| Basic Information | |
|---|---|
| Family ID | F069620 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 43 residues |
| Representative Sequence | NKRLGPVLAMIRDEQLRRGPERRSGPRRRDQRDARLFKVG |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 90.24 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.033 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.959 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.724 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.537 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 123 Family Scaffolds |
|---|---|---|
| PF13358 | DDE_3 | 6.50 |
| PF03819 | MazG | 3.25 |
| PF08241 | Methyltransf_11 | 3.25 |
| PF13744 | HTH_37 | 2.44 |
| PF07286 | D-Glu_cyclase | 2.44 |
| PF13701 | DDE_Tnp_1_4 | 1.63 |
| PF04072 | LCM | 1.63 |
| PF13551 | HTH_29 | 1.63 |
| PF13649 | Methyltransf_25 | 1.63 |
| PF00665 | rve | 0.81 |
| PF13817 | DDE_Tnp_IS66_C | 0.81 |
| PF03118 | RNA_pol_A_CTD | 0.81 |
| PF00239 | Resolvase | 0.81 |
| PF13384 | HTH_23 | 0.81 |
| PF17195 | DUF5132 | 0.81 |
| PF13560 | HTH_31 | 0.81 |
| PF02796 | HTH_7 | 0.81 |
| PF13167 | GTP-bdg_N | 0.81 |
| PF08484 | Methyltransf_14 | 0.81 |
| PF13231 | PMT_2 | 0.81 |
| PF01068 | DNA_ligase_A_M | 0.81 |
| PF01527 | HTH_Tnp_1 | 0.81 |
| PF04191 | PEMT | 0.81 |
| PF11149 | DUF2924 | 0.81 |
| PF05050 | Methyltransf_21 | 0.81 |
| PF05401 | NodS | 0.81 |
| PF13578 | Methyltransf_24 | 0.81 |
| PF05598 | DUF772 | 0.81 |
| PF13610 | DDE_Tnp_IS240 | 0.81 |
| PF05016 | ParE_toxin | 0.81 |
| PF03551 | PadR | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF00496 | SBP_bac_5 | 0.81 |
| PF13458 | Peripla_BP_6 | 0.81 |
| PF01996 | F420_ligase | 0.81 |
| PF00390 | malic | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
|---|---|---|---|
| COG4336 | Uncharacterized conserved protein YcsI, UPF0317/DUF1446 family | Function unknown [S] | 2.44 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.63 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 0.81 |
| COG0281 | Malic enzyme | Energy production and conversion [C] | 0.81 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.81 |
| COG1478 | F420-0:Gamma-glutamyl ligase (F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.81 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.81 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.81 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.81 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.81 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.81 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.81 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.81 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.03 % |
| Unclassified | root | N/A | 47.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005187|Ga0066675_10031445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3118 | Open in IMG/M |
| 3300005439|Ga0070711_100583783 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300005557|Ga0066704_10417677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 889 | Open in IMG/M |
| 3300005764|Ga0066903_104100589 | Not Available | 780 | Open in IMG/M |
| 3300005764|Ga0066903_108943559 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300009137|Ga0066709_100310323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2147 | Open in IMG/M |
| 3300009792|Ga0126374_11519343 | Not Available | 550 | Open in IMG/M |
| 3300010044|Ga0126310_11359690 | Not Available | 577 | Open in IMG/M |
| 3300010048|Ga0126373_12535716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum extorquens | 571 | Open in IMG/M |
| 3300010167|Ga0123353_12809918 | Not Available | 570 | Open in IMG/M |
| 3300010341|Ga0074045_10002669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 16419 | Open in IMG/M |
| 3300010359|Ga0126376_10088383 | Not Available | 2327 | Open in IMG/M |
| 3300010366|Ga0126379_10114403 | Not Available | 2434 | Open in IMG/M |
| 3300010398|Ga0126383_11531756 | Not Available | 756 | Open in IMG/M |
| 3300011271|Ga0137393_10486855 | Not Available | 1058 | Open in IMG/M |
| 3300012362|Ga0137361_11932047 | Not Available | 507 | Open in IMG/M |
| 3300012918|Ga0137396_10147054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1714 | Open in IMG/M |
| 3300012960|Ga0164301_10710849 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300012971|Ga0126369_12162511 | Not Available | 644 | Open in IMG/M |
| 3300012987|Ga0164307_11093945 | Not Available | 654 | Open in IMG/M |
| 3300012988|Ga0164306_10437028 | Not Available | 992 | Open in IMG/M |
| 3300014501|Ga0182024_11817328 | Not Available | 681 | Open in IMG/M |
| 3300016270|Ga0182036_10477643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300016294|Ga0182041_10212800 | Not Available | 1548 | Open in IMG/M |
| 3300016294|Ga0182041_10377126 | Not Available | 1200 | Open in IMG/M |
| 3300016294|Ga0182041_10804604 | Not Available | 840 | Open in IMG/M |
