| Basic Information | |
|---|---|
| Family ID | F069699 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 123 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MIIKAYRQELRDFINNNEIKILAGEKVEFPKQPDFIDLNIIY |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.82 % |
| % of genes near scaffold ends (potentially truncated) | 88.62 % |
| % of genes from short scaffolds (< 2000 bps) | 95.93 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.919 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (50.407 % of family members) |
| Environment Ontology (ENVO) | Unclassified (73.984 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (47.967 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.29% β-sheet: 0.00% Coil/Unstructured: 65.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF02178 | AT_hook | 0.81 |
| PF13884 | Peptidase_S74 | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.92 % |
| All Organisms | root | All Organisms | 30.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2199975675 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 999 | Open in IMG/M |
| 3300000052|Draft_c002063 | Not Available | 765 | Open in IMG/M |
| 3300000553|TBL_comb47_HYPODRAFT_10064583 | Not Available | 2078 | Open in IMG/M |
| 3300002369|B570J29640_105804 | Not Available | 596 | Open in IMG/M |
| 3300002370|B570J29631_107179 | Not Available | 580 | Open in IMG/M |
| 3300002379|B570J29633_102622 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 958 | Open in IMG/M |
| 3300002408|B570J29032_109074636 | Not Available | 586 | Open in IMG/M |
| 3300002408|B570J29032_109231539 | Not Available | 646 | Open in IMG/M |
| 3300002408|B570J29032_109770906 | Not Available | 1267 | Open in IMG/M |
| 3300003860|Ga0031658_1057790 | Not Available | 675 | Open in IMG/M |
| 3300007636|Ga0102856_1041473 | Not Available | 715 | Open in IMG/M |
| 3300007955|Ga0105740_1066336 | Not Available | 595 | Open in IMG/M |
| 3300008108|Ga0114341_10256831 | Not Available | 937 | Open in IMG/M |
| 3300008111|Ga0114344_1082898 | Not Available | 1187 | Open in IMG/M |
| 3300008117|Ga0114351_1424461 | Not Available | 550 | Open in IMG/M |
| 3300008120|Ga0114355_1196830 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 654 | Open in IMG/M |
| 3300009068|Ga0114973_10520617 | Not Available | 615 | Open in IMG/M |
| 3300009154|Ga0114963_10285297 | Not Available | 924 | Open in IMG/M |
| 3300009181|Ga0114969_10207274 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1200 | Open in IMG/M |
| 3300009181|Ga0114969_10539783 | Not Available | 647 | Open in IMG/M |
| 3300009187|Ga0114972_10640889 | Not Available | 590 | Open in IMG/M |
| 3300010388|Ga0136551_1060737 | Not Available | 682 | Open in IMG/M |
| 3300010970|Ga0137575_10032725 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 833 | Open in IMG/M |
| 3300012715|Ga0157599_1094253 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 895 | Open in IMG/M |
| 3300012719|Ga0157600_1126974 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 853 | Open in IMG/M |
| 3300012725|Ga0157610_1272464 | Not Available | 662 | Open in IMG/M |
| 3300012726|Ga0157597_1137244 | Not Available | 876 | Open in IMG/M |
| 3300012730|Ga0157602_1099454 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 910 | Open in IMG/M |
