| Basic Information | |
|---|---|
| Family ID | F069763 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTAARTK |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 88.62 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.187 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (36.585 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.520 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.285 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.49% β-sheet: 0.00% Coil/Unstructured: 84.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF02491 | SHS2_FTSA | 50.41 |
| PF14450 | FtsA | 35.77 |
| PF12327 | FtsZ_C | 2.44 |
| PF00091 | Tubulin | 2.44 |
| PF13263 | PHP_C | 1.63 |
| PF03932 | CutC | 0.81 |
| PF06277 | EutA | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG3142 | Copper homeostasis protein CutC | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4819 | Ethanolamine utilization protein EutA, possible chaperonin | Amino acid transport and metabolism [E] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.19 % |
| Unclassified | root | N/A | 0.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001137|JGI12637J13337_1017485 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300002914|JGI25617J43924_10166949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 743 | Open in IMG/M |
| 3300004091|Ga0062387_100272319 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300005174|Ga0066680_10284800 | All Organisms → cellular organisms → Bacteria | 1054 | Open in IMG/M |
| 3300005179|Ga0066684_10205773 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300005446|Ga0066686_10652061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 715 | Open in IMG/M |
| 3300005554|Ga0066661_10366572 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300005568|Ga0066703_10399920 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300005574|Ga0066694_10003269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6418 | Open in IMG/M |
| 3300005950|Ga0066787_10071484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 700 | Open in IMG/M |
| 3300006034|Ga0066656_10021949 | All Organisms → cellular organisms → Bacteria | 3432 | Open in IMG/M |
| 3300006102|Ga0075015_100452249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300006893|Ga0073928_10419244 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300007255|Ga0099791_10468486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300007258|Ga0099793_10530960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300007265|Ga0099794_10705226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300009038|Ga0099829_11442791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300009088|Ga0099830_10208639 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300009088|Ga0099830_10887060 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300009088|Ga0099830_11305208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300009089|Ga0099828_10259461 | All Organisms → cellular organisms → Bacteria | 1559 | Open in IMG/M |
| 3300009089|Ga0099828_10979212 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300009089|Ga0099828_11331069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300009090|Ga0099827_11195486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300009090|Ga0099827_11595781 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300009137|Ga0066709_103835370 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300010046|Ga0126384_12101589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300010320|Ga0134109_10027076 | All Organisms → cellular organisms → Bacteria | 1799 | Open in IMG/M |
| 3300010322|Ga0134084_10382245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300010359|Ga0126376_12970708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300010361|Ga0126378_11196488 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300010361|Ga0126378_12787095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300010361|Ga0126378_12838587 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010362|Ga0126377_12132428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300010364|Ga0134066_10001314 | All Organisms → cellular organisms → Bacteria | 3941 | Open in IMG/M |
