300031718|Ga0307474_11176477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 606 | Open in IMG/M |
| 3300031788|Ga0302319_10531269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1251 | Open in IMG/M |
| 3300032180|Ga0307471_104098892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 14.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.13% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.69% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.88% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.06% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.25% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 3.25% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.44% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.44% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.44% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.44% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.44% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.63% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.63% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.63% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.63% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.63% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009701 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300025527 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030937 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0031654_100001164 | 3300003861 | Freshwater Lake Sediment | MSRRLGAATRADPARNAMAPLDSYTTLLPAALERSVDELKPLFNAGLEREKSPI* |
| Ga0055465_103362172 | 3300004013 | Natural And Restored Wetlands | GDPARNAVALLDAYTTLLPNAIEQALADMRPLFGALLGSER* |
| Ga0062385_107286883 | 3300004080 | Bog Forest Soil | DMSRRLGAATRTDPARNAIALLDSYTALLPAALESSLEDLKPLFDAWRGA* |
| Ga0062384_1011302772 | 3300004082 | Bog Forest Soil | DPARNAMALLDSYTTLLPAALESSLQELEPLFDSWRGTPF* |
| Ga0062384_1014647191 | 3300004082 | Bog Forest Soil | RDMSRRLGAATRTDPARNAMALLDAYTTLLPAALESSLAELKPLFDAW* |
| Ga0070764_108952321 | 3300005712 | Soil | TDPARNAIALLDAYATLLPAALARSLQELKPLFDAW* |
| Ga0066790_104677681 | 3300005995 | Soil | ARNAMALLDSYTTLLPAALESSLQELKPLFDAWRGPKNPSI* |
| Ga0075017_1006731933 | 3300006059 | Watersheds | ARNALALLDSVTILLPAALECSLEELKPLFDAWQTRGFSAI* |
| Ga0073928_102404594 | 3300006893 | Iron-Sulfur Acid Spring | GAATRTDPAQNAMALLDAYTTLLPAAIDSSLEELKPLFDAW* |
| Ga0099791_104426633 | 3300007255 | Vadose Zone Soil | AQNAMALLDAYTTLLPAALASSLEELKPLFDAWRGAEFQAI* |
| Ga0099829_111455181 | 3300009038 | Vadose Zone Soil | LLDAYTTLLPAALESSLEELKPLFDAWRGAEFQAI* |
| Ga0116105_11535681 | 3300009624 | Peatland | RADPARNAMALLDAYTTLLPAALESSLEELKPLFDAW* |