| 3300013004|Ga0164293_10413660 | Not Available | 905 | Open in IMG/M |
| 3300013004|Ga0164293_10725523 | Not Available | 635 | Open in IMG/M |
| 3300013004|Ga0164293_10739856 | Not Available | 627 | Open in IMG/M |
| 3300013004|Ga0164293_10999469 | Not Available | 522 | Open in IMG/M |
| 3300013005|Ga0164292_10123980 | Not Available | 1919 | Open in IMG/M |
| 3300013005|Ga0164292_10311240 | Not Available | 1074 | Open in IMG/M |
| 3300013005|Ga0164292_10402920 | Not Available | 913 | Open in IMG/M |
| 3300013005|Ga0164292_10927855 | Not Available | 545 | Open in IMG/M |
| 3300013006|Ga0164294_10349794 | Not Available | 1018 | Open in IMG/M |
| 3300013295|Ga0170791_12468236 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 518 | Open in IMG/M |
| 3300013295|Ga0170791_13790299 | Not Available | 511 | Open in IMG/M |
| 3300013295|Ga0170791_15410981 | Not Available | 1035 | Open in IMG/M |
| 3300020160|Ga0211733_10977609 | Not Available | 604 | Open in IMG/M |
| 3300020162|Ga0211735_10048772 | Not Available | 1281 | Open in IMG/M |
| 3300020172|Ga0211729_10266535 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1039 | Open in IMG/M |
| 3300020172|Ga0211729_11053318 | Not Available | 884 | Open in IMG/M |
| 3300020493|Ga0208591_1013608 | Not Available | 1106 | Open in IMG/M |
| 3300020502|Ga0208087_1034835 | Not Available | 615 | Open in IMG/M |
| 3300020520|Ga0208481_1009847 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1698 | Open in IMG/M |
| 3300020528|Ga0208224_1007500 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1766 | Open in IMG/M |
| 3300020543|Ga0208089_1018608 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1021 | Open in IMG/M |
| 3300020558|Ga0208362_1011948 | Not Available | 1785 | Open in IMG/M |
| 3300020558|Ga0208362_1018775 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1306 | Open in IMG/M |
| 3300020565|Ga0208718_1023707 | Not Available | 1239 | Open in IMG/M |
| 3300021108|Ga0214162_1040322 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 794 | Open in IMG/M |
| 3300021108|Ga0214162_1045043 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 743 | Open in IMG/M |
| 3300027254|Ga0208177_1052146 | Not Available | 771 | Open in IMG/M |
| 3300027683|Ga0209392_1164925 | Not Available | 685 | Open in IMG/M |
| 3300027797|Ga0209107_10093612 | Not Available | 1620 | Open in IMG/M |
| 3300027804|Ga0209358_10504489 | Not Available | 549 | Open in IMG/M |
| 3300027804|Ga0209358_10541249 | Not Available | 522 | Open in IMG/M |
| 3300027836|Ga0209230_10304653 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 918 | Open in IMG/M |
| 3300028027|Ga0247722_10003475 | Not Available | 7831 | Open in IMG/M |
| 3300028027|Ga0247722_10099756 | Not Available | 1075 | Open in IMG/M |
| 3300028027|Ga0247722_10131906 | Not Available | 908 | Open in IMG/M |
| 3300031784|Ga0315899_10429667 | Not Available | 1279 | Open in IMG/M |
| 3300031784|Ga0315899_10654568 | Not Available | 983 | Open in IMG/M |
| 3300031784|Ga0315899_10763712 | Not Available | 889 | Open in IMG/M |
| 3300031784|Ga0315899_11470378 | Not Available | 573 | Open in IMG/M |
| 3300031786|Ga0315908_10184078 | Not Available | 1728 | Open in IMG/M |