| 3300010376|Ga0126381_103948617 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300011120|Ga0150983_11027506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300011120|Ga0150983_13292692 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300011270|Ga0137391_10294053 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300011271|Ga0137393_10721324 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300012189|Ga0137388_10415889 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300012189|Ga0137388_12015076 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012199|Ga0137383_11010384 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012201|Ga0137365_10390654 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300012202|Ga0137363_10924890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300012203|Ga0137399_10420581 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300012203|Ga0137399_10956118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300012203|Ga0137399_11033431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300012203|Ga0137399_11037530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300012207|Ga0137381_11439778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 581 | Open in IMG/M |
| 3300012351|Ga0137386_10799213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300012400|Ga0134048_1161082 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012582|Ga0137358_10109134 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300012582|Ga0137358_10511386 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300012685|Ga0137397_10640637 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012917|Ga0137395_10923179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300012925|Ga0137419_11224209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300012927|Ga0137416_10855158 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012927|Ga0137416_10904655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 785 | Open in IMG/M |
| 3300012929|Ga0137404_11205920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300012930|Ga0137407_10790014 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300012977|Ga0134087_10028040 | All Organisms → cellular organisms → Bacteria | 2110 | Open in IMG/M |
| 3300014166|Ga0134079_10180954 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300015241|Ga0137418_11236226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300015245|Ga0137409_10221121 | All Organisms → cellular organisms → Bacteria | 1695 | Open in IMG/M |
| 3300017657|Ga0134074_1186576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300017659|Ga0134083_10266506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300017943|Ga0187819_10661806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300017947|Ga0187785_10560300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300018431|Ga0066655_10000328 | All Organisms → cellular organisms → Bacteria | 15116 | Open in IMG/M |
| 3300018468|Ga0066662_12467260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300019275|Ga0187798_1553288 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300020579|Ga0210407_10629134 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300020579|Ga0210407_11111785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300020580|Ga0210403_10201025 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
| 3300020580|Ga0210403_10693743 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300021088|Ga0210404_10191112 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300021180|Ga0210396_11719427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300021406|Ga0210386_11602166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300021420|Ga0210394_11083976 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300021475|Ga0210392_11190219 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300021478|Ga0210402_10149828 | All Organisms → cellular organisms → Bacteria | 2124 | Open in IMG/M |