| Ga0116129_12079461 | 3300009633 | Peatland | AASTDPARNALALLDSFTLLLTAALERSLDELQPLFTGWQAEFPSI* |
| Ga0116117_10438901 | 3300009635 | Peatland | NPARNAIALLDSYTTLLPAAIDGSLDELRPLFESWKSPRPKAI* |
| Ga0116224_103525393 | 3300009683 | Peatlands Soil | PARNAMALLDSYTTLLPAALERSFEELKPLFRAWRTRGNSPI* |
| Ga0116228_107928221 | 3300009701 | Host-Associated | ATRTDPARNALALLDAYATLLPAALDDSLNELRPLFDAWQTLENSAI* |
| Ga0116226_110059953 | 3300009787 | Host-Associated | RTDPARNAIALLDSYTTLLPAALETSLEDLKPLFDAWQMRKTPAI* |
| Ga0116226_111892963 | 3300009787 | Host-Associated | RLGAATRTDPARNALALLDAYATLLPAALDDSLNELRPLFDAWQTRENSTI* |
| Ga0074046_103237512 | 3300010339 | Bog Forest Soil | MVLPARWNSVVNRDMSRRLGAATRTDPARNAIAALDAYATLLPVALECSLNEFKPLFDAWQTRRIPAI* |
| Ga0074045_109659712 | 3300010341 | Bog Forest Soil | RTDPARNAIALLDSYTTLLPAALESSLEDLKPLFDAWRAASE* |
| Ga0074044_106536021 | 3300010343 | Bog Forest Soil | LGAAATTDPARNALALLDSFTLLLPAALERSLDELQPLFTGWQTP* |
| Ga0126356_105358903 | 3300010877 | Boreal Forest Soil | GAATRTDPARNAMALLDAYTTLLPAALDRSLDELKPLFDAWQTKKNPAI* |
| Ga0126350_103230113 | 3300010880 | Boreal Forest Soil | SRRLGAAATTDPARNAMALLDAYTTLLPAALESSLEELKPLFDAWRRAN* |
| Ga0137393_114061343 | 3300011271 | Vadose Zone Soil | NARALLDSYTTLLPAALESSLEELKPLFEAWRAPPISAI* |
| Ga0137388_108827961 | 3300012189 | Vadose Zone Soil | TRTDPAQNAMALLDAYTTLLPAALASSLEELKPLFDAWRGAEFQAI* |
| Ga0137360_116142262 | 3300012361 | Vadose Zone Soil | RDMSRRLGAATRTDPARNAMALLDAYTTLLPAALDRSLDELKPLFDAWQTKKNPAI* |
| Ga0137419_112785122 | 3300012925 | Vadose Zone Soil | GAAAPTDPARNAMALLDAYTTLLPAALESSLEELKPLFEAW* |
| Ga0137416_101429101 | 3300012927 | Vadose Zone Soil | TRTDPAQNAMALLDAYATLLPAVLESSLEELKPLFDAWRGAEFQAI* |
| Ga0137416_108120521 | 3300012927 | Vadose Zone Soil | DPAQNAIALLDAYTTLLPAALESSLEELRPLFDAWRGAEFQAI* |
| Ga0137407_110430823 | 3300012930 | Vadose Zone Soil | RTDPAQNAMALLDSYATLLPAALESSLEELKPLFDGWRGAEFQAI* |
| Ga0181534_102292963 | 3300014168 | Bog | TDPARNAMALLDSVTTLVPAALDCSLDELRPLFDAWETREKSTI* |
| Ga0182018_101297874 | 3300014489 | Palsa | VNRDMSRRLGAATRSDPARNAIALLDSYTTLLPAALERSFDELKPLFGAWQTERKFPI* |
| Ga0182012_103957613 | 3300014499 | Bog | GAATRTDPARNAMALLDSYTCLLPAALEGSLEELKPLFGAWKGAAI* |
| Ga0182012_108208511 | 3300014499 | Bog | KNLHVVNRDMSRRLGAATRTDPARNALALLDAYTILLPAALECSLEELTPLFDAWQTKRIPAI* |
| Ga0182024_102853975 | 3300014501 | Permafrost | SRRLGAATNTDPARNAMALLDSYATLLPAALDRSLEEWKPLFDAWESA* |
| Ga0182024_112229903 | 3300014501 | Permafrost | LGAATNTDPARNAIALLDTYTTLLPAALDRSLDELRPLFDAWQTK* |
| Ga0182030_108600253 | 3300014838 | Bog | MSRRLGAATRSDPARNAMALLDTYTTLLPAALECSLDELKPLFDAWQTKRIPAI* |
| Ga0137409_115556552 | 3300015245 | Vadose Zone Soil | LGAATRTDPARNAMALLDAYTTLLPAALDRSLDELKPLFDAWQTKKNPAI* |