| 3300031786|Ga0315908_11367856 | Not Available | 556 | Open in IMG/M |
| 3300031857|Ga0315909_10468904 | Not Available | 880 | Open in IMG/M |
| 3300032050|Ga0315906_10767352 | Not Available | 762 | Open in IMG/M |
| 3300032050|Ga0315906_11309414 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 516 | Open in IMG/M |
| 3300032092|Ga0315905_10767838 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 844 | Open in IMG/M |
| 3300032093|Ga0315902_10947206 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 655 | Open in IMG/M |
| 3300033979|Ga0334978_0133780 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1244 | Open in IMG/M |
| 3300033981|Ga0334982_0237527 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 882 | Open in IMG/M |
| 3300033996|Ga0334979_0110812 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1698 | Open in IMG/M |
| 3300033996|Ga0334979_0259765 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1000 | Open in IMG/M |
| 3300034019|Ga0334998_0150435 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1492 | Open in IMG/M |
| 3300034022|Ga0335005_0045414 | Not Available | 2982 | Open in IMG/M |
| 3300034022|Ga0335005_0177065 | Not Available | 1337 | Open in IMG/M |
| 3300034023|Ga0335021_0367304 | Not Available | 757 | Open in IMG/M |
| 3300034023|Ga0335021_0449503 | Not Available | 663 | Open in IMG/M |
| 3300034050|Ga0335023_0170636 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 1229 | Open in IMG/M |
| 3300034050|Ga0335023_0197761 | Not Available | 1125 | Open in IMG/M |
| 3300034050|Ga0335023_0474231 | Not Available | 651 | Open in IMG/M |
| 3300034051|Ga0335024_0120098 | Not Available | 1449 | Open in IMG/M |
| 3300034051|Ga0335024_0141113 | Not Available | 1316 | Open in IMG/M |
| 3300034051|Ga0335024_0141614 | Not Available | 1313 | Open in IMG/M |
| 3300034051|Ga0335024_0475256 | Not Available | 613 | Open in IMG/M |
| 3300034051|Ga0335024_0484834 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 605 | Open in IMG/M |
| 3300034051|Ga0335024_0610067 | Not Available | 521 | Open in IMG/M |
| 3300034060|Ga0334983_0228793 | Not Available | 1140 | Open in IMG/M |
| 3300034060|Ga0334983_0314700 | Not Available | 931 | Open in IMG/M |
| 3300034060|Ga0334983_0373480 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 830 | Open in IMG/M |
| 3300034060|Ga0334983_0457648 | Not Available | 723 | Open in IMG/M |
| 3300034060|Ga0334983_0781915 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 500 | Open in IMG/M |
| 3300034064|Ga0335001_0443175 | Not Available | 693 | Open in IMG/M |
| 3300034066|Ga0335019_0439140 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 790 | Open in IMG/M |
| 3300034103|Ga0335030_0369736 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 939 | Open in IMG/M |
| 3300034105|Ga0335035_0097188 | Not Available | 1900 | Open in IMG/M |
| 3300034105|Ga0335035_0581416 | Not Available | 597 | Open in IMG/M |
| 3300034107|Ga0335037_0061373 | Not Available | 2027 | Open in IMG/M |
| 3300034107|Ga0335037_0132913 | Not Available | 1357 | Open in IMG/M |
| 3300034107|Ga0335037_0274080 | Not Available | 920 | Open in IMG/M |
| 3300034107|Ga0335037_0369000 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 777 | Open in IMG/M |