| 3300021559|Ga0210409_10955696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300022508|Ga0222728_1063315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300022722|Ga0242657_1076094 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300024330|Ga0137417_1116314 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300024330|Ga0137417_1233941 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300024330|Ga0137417_1299562 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300026214|Ga0209838_1064718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300026310|Ga0209239_1110136 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300026310|Ga0209239_1325111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300026313|Ga0209761_1342829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300026314|Ga0209268_1007526 | All Organisms → cellular organisms → Bacteria | 4598 | Open in IMG/M |
| 3300026334|Ga0209377_1011444 | All Organisms → cellular organisms → Bacteria | 4927 | Open in IMG/M |
| 3300026334|Ga0209377_1029038 | All Organisms → cellular organisms → Bacteria | 2675 | Open in IMG/M |
| 3300026334|Ga0209377_1223565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300026359|Ga0257163_1010105 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300026497|Ga0257164_1089286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300026527|Ga0209059_1065066 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300026551|Ga0209648_10622664 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300026552|Ga0209577_10798347 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300026557|Ga0179587_10047079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2466 | Open in IMG/M |
| 3300027587|Ga0209220_1153846 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027643|Ga0209076_1155442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300027655|Ga0209388_1213981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300027681|Ga0208991_1179354 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300027684|Ga0209626_1116989 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300027867|Ga0209167_10289058 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300027875|Ga0209283_10324373 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300027882|Ga0209590_10249282 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300027895|Ga0209624_10581770 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300028536|Ga0137415_10423579 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300028798|Ga0302222_10026066 | All Organisms → cellular organisms → Bacteria | 2394 | Open in IMG/M |
| 3300028906|Ga0308309_10612226 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300030617|Ga0311356_10738850 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300031715|Ga0307476_10955338 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031740|Ga0307468_101567149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300031754|Ga0307475_10697731 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300031962|Ga0307479_10035203 | All Organisms → cellular organisms → Bacteria | 4786 | Open in IMG/M |
| 3300031962|Ga0307479_10419565 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300032008|Ga0318562_10058816 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300032043|Ga0318556_10076435 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 36.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.06% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.63% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12637J13337_10174851 | 3300001137 | Forest Soil | NGDFAAKYRMLVENFSQWQANAGHIRSVDLQYSRQVILNPDSSAGVAVAKAR* |
| JGI25617J43924_101669491 | 3300002914 | Grasslands Soil | FKMLVDNFSQWQANAGHVQSIDLQYSRQVVVNPDTSSGVTTARKK* |
| Ga0062387_1002723191 | 3300004091 | Bog Forest Soil | VENFAQWQANAGRVRSVDLQYARQVVINPDASASSTVARAK* |
| Ga0066680_102848002 | 3300005174 | Soil | KMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDASAGTAAARTK* |
| Ga0066684_102057732 | 3300005179 | Soil | KMLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSPGATAARTK* |
| Ga0066686_106520611 | 3300005446 | Soil | IHFGAGEFTSKYKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSAGAAARKTR* |