| Ga0187847_108535072 | 3300017948 | Peatland | LGAATRADPVRNALALLDSVTTLLPAALDCSLDELKPLFGAWAPLEFSPFNLP |
| Ga0187872_100145988 | 3300018017 | Peatland | PARNAIALLDAYATLSPAALECSLNELNPLFDAWQTKRIPAI |
| Ga0187890_103223743 | 3300018044 | Peatland | HLVNRDMSRRLGAATHTDPARNAMALLDSYATLLPAALDRSLEEWKPLFDAWEAK |
| Ga0187851_100082921 | 3300018046 | Peatland | THTDPARNAMALLDSYAMLLPAALDRSLEEWKPLFDAWEAK |
| Ga0187858_101775963 | 3300018057 | Peatland | DMSRRLGAATRTDPARNAIALLDSYTTLLPAALECSLNELNPLFDAWQTKRIPAI |
| Ga0187858_104417913 | 3300018057 | Peatland | DPARNAMALLDSYATLLPAALDRSLEEWKPLFDAWEAE |
| Ga0187772_113866622 | 3300018085 | Tropical Peatland | LGAATRTDPARNAMALLDSYTTLLPAALERSLDELRPLFDAWRT |
| Ga0193728_10021941 | 3300019890 | Soil | RVVDRDMSRRLGAATRTDPARNAMALLDSYTTLLPAALESSLQELKPLFDAWRGPKIPSI |
| Ga0193726_10129691 | 3300020021 | Soil | APAGAAARTDPARNAMALLDAYTTLLPAALESSLEELKPLFEAW |
| Ga0193733_11137793 | 3300020022 | Soil | RTDPARNAMALLDAYTTLLPAALESSLAELKPLFDAWREAQ |
| Ga0193752_10262041 | 3300020027 | Soil | RRLGAATRTDPARNAMALLDSYTTLLPAALESSLEELKPLFDAWRGAANSSI |
| Ga0193716_11571901 | 3300020061 | Soil | GAATRTDPARNAMALLDSYTTLLPAALESSLEELKPLFDAWRGAANSSI |
| Ga0210407_103398881 | 3300020579 | Soil | DPARNAIALLDSYTTLLPAALESSLEELKPLFDAWRNACE |
| Ga0210407_107703641 | 3300020579 | Soil | MSRRLGAATRTDPARNAMALLDSYTTLLPAALESQLTELKPLFEAWRGLPISAI |
| Ga0210399_113290763 | 3300020581 | Soil | MALLDAYTTLLPAALESSLEELKPLFDAWRGAEFQAI |
| Ga0210395_100552337 | 3300020582 | Soil | TDPARNAMALLDSYTTILPAALESSLEDLKPLFDAWRST |
| Ga0210401_116158721 | 3300020583 | Soil | RDMSRRLGAATHTDPARNAMALLDAYTTLLPAALESSLEELKPLFDAWRRPGSAAI |
| Ga0210406_104723843 | 3300021168 | Soil | DPARNAIALLDSYTTLLPAALASSLEELKPLFDAWRDPQI |
| Ga0210408_112209522 | 3300021178 | Soil | TRTDPARNAMALLDSYTTLLPAAIERSLEELKPLFDAWQDKHFFAI |
| Ga0210392_100152931 | 3300021475 | Soil | GAATRTDPARNAMALLDSYTTLLPAALESSLEELKPLFEAWRGLPISAI |
| Ga0210392_101206295 | 3300021475 | Soil | AATRTDPAQNAMALLDAYTTLLPAALESSLAELKPLFDAW |
| Ga0210398_104685853 | 3300021477 | Soil | GAATRTDPARNAMALLDSYTTLLPAALDSSLEELKPLFDGWRAT |
| Ga0210402_116098942 | 3300021478 | Soil | RRLGAAARTDPARNAMALLDAYTTLLPAALERSLDELRPLFDAWQTKKNPAI |
| Ga0242663_10387663 | 3300022523 | Soil | RDMSRRLGAATRTDPARNAMALLDSYTTLLPAALESQLAELKPLFDAWRGVLISSI |
| Ga0242654_103274453 | 3300022726 | Soil | ALLDAYATLLPAVLESSLEEFKPLFDAWRGVEFQAI |
| Ga0233356_10486991 | 3300023046 | Soil | TRTDPAQNAMALLDAYTTLLPAALESSLEELKPLFDAW |
| Ga0208714_10433212 | 3300025527 | Arctic Peat Soil | MPRRLGAATRTDPARNAMALLDSYTTLLAAVLERSFDELKPLFNAWLEREKSPI |
| Ga0209890_102216092 | 3300026291 | Soil | RRLGAATRTDPARNAMALLDAYTTLLPAALESSLEELKPLFDAW |
| Ga0179593_13053444 | 3300026555 | Vadose Zone Soil | MSRRLGAAAPTDPARNAMALLDAYTTLLPAALESSLEELKPLFEAW |