| 3300034107|Ga0335037_0429269 | Not Available | 711 | Open in IMG/M |
| 3300034107|Ga0335037_0506825 | Not Available | 644 | Open in IMG/M |
| 3300034107|Ga0335037_0544204 | Not Available | 617 | Open in IMG/M |
| 3300034112|Ga0335066_0293829 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 922 | Open in IMG/M |
| 3300034116|Ga0335068_0123318 | Not Available | 1429 | Open in IMG/M |
| 3300034116|Ga0335068_0151922 | Not Available | 1250 | Open in IMG/M |
| 3300034116|Ga0335068_0161153 | Not Available | 1204 | Open in IMG/M |
| 3300034116|Ga0335068_0282354 | Not Available | 834 | Open in IMG/M |
| 3300034116|Ga0335068_0452885 | Not Available | 603 | Open in IMG/M |
| 3300034116|Ga0335068_0453408 | Not Available | 603 | Open in IMG/M |
| 3300034116|Ga0335068_0555756 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 523 | Open in IMG/M |
| 3300034119|Ga0335054_0434694 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 744 | Open in IMG/M |
| 3300034121|Ga0335058_0759243 | Not Available | 531 | Open in IMG/M |
| 3300034122|Ga0335060_0338297 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 812 | Open in IMG/M |
| 3300034166|Ga0335016_0245743 | Not Available | 1132 | Open in IMG/M |
| 3300034166|Ga0335016_0327458 | All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Cryptomonadaceae → Cryptomonas → Cryptomonas curvata | 925 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 50.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 11.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.88% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.44% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.44% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.63% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 1.63% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.81% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.81% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.81% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.81% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.81% |
| Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300000052 | Coal bed methane well microbial communities from Alberta, Canada | Engineered | Open in IMG/M |
| 3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
| 3300002369 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002370 | Freshwater microbial communities from Lake Mendota, WI - 03MAY2011 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002379 | Freshwater microbial communities from Lake Mendota, WI - 19NOV2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007955 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0um | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300010970 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016 | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012719 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020502 | Freshwater microbial communities from Lake Mendota, WI - 29OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020520 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020543 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020558 | Freshwater microbial communities from Lake Mendota, WI - 13OCT2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300027254 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034050 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095 | Environmental | Open in IMG/M |