| Ga0066661_103665722 | 3300005554 | Soil | QWQANAGRVQSIDLQYSRQVVVNPDASAGTAAARTK* |
| Ga0066703_103999201 | 3300005568 | Soil | VDNFAQWQAHTGHVQSIDLQYARQVVVNPDSSAGTVAARTK* |
| Ga0066694_100032691 | 3300005574 | Soil | QWQAHTGHVQSIDLQYARQVVVNPDSSAGTVAARTK* |
| Ga0066787_100714842 | 3300005950 | Soil | FSQWQASAGRVQSIDLQYSRQVILNPDSSAGVAVAKAR* |
| Ga0066656_100219494 | 3300006034 | Soil | MLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSTGAAARKTR* |
| Ga0075015_1004522491 | 3300006102 | Watersheds | KYKMLVDNFSQWQANAGRVQSIDLQYTRQVVVNPDTSSVTATARAK* |
| Ga0073928_104192441 | 3300006893 | Iron-Sulfur Acid Spring | RMLVENFSQWQANAGRVRSIDLQYSRQVILNPDSSAGVAVAKAR* |
| Ga0099791_104684862 | 3300007255 | Vadose Zone Soil | IDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTTARKR* |
| Ga0099793_105309602 | 3300007258 | Vadose Zone Soil | SSEFTGKYKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTAARTK* |
| Ga0099794_107052262 | 3300007265 | Vadose Zone Soil | SSEFTGKYKMLVDNFSQWQANAGHVQSIDLQYSRQVVVNPDPSAGTTTARKK* |
| Ga0099829_114427911 | 3300009038 | Vadose Zone Soil | NFSQWQANAGHVQSIDLQYSRQVVVNPDSSAGTASARTR* |
| Ga0099830_102086391 | 3300009088 | Vadose Zone Soil | MLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSAGTAAKKTK* |
| Ga0099830_108870602 | 3300009088 | Vadose Zone Soil | SSEFTGKFKMLVDNFSQWQANAGHVQSIDLQYSRQVVVNPDTSAGTTTARKK* |
| Ga0099830_113052082 | 3300009088 | Vadose Zone Soil | YKMLVDNFLQWQANAGRVQSIDLQYSRQVVVNPDTSAGATAARTK* |
| Ga0099828_102594611 | 3300009089 | Vadose Zone Soil | NFAQWQANTGRVRSIDLQYSRQVVVNPDTSAGTSVARRK* |
| Ga0099828_109792121 | 3300009089 | Vadose Zone Soil | NFTQWQANAGRVQSIDLQYSRQVVVNPDTSSGTVATKTK* |
| Ga0099828_113310692 | 3300009089 | Vadose Zone Soil | KYKMLVDNFSQWQANAGRVQSIDLQYARQVVVNPDSNAGTASIRKK* |
| Ga0099827_111954861 | 3300009090 | Vadose Zone Soil | FSQWQANAGRVQSIDLQYSRQVVVNPDASAGTAAARTK* |
| Ga0099827_115957812 | 3300009090 | Vadose Zone Soil | FGASEFTGKYKMLVDNFSQWQASAGRVQSIDLQYSRQVVVNPDTSAGTTTARTK* |
| Ga0066709_1038353701 | 3300009137 | Grasslands Soil | QWQANTGRVQSIDLQYSRQVVVNPDTSAGTSVARRK* |
| Ga0126384_121015891 | 3300010046 | Tropical Forest Soil | WQASNGRVRSIDLQYSRQVILNTDTSAATTVARAR* |
| Ga0134109_100270761 | 3300010320 | Grasslands Soil | NFSQWQAHTGRVQSIDLQYTRQVVVNPDTSAGTVAAKIK* |
| Ga0134084_103822452 | 3300010322 | Grasslands Soil | HFGSGEFTGKYKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDVSAGTTAARTK* |
| Ga0126376_129707081 | 3300010359 | Tropical Forest Soil | SDFSSKFKMLVDNFSQWQAHTGRVQSIDLQYARQVVVNPDSSAGTAAARTK* |
| Ga0126378_111964882 | 3300010361 | Tropical Forest Soil | QWQAHTGRVQSIDLQYTRQVVVNPDTSAGTMAARTK* |
| Ga0126378_127870951 | 3300010361 | Tropical Forest Soil | QANAGHVQSIDLQYTRQVVVNPDSSPGTMAAKTK* |
| Ga0126378_128385871 | 3300010361 | Tropical Forest Soil | QWQAHTGRVQSIDLQYTRQVVVNPDTSAGAMAARTK* |
| Ga0126377_121324282 | 3300010362 | Tropical Forest Soil | SQWQAHAGRVQSIDLQYTRQVVVNPDTSAGAATARK* |
| Ga0134066_100013141 | 3300010364 | Grasslands Soil | FSQWQAHTGRVQSIDLQYTRQVVVNPDTSAGTVAAKVK* |
| Ga0126381_1039486172 | 3300010376 | Tropical Forest Soil | WQASNGRVRSIDLQYSRQVILNPVSSATASAAKAK* |
| Ga0150983_110275062 | 3300011120 | Forest Soil | GEFTGKYKMLVDNFSQWQANAGRVQSIDLQYKRQVVVNPDTSAGTARAK* |
| Ga0150983_132926921 | 3300011120 | Forest Soil | FTAKFKMLVDNFSQWQANAGRMQSIDLQYSRQVVVNPDSNVGTASARKR* |
| Ga0137391_102940531 | 3300011270 | Vadose Zone Soil | EFTGKYKMLVDNFSQWQANAGHVQSIDLQYSRQVVVNPDTSPGITTARKK* |
| Ga0137393_107213241 | 3300011271 | Vadose Zone Soil | FTGKYKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDASAGTAAARTK* |
| Ga0137388_104158892 | 3300012189 | Vadose Zone Soil | SSEFTGKFKMLVDNFSQWQANAGHVQSIDLQYSRQVVVNPDTSSGVATARTK* |
| Ga0137388_120150762 | 3300012189 | Vadose Zone Soil | VDNFAQWQANTGRVQSIYLQYSRLVVVNPYTSAGTSVASRK* |
| Ga0137383_110103842 | 3300012199 | Vadose Zone Soil | GKFKMLVDNFAQWQANTGRVQSIDLQYSRQVVVNPDTSAGTSVARRK* |
| Ga0137365_103906541 | 3300012201 | Vadose Zone Soil | NFAQWQANTGRVQSIDLQYSRQVVVNPDTSAGTSVARRK* |
| Ga0137363_109248902 | 3300012202 | Vadose Zone Soil | YKMLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTTARKR* |