| Ga0209008_10258364 | 3300027545 | Forest Soil | DPARNAMALLDSYTTLLPAALESSLEELKPLFDAWRVQNPSI |
| Ga0209219_10367741 | 3300027565 | Forest Soil | EKLYENLHVVNRGMSRRLGAATRTDPAQNAMALLDAYTTLLPAALEELKPLFDGW |
| Ga0209116_10812213 | 3300027590 | Forest Soil | RLGAATSTDPARNAMALLDSYTTLLPAALDRSLAEWKPLFDAWESK |
| Ga0209330_10818301 | 3300027619 | Forest Soil | ATNTDPARNAIALLDTYTTLLPAALDRSLDELRPLFDAWQTK |
| Ga0209736_11364101 | 3300027660 | Forest Soil | DPAQNAMALLDAYATLLPAALDSSLEELKPLFDAWRGAAFQAI |
| Ga0209038_100698423 | 3300027737 | Bog Forest Soil | SRRLGAAATTDPARNALALLDSFTLLLPAALERSLDELQPLFTGWQTP |
| Ga0209274_105561523 | 3300027853 | Soil | GAATRTDPARNAMALLDSYTTLLPAALESSLQELEPLFDAWQGSPNSSI |
| Ga0209611_102624503 | 3300027860 | Host-Associated | DPARNAIALLDSYTTLLPAALETSLEDLKPLFDAWQMRKTPAI |
| Ga0209167_100546581 | 3300027867 | Surface Soil | LGAAARTDPARNAIALLDAYATLLPAALARSLQELKPLFDAW |
| Ga0209624_109636763 | 3300027895 | Forest Soil | NTDPARNAIALLDTYTTLLPAALDRSLDELRPLFDAWQTK |
| Ga0209048_1000051225 | 3300027902 | Freshwater Lake Sediment | MSRRLGAATRADPARNAMAPLDSYTTLLPAALERSVDELKPLFNAGLEREKSPI |
| Ga0209006_101855775 | 3300027908 | Forest Soil | DPARNAMALLDAYTTLLPAALESSLEELKPLFDAW |
| Ga0265352_10062983 | 3300028021 | Soil | TRTDPARNAMALLDSYTTLLPAALESSLQELKPLFDAWRGAPI |
| Ga0302234_105104552 | 3300028773 | Palsa | TRSDPARNAIALLDTFTSLLPMALDSSLQELAPLFDAWRVAKT |
| Ga0302232_100768591 | 3300028789 | Palsa | LGAATRTDPARNAMALLDSYTTLLPAALESSLQELKPLFDAWQGSPNSSI |
| Ga0302226_102038331 | 3300028801 | Palsa | RLGAAATTDPARNAIALLDSFTLLLPAALERSLDELQPLFTGWQTP |
| Ga0302221_102542961 | 3300028806 | Palsa | DMSRRLGAATRTDPARNAMALLDSYTTLLPAALESSLQELKPLFDAWQGSPNSSI |
| Ga0308309_117011491 | 3300028906 | Soil | AATRTDPARNAIALLDSYTTLLPAALESSLEELKPLFDAWRNASE |
| Ga0311362_102522261 | 3300029913 | Bog | GAATHTDPARNAMALLDSYATLLPAALDRSLEEWKPLFDAWEAK |
| Ga0311363_113448161 | 3300029922 | Fen | NTDPARNAIALLDSYTTLLPAALERSLDELRPLFDAWKIK |
| Ga0311340_106230753 | 3300029943 | Palsa | ARNAMALLDAYTTLLPAALESSLEELKPLFDAWWGRRN |
| Ga0311340_115176731 | 3300029943 | Palsa | TRSDPARNAIALLDAYTSLLPLALDSSLQELAPLFDAWRAART |
| Ga0311330_105681213 | 3300029945 | Bog | MARRLGAATRTDPARNAMALLDSYTCLLPAALEGSLEELKPLFGAWKGAAI |
| Ga0311346_108701473 | 3300029952 | Bog | AMALLDAAATLVPAALECSLEELKPLFDAWKIQEFSAI |
| Ga0302195_104434731 | 3300030051 | Bog | DPARNAMALLDSYTCLLPAALEGSLEELKPLFGAWKGAAI |
| Ga0302176_104040951 | 3300030057 | Palsa | RNAMALLDAYTTLLPAALESSLEELKPLFDAWWGRRN |
| Ga0311370_106329621 | 3300030503 | Palsa | RLGAAASTDPARNALALLDSFTLLLPAALERSLDELQPLFTGWQTR |
| Ga0311370_124178721 | 3300030503 | Palsa | NRDMSRRLGAATRTDPARNAMALLDSYTTLLPAALEASLEDLKPLFGAWRGGEI |