| 3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034107 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200187169 | 2199352005 | Freshwater | QDLRDFINNNEIKILAGEKVEFPPQPDFIDLNIIY |
| Draft_0020631 | 3300000052 | Hydrocarbon Resource Environments | DFPIEYEQQLIIKKYRKDLREFINNNEIKILAGETVSWPEQPDFIDLYIVY* |
| TBL_comb47_HYPODRAFT_100645831 | 3300000553 | Freshwater | QMKIKEYRQALREFINNNKDNYLNGQAKIDFPPQPDFIELNIIY* |
| B570J29640_1058042 | 3300002369 | Freshwater | KAYRQELRDFINNNEIKILAGEKVEFPQQPDFINLNIIY* |
| B570J29631_1071792 | 3300002370 | Freshwater | LSDYPISLEHQMIIKTYRQDLREFINNNEVRILAGEKIEFPFQPDFINLNIIY* |
| B570J29633_1026221 | 3300002379 | Freshwater | IAYDQQLIIKKYRQELRDFINNNEIKILAGEKVEFPPQPDFIDLNIIY* |
| B570J29032_1090746361 | 3300002408 | Freshwater | MIIKAYRQELRDFINNNEIKILAGEKVEFPQQPDFINLNIIY* |
| B570J29032_1092315392 | 3300002408 | Freshwater | RQELRDFINNNEIKILAGEIVKFPEPPDFINLNILY* |
| B570J29032_1097709061 | 3300002408 | Freshwater | EQQMIIKKYRQDLRDFINNNEIKILSGEKVDWPNQPDFIDLNIIY* |
| Ga0031658_10577901 | 3300003860 | Freshwater Lake Sediment | TDKYILSDYPISLEHQMIIKTYRQDLREFINXNEVRILAGEKIEFPFQPDFINLNIIY* |
| Ga0102856_10414732 | 3300007636 | Estuarine | DYPITLEQQMQIKLYRQELREFININNELILTGAKVDYPIQPDFIDLNIIY* |
| Ga0105740_10663362 | 3300007955 | Estuary Water | DKYILSDYPITLEKQMIIKTYRQELRDFINNNEIKILAGEKVAFPQQPDFIDLNIIY* |
| Ga0114341_102568311 | 3300008108 | Freshwater, Plankton | QDLREFINNNEVRILAGEKIEFIIQPDFINLNIIY* |
| Ga0114344_10828981 | 3300008111 | Freshwater, Plankton | KYRKDLREFINNNEIKILAGETVSWPEQPDFIDLYIVY* |
| Ga0114351_14244612 | 3300008117 | Freshwater, Plankton | SDYPISLEHQMIIKTYRQDLREFINNNEVRILAGEKIEFPFQPDFINLNIIY* |
| Ga0114355_11968302 | 3300008120 | Freshwater, Plankton | YEQQMIIKKYRQDLRDFINKNEIKILAGEKVDFPPVPDFIDLNIIY* |
| Ga0114973_105206171 | 3300009068 | Freshwater Lake | KSKLIYMNEYITNTDQFLLSDYPISLEQQMIIIAYRQDIRNFINENKIKILAGEKIDFPPQPNFLNLNIIY* |
| Ga0114963_102852971 | 3300009154 | Freshwater Lake | IIKKYRQDLRNFINENEIKILAGEKVDFPKQPDFIDLNIIY* |
| Ga0114969_102072742 | 3300009181 | Freshwater Lake | MIIKTYRQDLRNFINDNKEKILNGEKIEFPKQPDFIDLNIIY* |
| Ga0114969_105397831 | 3300009181 | Freshwater Lake | QQLIIKDYRKNLRNFINENEIKILAGEKIEFPIQPDFIDLNIIY* |
| Ga0114971_107268621 | 3300009185 | Freshwater Lake | ARNIRSELLNKSDKYFLIDFPIGYEQQVINKKYRQDLRNFINENEIKILAGEKVDFPKQPDFIDLNIIY* |
| Ga0114972_106408891 | 3300009187 | Freshwater Lake | LIIKKYRQDLRNFINENEIKILAGEKVTWPEQPDFIDLNIIY* |
| Ga0136551_10607371 | 3300010388 | Pond Fresh Water | SLSQQIEIKTYRQDLRQFIDDNQERILNGEKVEFPPQPTFINLNIIY* |
| Ga0137575_100327251 | 3300010970 | Pond Fresh Water | FLIDYPIDHEQQNIIKIYRQELRDFININKEKILAGEKVEFPIKPDFIDLNIIY* |
| Ga0157599_10942532 | 3300012715 | Freshwater | LIDFPIEYEKQLIIKKYRQDLRDFINNNEIKILAGEKVEFPPQPDFIDLNIIY* |
| Ga0157600_11269742 | 3300012719 | Freshwater | FLIDYPVAYEQQMIIKKYRQDLRDFINNNEIKILAGEKVDFPPVPDFIDLNIIY* |
| Ga0157610_12724641 | 3300012725 | Freshwater | TDRYFLIDFPIEHEKQMIIKKYRQELRDFINENEIKILAGEKVEFPQQPDFIELNIIY* |
| Ga0157597_11372442 | 3300012726 | Freshwater | QQMIIKTYRQELREFINNNIELILTGAKLDFPKQPDFINLNIIY* |