| Ga0137399_104205811 | 3300012203 | Vadose Zone Soil | IHFGAGEFTGKYKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSAGAAARKTR* |
| Ga0137399_109561182 | 3300012203 | Vadose Zone Soil | IHFGSSEFTGKYKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTAARTK* |
| Ga0137399_110334312 | 3300012203 | Vadose Zone Soil | FSQWQANTGRVQSIDLQYMRQVVVNPDASVGTAAKKTK* |
| Ga0137399_110375302 | 3300012203 | Vadose Zone Soil | NFSQWQANTGRVQSIDLQYMRQVVVNPDTSAAAKKTR* |
| Ga0137381_114397782 | 3300012207 | Vadose Zone Soil | SQWQANAGRVQSIDLQYSRQVVVNPDTSAGTMAAKTK* |
| Ga0137386_107992131 | 3300012351 | Vadose Zone Soil | YKMLVDNFAQWQAHTGHVQSIDLQYARQVVVNPDSSAGTVAARTK* |
| Ga0134048_11610821 | 3300012400 | Grasslands Soil | FGSGEFSGKYKMLIDNFSQWQANAGRVQSIDLHYSRQVVVNPDTSPGATAARTK* |
| Ga0137358_101091343 | 3300012582 | Vadose Zone Soil | DNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTTARKR* |
| Ga0137358_105113862 | 3300012582 | Vadose Zone Soil | YKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTAARTK* |
| Ga0137397_106406371 | 3300012685 | Vadose Zone Soil | MLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTAARTK* |
| Ga0137395_109231792 | 3300012917 | Vadose Zone Soil | GSSEFTGKYKMLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSPGTAVARKK* |
| Ga0137419_112242092 | 3300012925 | Vadose Zone Soil | YKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSASTAAKKTR* |
| Ga0137416_108551582 | 3300012927 | Vadose Zone Soil | KMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDASAGTSAARTK* |
| Ga0137416_109046551 | 3300012927 | Vadose Zone Soil | IHFGAGEFTGKYKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSTSTATKKTR* |
| Ga0137404_112059202 | 3300012929 | Vadose Zone Soil | FTGKYKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSTGTAAKKTR* |
| Ga0137407_107900141 | 3300012930 | Vadose Zone Soil | QWQANTGRVQSIDLQYMRQVVVNPDTSTGVAGKKTR* |
| Ga0134087_100280403 | 3300012977 | Grasslands Soil | MLVDNFAQWQAHTGHVQSIDLQYARQVVVNPDSSAGTVAARTK* |
| Ga0134079_101809542 | 3300014166 | Grasslands Soil | WQAHTGHVQSIDLQYARQVVVNPDSSAGTVAARTK* |
| Ga0137418_112362261 | 3300015241 | Vadose Zone Soil | VDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTAARTK* |
| Ga0137409_102211211 | 3300015245 | Vadose Zone Soil | TGKYKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSASTAAKKTR* |
| Ga0134074_11865761 | 3300017657 | Grasslands Soil | MLVDNFSQWQAHTGRVQSIDLQYTRQVVVNPDTSAGTVAAKIK |
| Ga0134083_102665062 | 3300017659 | Grasslands Soil | DNFSQWQANAGRIQSIDLQYSRQVVVNPDTSPGTAVARKK |
| Ga0187819_106618062 | 3300017943 | Freshwater Sediment | SQWQANAGHVQSIDLQYARQVVVNPDAGSGAPIAKRK |
| Ga0187785_105603002 | 3300017947 | Tropical Peatland | VDNFAQWQASNGRVRSIDLQYSRQVILNTDTSAAATVARAR |
| Ga0066655_100003281 | 3300018431 | Grasslands Soil | KMLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSPGATAARTK |
| Ga0066662_124672601 | 3300018468 | Grasslands Soil | VHFGSAEFTGKYKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDNGPDTMASRRK |
| Ga0187798_15532881 | 3300019275 | Peatland | YRMLVENFAQWQANAGRVQSIDLQYSRQVVVNPDTSASTGKEK |
| Ga0210407_106291341 | 3300020579 | Soil | SGEFAGKYKMLVDNFSQWQANTGRVQSIDLQYLRQVIVNPEPGSGTIAKKSK |
| Ga0210407_111117852 | 3300020579 | Soil | GKYKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDASAGTAPARTK |
| Ga0210403_102010251 | 3300020580 | Soil | YKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSAGTASKKTK |
| Ga0210403_106937431 | 3300020580 | Soil | FSQWQANTGRVQSVDLQYLRQVIVNPEPSSGTIAKKLK |
| Ga0210404_101911122 | 3300021088 | Soil | GGDFAAKYRMLVENFSQWQANAGRVRSIDLQYSRQVILNPDSSVGVAVAKAR |
| Ga0210396_117194272 | 3300021180 | Soil | NFAQWQASNGRVRSIDLQYSRQVILNTDTSGSTTVAKTR |
| Ga0210386_116021661 | 3300021406 | Soil | QWQASNGRVRTIDLQYSRQVILNTDSSSSATVAKTR |
| Ga0210394_110839761 | 3300021420 | Soil | AAKYRMLVENFSQWQANAGRVRSIDLQYSRQVILNPDSSVGVAVAKAR |
| Ga0210392_111902192 | 3300021475 | Soil | LVVDNFAQWQASNGHVRNIDLQYSKQVILNTDSSGGTTVAKSR |
| Ga0210402_101498283 | 3300021478 | Soil | FTNKFSMLVGNFAQWQANTGRVQSIDLQYPRQVVVNPDTSAGTITAKNK |
| Ga0210409_109556962 | 3300021559 | Soil | WQANTGRVQSIDLQYMRQVVVNPDTSAGMTAKKTK |
| Ga0222728_10633151 | 3300022508 | Soil | TGKYKMLVDNFSQWQANTGRVQSIDLQYLRQVIVNPEPGSGTIAKKSK |