| 3300016319|Ga0182033_10562794 | Not Available | 986 | Open in IMG/M |
| 3300016319|Ga0182033_11099168 | Not Available | 710 | Open in IMG/M |
| 3300016319|Ga0182033_11532233 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300016357|Ga0182032_10112817 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
| 3300016357|Ga0182032_10821082 | Not Available | 787 | Open in IMG/M |
| 3300016371|Ga0182034_10390567 | Not Available | 1139 | Open in IMG/M |
| 3300016371|Ga0182034_10500896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 1013 | Open in IMG/M |
| 3300016387|Ga0182040_10017892 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3857 | Open in IMG/M |
| 3300016387|Ga0182040_10369082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. | 1118 | Open in IMG/M |
| 3300016387|Ga0182040_10817742 | Not Available | 769 | Open in IMG/M |
| 3300016387|Ga0182040_11612982 | Not Available | 553 | Open in IMG/M |
| 3300016445|Ga0182038_10235824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. HF4 | 1462 | Open in IMG/M |
| 3300016445|Ga0182038_10561174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Lichenicoccus → Lichenicoccus roseus | 981 | Open in IMG/M |
| 3300017942|Ga0187808_10404885 | Not Available | 624 | Open in IMG/M |
| 3300018006|Ga0187804_10310598 | Not Available | 688 | Open in IMG/M |
| 3300018085|Ga0187772_10673508 | Not Available | 740 | Open in IMG/M |
| 3300018090|Ga0187770_11570017 | Not Available | 536 | Open in IMG/M |
| 3300018431|Ga0066655_10442290 | Not Available | 858 | Open in IMG/M |
| 3300018482|Ga0066669_12395841 | Not Available | 506 | Open in IMG/M |
| 3300020581|Ga0210399_10254350 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1465 | Open in IMG/M |
| 3300021088|Ga0210404_10033673 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
| 3300021361|Ga0213872_10150572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
| 3300021362|Ga0213882_10332235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300021405|Ga0210387_10177384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1838 | Open in IMG/M |
| 3300021477|Ga0210398_11135449 | Not Available | 619 | Open in IMG/M |
| 3300021478|Ga0210402_10923533 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300021560|Ga0126371_13737394 | Not Available | 513 | Open in IMG/M |
| 3300022893|Ga0247787_1064917 | Not Available | 553 | Open in IMG/M |
| 3300025916|Ga0207663_10174036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Duganella | 1532 | Open in IMG/M |
| 3300025931|Ga0207644_10853500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 762 | Open in IMG/M |
| 3300026369|Ga0257152_1017561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300026990|Ga0207824_1038263 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300027035|Ga0207776_1005759 | Not Available | 1910 | Open in IMG/M |
| 3300027042|Ga0207766_1006209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1458 | Open in IMG/M |
| 3300027043|Ga0207800_1032818 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300027071|Ga0209214_1026636 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300027701|Ga0209447_10098392 | Not Available | 804 | Open in IMG/M |
| 3300027812|Ga0209656_10223154 | Not Available | 903 | Open in IMG/M |
| 3300027824|Ga0209040_10221381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 967 | Open in IMG/M |
| 3300027846|Ga0209180_10402226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 776 | Open in IMG/M |
| 3300027894|Ga0209068_10935023 | Not Available | 514 | Open in IMG/M |
| 3300031545|Ga0318541_10444564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae | 725 | Open in IMG/M |
| 3300031561|Ga0318528_10581664 | Not Available | 601 | Open in IMG/M |
| 3300031561|Ga0318528_10713962 | Not Available | 536 | Open in IMG/M |
| 3300031564|Ga0318573_10258977 | Not Available | 928 | Open in IMG/M |
| 3300031680|Ga0318574_10292491 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031681|Ga0318572_10092219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1698 | Open in IMG/M |
| 3300031708|Ga0310686_102191830 | Not Available | 725 | Open in IMG/M |
| 3300031719|Ga0306917_10264130 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1322 | Open in IMG/M |
| 3300031736|Ga0318501_10509828 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300031744|Ga0306918_11516548 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031744|Ga0306918_11582467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300031768|Ga0318509_10199572 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300031779|Ga0318566_10341709 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300031779|Ga0318566_10600960 | Not Available | 536 | Open in IMG/M |
| 3300031797|Ga0318550_10339240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 728 | Open in IMG/M |