| Ga0157602_10994541 | 3300012730 | Freshwater | KKYRQDLRDFINNNEIKILAGEKVEFPPVPDFIDLNIIY* |
| Ga0164293_104136602 | 3300013004 | Freshwater | IKAYRQELRDFINNNEIKILAGEKVEFPQQPDFIDLNIIY* |
| Ga0164293_107255232 | 3300013004 | Freshwater | IEYEKQMIIKKYRQDLREFINNNEIKILAGEKVEFPPQPDFIDLNIIY* |
| Ga0164293_107398561 | 3300013004 | Freshwater | QQMIVKTYRQELRDFINNYEIKILAGEKVAFPQQPDFIDLNIIY* |
| Ga0164293_109994691 | 3300013004 | Freshwater | MIIKTYRQDLRDFINNNEIKILAGEKVEFPTVPDFIDLNIIY* |
| Ga0164292_101239804 | 3300013005 | Freshwater | DYPIAYEQQIIIKTYRQVLRDFINNNEIKILAGEKVDFPEPPDFIDLNIIY* |
| Ga0164292_103112401 | 3300013005 | Freshwater | KKYRQDLRNFINENEIKILAGEKVELPIQPDFIELNIIY* |
| Ga0164292_104029201 | 3300013005 | Freshwater | TLEQQMIIKTYRQELREFINNNIELILTGAKIDFPKQPDFINLNIIY* |
| Ga0164292_109278551 | 3300013005 | Freshwater | AYEQQMIIKAYRQELRDFINNDEIKILAGEKVEFPQQPDFIDLNIVY* |
| Ga0164294_103497942 | 3300013006 | Freshwater | TLEQQMIIKTYRQELREFINNNEIKILAGEKVDFPPQPDFIDLNIIY* |
| Ga0170791_124682361 | 3300013295 | Freshwater | ILSDYPISLEQQMKIKEYRQALRKFINNNKDKYLNGQAQIDFPPQPDFIDLNIIY* |
| Ga0170791_137902991 | 3300013295 | Freshwater | QDLRNFINENEIKILAGEKIEFPIQPDFIDLNIIY* |
| Ga0170791_154109812 | 3300013295 | Freshwater | YPITLEQQNEIKEYRQKLREFINENEIKILTGEKVEFPKQPDFIDLNIIY* |
| Ga0211733_109776092 | 3300020160 | Freshwater | YEQQLIIKTYRQNLRDFINDNKERILNGDKIEMPKQPDFIDLNIIY |
| Ga0211735_100487721 | 3300020162 | Freshwater | QQIIIKSYRQELRDFINNNKEKILNGDKIDFPQQPDFIDLNIIY |
| Ga0211729_102665351 | 3300020172 | Freshwater | EQQMIIKLYRQDLREFININKEKILNGDKIDFPTQPDFIDLNIIY |
| Ga0211729_110533181 | 3300020172 | Freshwater | LIDYPIQYEQQNIIKAYRQELRDFINDNKERILNGDKIELPKQPDFIDLNIIY |
| Ga0208591_10136081 | 3300020493 | Freshwater | PIAYDQQMIIKAYRQELRDFINNNEIKLLAGEKVEFPIKPDFIDLNIIY |
| Ga0208087_10348351 | 3300020502 | Freshwater | QDLRDFINENEIKILAGEKVEWPKQPDFIDLNIIY |
| Ga0208481_10098471 | 3300020520 | Freshwater | LLNRTDRYFLIDYPIAYEQQMIIKTYRRELREFINNNKERILNGEKVDFPEQPNFIDLNIIY |
| Ga0208224_10075003 | 3300020528 | Freshwater | IKTYRQDLRDFINNYEIKLLAGEKVAFPQQPDFIDLNIIY |
| Ga0208089_10186081 | 3300020543 | Freshwater | IAYEQQMIIKKYRQDLRDFINNNEIKILAGEKVEFPPVPDFIDLNIIY |
| Ga0208362_10119481 | 3300020558 | Freshwater | DFPIEHEKQMIIKKYRQELRDFINENEIKILAGEKVEWPKQPDFIDLNIIY |
| Ga0208362_10187753 | 3300020558 | Freshwater | DFPIEHEKQMIIKKYRQELRDFINENEIKILAGEKVEWPKQPDFIELNIIY |
| Ga0208718_10237072 | 3300020565 | Freshwater | FLIDYPIAHDQQLIIKAYRQELRDFINNNEIKILAGEKVEFPEPPDFIDLNIIY |
| Ga0214162_10403222 | 3300021108 | Freshwater | LNRTDRYFLIDYPIAYEQQIIIKAYRQELRDFININKEKILNGDKIDFPTQPDFIDLNII |
| Ga0214162_10450432 | 3300021108 | Freshwater | TVYRQDLREFINNNEIKILSGDKVEFPPQPTFINLNIIY |
| Ga0208177_10521461 | 3300027254 | Estuarine | KTDKYILSDYPISLEHQMIIKTYRQDLREFINNNEVRILAGEKIEFIIQPDFINLNIIY |
| Ga0209392_11649251 | 3300027683 | Freshwater Sediment | KTYRQDLRDMINNNHEKFQAREPVLYPPIPDFIREHQV |
| Ga0209107_100936121 | 3300027797 | Freshwater And Sediment | EQQLIIKKYRQDLRNFINENKDLILAGNNEIKFPIPPDFIDLNIIY |
| Ga0209358_105044891 | 3300027804 | Freshwater Lake | DFPIEYEQQMIIKQYRQDLRDFINENEIKILAGEKVEWPKQPDFIDLNIIY |
| Ga0209358_105412492 | 3300027804 | Freshwater Lake | YILSDYPISLEHQMIIKTYRQDLREFINNNEVRILAGEKIEFIIQPDFINLNIIY |