| Ga0242657_10760942 | 3300022722 | Soil | FAQWQASNGRVRTIDLQYSRQVILNTDSSGSATVAKTR |
| Ga0137417_11163141 | 3300024330 | Vadose Zone Soil | VDNFSHDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTAARTK |
| Ga0137417_12339412 | 3300024330 | Vadose Zone Soil | YKMLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTTARKR |
| Ga0137417_12995622 | 3300024330 | Vadose Zone Soil | MLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTTARKR |
| Ga0209838_10647182 | 3300026214 | Soil | FSQWQASAGRVQSIDLQYSRQVILNPDSSAGVAVAKAR |
| Ga0209239_11101362 | 3300026310 | Grasslands Soil | GKYKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDASAGTAAAAARTK |
| Ga0209239_13251111 | 3300026310 | Grasslands Soil | KYKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDVSVGTTAARTK |
| Ga0209761_13428292 | 3300026313 | Grasslands Soil | QWQANAGRVQSIDLQYARQVVVNPDSSAGTMAAKTK |
| Ga0209268_10075265 | 3300026314 | Soil | FAQWQAHTGHVQSIDLQYARQVVVNPDSSAGTVAARTK |
| Ga0209377_10114441 | 3300026334 | Soil | EFSGKYKMLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSPGATAARTK |
| Ga0209377_10290381 | 3300026334 | Soil | GKYKMLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTAARTR |
| Ga0209377_12235652 | 3300026334 | Soil | EFTGKYKMLVDNFSQWQANAGHVQSIDLQYSRQVVVNPDTSAGTTTARTK |
| Ga0257163_10101051 | 3300026359 | Soil | KMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDASAGTAAARTK |
| Ga0257164_10892861 | 3300026497 | Soil | VDNFTQWQANAGRVQSIDLQYSRQVVVNPDASAGTAAARTK |
| Ga0209059_10650663 | 3300026527 | Soil | FTGKFKMLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSPGTAVARKK |
| Ga0209648_106226642 | 3300026551 | Grasslands Soil | FTGKYKMLVDNFSQWQANTGRVQSIDLQYSRQVVVNPDTSAGTTAARTK |
| Ga0209577_107983471 | 3300026552 | Soil | GSSDFSGKFKMLVDNFSQWQAHTGRVQSIDLQYTRQVVVNPDTSAGAVTARTK |
| Ga0179587_100470791 | 3300026557 | Vadose Zone Soil | FSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTAARAK |
| Ga0209220_11538461 | 3300027587 | Forest Soil | NGDFAAKYRMLVENFLQWQANAGHIRSVDLQYSRQVILNPDSSAGVAVAKAR |
| Ga0209076_11554421 | 3300027643 | Vadose Zone Soil | KYKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSAGGAARKTR |
| Ga0209388_12139811 | 3300027655 | Vadose Zone Soil | IDNFSQWQANAGRVQSIDLQYSRQVVVNPDTSAGTTTARKR |
| Ga0208991_11793542 | 3300027681 | Forest Soil | MLAENFAQWQANAGRVQSIDLQYSRQVILNPDSRAGVAVAKAR |
| Ga0209626_11169892 | 3300027684 | Forest Soil | DFAAKYRMLVENFSQWQANAGHVRSIDLQYSRQVILNPDSSAGVAVAKAR |
| Ga0209773_104366131 | 3300027829 | Bog Forest Soil | ENFAQWQANAGRVRSVDLQYARQVVINPDASANSTVARAK |
| Ga0209167_102890582 | 3300027867 | Surface Soil | LVNNFAQWQANTGHVQSIDLQYPRQVVVNPDTSAGTITAKNK |
| Ga0209283_103243732 | 3300027875 | Vadose Zone Soil | SEFTGKYKMLVDNFSQWQANAGRVQSIDLQYSRQVVVNPDPSAGTTTARKK |
| Ga0209590_102492822 | 3300027882 | Vadose Zone Soil | FGVSDFTGKFKMLVDNFAQWQANTGRVQSIDLQYSRQVVVNPDTSAGTSVARRK |
| Ga0209624_105817702 | 3300027895 | Forest Soil | AQWQASNGRVRSIDLQYSRQVILNTDTSGSTTVAKTR |
| Ga0137415_104235791 | 3300028536 | Vadose Zone Soil | KYKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDASVGTAAKKTK |
| Ga0302222_100260661 | 3300028798 | Palsa | AQWQANNGRVRSIDLQYARQVILNPDANVVTAARTK |
| Ga0308309_106122262 | 3300028906 | Soil | LVVDNFAQWQASNGRVRTIDLQYSRQVILNTDSSSSTTVAKTR |
| Ga0311356_107388501 | 3300030617 | Palsa | SSEFTGKYRMLVENFAQWQANAGRVRSVDLQYARQVVINPDASAPVTVARAK |
| Ga0307476_109553381 | 3300031715 | Hardwood Forest Soil | GEFTGKYRMLVENFAQWQANAGRVRSVDLQYARQVVINPDANAATTVARAK |
| Ga0307468_1015671491 | 3300031740 | Hardwood Forest Soil | AGKYKMLVDNFSQWQANTGRVQSIDLQYMRQVVVNPDTSAGTAAKKTR |
| Ga0307475_106977311 | 3300031754 | Hardwood Forest Soil | FAAKYRMLVENFSQWQANAGHVRSIDLQYSRQVILNPDASAGVAVAKAR |
| Ga0307479_100352036 | 3300031962 | Hardwood Forest Soil | KMLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDASAGTATARKR |
| Ga0307479_104195652 | 3300031962 | Hardwood Forest Soil | MLIDNFSQWQANAGRVQSIDLQYSRQVVVNPDASVGMATARKR |
| Ga0318562_100588161 | 3300032008 | Soil | VDNFAQWQDHTGRVQSIDLQYARQVVVNPDSSAGTVAARTK |
| Ga0318556_100764353 | 3300032043 | Soil | WQDHTGRVQSIDLQYARQVVVNPDSSAGTVAARTK |
| ⦗Top⦘ |