| Ga0302275_100026981 | 3300030518 | Bog | PARNAMALLDAVTTLVPAALDCSLDELRPLFDAWETRENSTI |
| Ga0302193_105961522 | 3300030519 | Bog | ARNAMALLDSYTCLLPAALEGSLEELKPLFGAWKGAAI |
| Ga0311372_103424051 | 3300030520 | Palsa | SRRLGAATRTDSGRNAMALLDSYTTSLPAALESSLKDFKPLFGAWRGAI |
| Ga0311355_101977231 | 3300030580 | Palsa | RRLGAATRTDPARNALALLDSYTTLLPAALDGSFADLKPLFDAWQTKENTAI |
| Ga0311355_115928631 | 3300030580 | Palsa | DPARNALALLDSYTTLLPAALDGSFADLKPLFDAWQTKGNTAI |
| Ga0311354_109116703 | 3300030618 | Palsa | TRTAPARNAMALLDAYTTLLPAALESSLEELKPLFDAWWGRRN |
| Ga0302317_103659691 | 3300030677 | Palsa | DPARNAMALLDAYTTLLPAALESSLEELKPLFDAWWGRRN |
| Ga0265762_10988053 | 3300030760 | Soil | NAMALLDSYTTLLPAALESSLQELKPLFDAWQGSPNSSI |
| Ga0265763_10384991 | 3300030763 | Soil | ARNAMALLDSYTTLLPAALESSLQELKPLFDAWRGAPI |
| Ga0138302_14232991 | 3300030937 | Soil | ARNAMALLDSYTTLLPAALESQLTELKPLFDAWRGVPNSSI |
| Ga0302308_108215841 | 3300031027 | Palsa | SRRLGAAATTDPARNALALLDSFTLLLPAALERSLDELQPLFSGWQTP |
| Ga0302180_105618212 | 3300031028 | Palsa | RLGAATRSDPARNAIALLDTFTSLLPMALDSSLQELAPLFDAWRVAKT |
| Ga0170834_1112531042 | 3300031057 | Forest Soil | DMSRRLGAATRTDPARNAMALLDSYTTLLPAALESSLEELKPLFDAWRGSQI |
| Ga0170834_1112772051 | 3300031057 | Forest Soil | LLDGYATLLPALLESSLEEFKPLFDAWRGVEFQAI |
| Ga0170824_1063675783 | 3300031231 | Forest Soil | ATRTDPARNAMALLDAYTTLLPAALESSLAELKPLFDAWRGAQ |
| Ga0302325_122602101 | 3300031234 | Palsa | TRADPARNAIALLDAYTMLLPAALESSLEELKPLFDAW |
| Ga0302324_1032982232 | 3300031236 | Palsa | LGAATHTDPAQNAMALLDAYITLLPATLESSLNGLKPLFDAW |
| Ga0265339_103159513 | 3300031249 | Rhizosphere | VVNRDMSRRLGAATHADPARNGIALLDAGTTLLPAALECLLDELRPLFGAWRAGETWAI |
| Ga0170820_128711013 | 3300031446 | Forest Soil | RTDPAQNAMALLDAYTTLLPAALASSLEELKPLFDAWRGAEFQAI |
| Ga0170820_134163941 | 3300031446 | Forest Soil | LIVNRDLSRRLGAATRTDPARNAIALLDSYTTLLPLALENLLEEFRPLFEAWREVEF |
| Ga0265313_102477253 | 3300031595 | Rhizosphere | IALLDAYTTLLPAALECLLEELKPLFGAWQGSASRTI |
| Ga0310686_1044551031 | 3300031708 | Soil | MSRRLGATSRTDPARNAMALLDSHTCLLPGALDSSLEELKPLFGAWKPPGI |
| Ga0310686_1058832813 | 3300031708 | Soil | DPARNAMALLDSYTTLLPAALESSLRELKPLFDAWRGTPHSSI |
| Ga0307474_107019321 | 3300031718 | Hardwood Forest Soil | LGAATHTDPARNAMALLDAYTTLLPAALESSLEELKPLFDAWRRPESDPI |
| Ga0307474_111764771 | 3300031718 | Hardwood Forest Soil | SGAATRTDPARNAMALLDSYTTLLPAALESSLQDLKPLFDAWRGVPILPI |
| Ga0302319_105312691 | 3300031788 | Bog | RLGAATHTDPARNAMALLDSYATLLPAALDRSLEEWKPLFDAWEAK |
| Ga0311301_120601233 | 3300032160 | Peatlands Soil | NAIALLDSYTTLLPAAIASSLDELRPLFESWKNPKQNTI |
| Ga0307471_1040988921 | 3300032180 | Hardwood Forest Soil | RTDPARNAMALLDSYTTLLPAALESQLKELKPLFEAWRDLPNSAI |
| ⦗Top⦘ |