| Ga0209230_103046532 | 3300027836 | Freshwater And Sediment | QDLREFINNNEVRILAGEKIEFIIQPDFINLNIIY |
| Ga0247722_100034759 | 3300028027 | Deep Subsurface Sediment | QIIIKSYRQELRDFINNNKEKILNGDKIEFPTPPDFIDLNIIY |
| Ga0247722_100997561 | 3300028027 | Deep Subsurface Sediment | YRQELREFININNELILTGAKVDYPIQPDFINLNIIY |
| Ga0247722_101319061 | 3300028027 | Deep Subsurface Sediment | LLNRTDRYILSDYPISLEQQMIIKAYRQDLRNFINDNKEKILNGEKIDFPPHPDFIDLNIIY |
| Ga0315899_104296671 | 3300031784 | Freshwater | QYEQQIRIKKYRQDLRNFINENEIKILAGEKVNFPTPPDFIDLNIIY |
| Ga0315899_106545681 | 3300031784 | Freshwater | YEKQMIIKKYRQDLRDFINNNEIKILAGEKVDWPDQPDFIDLNIIY |
| Ga0315899_107637122 | 3300031784 | Freshwater | MSLEHQMIIKTYRQDLREFINNNEVRILAGEKIEFPFQPDFINLNIIY |
| Ga0315899_114703781 | 3300031784 | Freshwater | IDYPIEYEKQMIIKKYRQDLRDFININEEKILSGQKIDFPTQPDFININILY |
| Ga0315908_101840781 | 3300031786 | Freshwater | DFPIGYEQQVIIKKYRKDLRDFINDNEIKILAGEKVDFPKQPDFIDLNIIY |
| Ga0315908_113678562 | 3300031786 | Freshwater | YILSDYPISLEQQMIIKTYRQELRQFINDNKEKILNGEKIDFPKQPDFLDLNIIY |
| Ga0315909_104689042 | 3300031857 | Freshwater | PIQYEQQIIIKKYRQDLRNFINNNEIKILAGEKVEFPIQPDFIELNIIY |
| Ga0315906_107673521 | 3300032050 | Freshwater | NKTDRYFLIDFPIEYEQQLIIKKYRKDLREFINNNEIKILAGETVSWPEQPDFIDLYIVY |
| Ga0315906_113094141 | 3300032050 | Freshwater | EYRQELREFINDNKEKILAGEKVEFPTQPDFIDLNIIY |
| Ga0315905_107678381 | 3300032092 | Freshwater | SYRQALRDCINVNKEKILSGQKLDFPTQPDFTNINILY |
| Ga0315902_109472061 | 3300032093 | Freshwater | DRYFLIDYPIAYEKQMIIKQYRQDLRDFINNNEIKILAGEKVEFPQQPDFIDLNIVY |
| Ga0334978_0133780_29_157 | 3300033979 | Freshwater | MIIKKYRQELRDFINENEIKILAGEKVEWPKQPDFIDLNIIY |
| Ga0334982_0237527_700_882 | 3300033981 | Freshwater | NKTDRYFLIDYPIAYEQQMIIKKYRQDLRDFINNNEIKILAGEKVEFPPQPDFIDLNIIY |
| Ga0334979_0110812_1518_1646 | 3300033996 | Freshwater | MIIKKYRQELRDFINENEIKILAGEKVEWPKQPDFIELNIIY |
| Ga0334979_0259765_3_125 | 3300033996 | Freshwater | IKKYRQDLRDFINNNEIKILAGEKVDFPPVPDFIDLNIIY |
| Ga0334998_0150435_1385_1492 | 3300034019 | Freshwater | QELRDFINNNEIKILAGEKVEFPPQPDFIDLNIIY |
| Ga0335005_0045414_2836_2964 | 3300034022 | Freshwater | MIIKAYRQELRDFINNNEIKILAGEKVEFPEQPNFINLNIIY |
| Ga0335005_0177065_1_162 | 3300034022 | Freshwater | LIDYPIAHDQQMIIKAYRQELRDFINNNEIKILAGEKVEFPQQPDFINLNIIY |
| Ga0335021_0367304_587_715 | 3300034023 | Freshwater | MEIKEYRQNLREFINENEIKILAGEKVEFPQQPDFIELNIIY |
| Ga0335021_0449503_2_169 | 3300034023 | Freshwater | YFLIDFPIEYEKQLIIKKYRQDLRDFINNNEIKILSGEKVEFPPQPDFIDLNIIY |
| Ga0335023_0170636_1103_1228 | 3300034050 | Freshwater | IIKNYRQELRDFININKEKILNGDKIDFPTQPDFIDLNIIY |
| Ga0335023_0197761_981_1109 | 3300034050 | Freshwater | LIIKAYRQELRDFINNNEIKILAGEIVKFPEPPDFINLNILY |
| Ga0335023_0474231_1_144 | 3300034050 | Freshwater | TLEQQMIIKTYRQELREFINNNTELILTGAKLDFPKQPDFINLNIIY |
| Ga0335024_0120098_32_160 | 3300034051 | Freshwater | MIIKAYRQELRDFINNNEIKILAGEKVEFPKQPDFIDLNIIY |
| Ga0335024_0141113_1204_1314 | 3300034051 | Freshwater | RQELRNFINNNEIKILAGEKVEFPTQPDFIDLNILY |
| Ga0335024_0141614_1191_1313 | 3300034051 | Freshwater | IKNYRQELRDFININKEKILNGDKIDFPTQPDFIDLNIIY |
| Ga0335024_0475256_471_611 | 3300034051 | Freshwater | YEQQVIIKKYRQDLRNFINENEIKILAGEKVDFPKQPDFIDLNIIY |
| Ga0335024_0484834_453_605 | 3300034051 | Freshwater | YPITLEQQMQIKLYRQELREFININNELILTGAKVDYPIQPDFIDLNIIY |
| Ga0335024_0610067_3_128 | 3300034051 | Freshwater | IIKAYRQDLRNFINDNKEKILNGEKIDFPPQPDFIDLNIIY |
| Ga0334983_0228793_2_109 | 3300034060 | Freshwater | QVLRDFINNNEIKILAGEKVDFPEPPDFLDLNIIY |
| Ga0334983_0314700_790_930 | 3300034060 | Freshwater | LDEQLIIKTYRQELRDFINNNEIKILAGEKVEFPQQPDFIDLNIVY |
| Ga0334983_0373480_674_802 | 3300034060 | Freshwater | MIIKTYRQDLREFINNNKERILNGEKVDLPEQPNFIDLNIIY |
| Ga0334983_0457648_613_723 | 3300034060 | Freshwater | RQELRDFINNYEIKILAGEKVAFPQQPDFIDFNIEY |
| Ga0334983_0781915_317_499 | 3300034060 | Freshwater | NKTDKYFLIDYPIHYEQQVIIKKYRQDLRNFINENEIKILAGEKPEFPKPPDFIDLNIIY |
| Ga0335001_0443175_2_118 | 3300034064 | Freshwater | KYRQDLRDFINENEIKILAGEKVDFPPQPDFIDLNIIY |
| Ga0335019_0439140_626_790 | 3300034066 | Freshwater | FLIDYPIAYEQQMIIKKYRQDLRDFINNNEIKILAGEKVEFPPQPDFIDLNIIY |
| Ga0335030_0369736_3_116 | 3300034103 | Freshwater | YRQDLRDFINNNEIKILAGEKVEFPPQPDFIDLNIIY |
| Ga0335035_0097188_1678_1824 | 3300034105 | Freshwater | MAYDKQLIIKAYRQELRDFINNNEIKILAGEIVKFPEPPDFINLNILY |
| Ga0335035_0581416_466_597 | 3300034105 | Freshwater | QIEIKAYRQDLRNFINDNKEKILNGEKIDFPPQPDFIDLNIIY |
| Ga0335037_0061373_1_138 | 3300034107 | Freshwater | ISLLLIKAYRQELRDFINNNEIKLLAGEKVEFPIKPDFIDLNIIY |
| Ga0335037_0132913_1_129 | 3300034107 | Freshwater | MIIKTYRQDLREFINNNEVRILAGEKIEFIIQPDFINLNIIY |
| Ga0335037_0274080_795_920 | 3300034107 | Freshwater | IIKAYRQELRDFINNNKDIILTGQILDFPKPPDFINLNIIY |
| Ga0335037_0369000_636_776 | 3300034107 | Freshwater | YEQQMIIKLYRQDLREFININKEKILNGDKLDFPVIPDFIDLNIIY |
| Ga0335037_0429269_548_709 | 3300034107 | Freshwater | LIDYPIAYEQQNTIKAYRQELRDFININKDKILNGDKIDFPTQPDFIDLNIIY |
| Ga0335037_0506825_495_623 | 3300034107 | Freshwater | MEIKAYRQDLRNFINDNKEKILNGEKIDFPPQPDFIDLNIIY |
| Ga0335037_0544204_492_617 | 3300034107 | Freshwater | IIKAYRQELRDFINNNEIKILAGEKVEFPQQPDFINLNIIY |
| Ga0335066_0293829_744_920 | 3300034112 | Freshwater | TDRYFLIDFPIEHEKQMIIKKYRQELRDFINENEIKILAGEKVEFPQQPDFIELNIIY |
| Ga0335068_0123318_1268_1429 | 3300034116 | Freshwater | LIDYPIAYEQQMIIKKYRQDLRDFINNNEIKILSGEKVDWPNQPDFIDLNIIY |
| Ga0335068_0151922_1129_1248 | 3300034116 | Freshwater | KTYRQELREFINNNKDIILTGQILDFPKPPDFINLNIIY |
| Ga0335068_0161153_1031_1204 | 3300034116 | Freshwater | DKYFLIDFPIAYEQQLIIKAYRQELRNFINNNEIKILAGEKVQFPQQPDFIDLNIIY |
| Ga0335068_0282354_725_832 | 3300034116 | Freshwater | DLRNFINENKDLILAGNNEIKFPQQPDFIDLNIIY |
| Ga0335068_0452885_490_603 | 3300034116 | Freshwater | YRQDLRNFINNNEIKILAGEKVEFPIQPDFIELNIIY |
| Ga0335068_0453408_426_602 | 3300034116 | Freshwater | TDKYFLIDFPIGYEQQVIIKKYRQDLRNFINENEIKILAGEKVDFPKQPDFIELNIIY |
| Ga0335068_0555756_375_521 | 3300034116 | Freshwater | MAYDKQLIIKAYRQELRDFINNNEIKILAGEIVKFPEPPDFIDLNIIY |
| Ga0335054_0434694_628_744 | 3300034119 | Freshwater | KYRQDLRDFINNNEIKILAGEKVEFPPIPDFIDLNIIY |
| Ga0335058_0759243_1_138 | 3300034121 | Freshwater | EQQLIIKAYRQELRNFINNNEIKILAGEKVAFPQQPDFIDFNIEY |
| Ga0335060_0338297_3_146 | 3300034122 | Freshwater | EYEKQLIIKKYRQDLRDFINNNEIKILAGEKVDFPPQPDFIDLNIIY |
| Ga0335016_0245743_948_1076 | 3300034166 | Freshwater | MIIKTYRQELREFINNNEIKILAGEKVDFPPVPDFIDLNIIY |
| Ga0335016_0327458_809_925 | 3300034166 | Freshwater | KYRQDLRDFINNNEIKILAGEKVDFPPIPDFIDLNIIY |
| ⦗Top⦘ |