| 3300031819|Ga0318568_10586846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 694 | Open in IMG/M |
| 3300031835|Ga0318517_10526179 | Not Available | 532 | Open in IMG/M |
| 3300031879|Ga0306919_10083263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2211 | Open in IMG/M |
| 3300031879|Ga0306919_10167530 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1615 | Open in IMG/M |
| 3300031879|Ga0306919_10550093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 890 | Open in IMG/M |
| 3300031879|Ga0306919_11137666 | Not Available | 594 | Open in IMG/M |
| 3300031879|Ga0306919_11230008 | Not Available | 568 | Open in IMG/M |
| 3300031890|Ga0306925_10543796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1232 | Open in IMG/M |
| 3300031890|Ga0306925_12014185 | Not Available | 544 | Open in IMG/M |
| 3300031893|Ga0318536_10134867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
| 3300031893|Ga0318536_10255891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300031897|Ga0318520_10297372 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300031912|Ga0306921_11997617 | Not Available | 618 | Open in IMG/M |
| 3300031942|Ga0310916_11453794 | Not Available | 560 | Open in IMG/M |
| 3300031945|Ga0310913_11265767 | Not Available | 512 | Open in IMG/M |
| 3300031946|Ga0310910_10460479 | Not Available | 1009 | Open in IMG/M |
| 3300031947|Ga0310909_10067191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2806 | Open in IMG/M |
| 3300031947|Ga0310909_10741389 | Not Available | 814 | Open in IMG/M |
| 3300031954|Ga0306926_10588032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1360 | Open in IMG/M |
| 3300031954|Ga0306926_12934268 | Not Available | 511 | Open in IMG/M |
| 3300032001|Ga0306922_10168981 | All Organisms → cellular organisms → Bacteria | 2343 | Open in IMG/M |
| 3300032042|Ga0318545_10006501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3382 | Open in IMG/M |
| 3300032042|Ga0318545_10026789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1868 | Open in IMG/M |
| 3300032042|Ga0318545_10200496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae | 714 | Open in IMG/M |
| 3300032051|Ga0318532_10116437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300032052|Ga0318506_10305812 | Not Available | 705 | Open in IMG/M |
| 3300032055|Ga0318575_10216568 | Not Available | 963 | Open in IMG/M |
| 3300032059|Ga0318533_10278328 | Not Available | 1211 | Open in IMG/M |
| 3300032059|Ga0318533_10596411 | Not Available | 811 | Open in IMG/M |
| 3300032063|Ga0318504_10261762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
| 3300032063|Ga0318504_10471570 | Not Available | 601 | Open in IMG/M |
| 3300032066|Ga0318514_10143873 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300032076|Ga0306924_10394707 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1584 | Open in IMG/M |
| 3300032091|Ga0318577_10126840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → unclassified Roseomonas → Roseomonas sp. HF4 | 1207 | Open in IMG/M |
| 3300032091|Ga0318577_10418607 | Not Available | 640 | Open in IMG/M |
| 3300032094|Ga0318540_10344276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 720 | Open in IMG/M |
| 3300032261|Ga0306920_101824111 | Not Available | 857 | Open in IMG/M |
| 3300032261|Ga0306920_102936481 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300032898|Ga0335072_10232185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 2144 | Open in IMG/M |
| 3300033289|Ga0310914_10526734 | Not Available | 1068 | Open in IMG/M |
| 3300033289|Ga0310914_11168524 | Not Available | 671 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.25% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.44% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.63% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.81% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Host-Associated | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026369 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-A | Environmental | Open in IMG/M |
| 3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027043 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066675_100314451 | 3300005187 | Soil | KRLGPVLAMIRDQQLRRGPQRRSEPRRRDQRDARLFKVG* |
| Ga0070711_1005837831 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ADNKRLGPVLAMIRDEQLRRGPERRSAKAPRRRDQRDTDLFKVG* |
| Ga0066704_104176771 | 3300005557 | Soil | TIADNKRLGSVLAMIRDEQLRREPKRRSGPRRRDQRDARLFKVG* |
| Ga0066903_1041005892 | 3300005764 | Tropical Forest Soil | GAALAFIRDQQLRREPERRSDRAPRRRDQHNARLFKVG* |
| Ga0066903_1089435591 | 3300005764 | Tropical Forest Soil | VDQGAIADNKHLGAVLAMIRDEQLRRGLRRRSGPRRRDQRDARLFKVG* |
| Ga0066709_1003103231 | 3300009137 | Grasslands Soil | AALTFIREEQLRREPQRRSTKAPRRRDQHDARLFKVG* |
| Ga0126374_115193432 | 3300009792 | Tropical Forest Soil | QVNQGAIADNKRLGPVLAMIRDEQQRRGPERRSGPRRRDQLDVRLFKVG* |
| Ga0126310_113596902 | 3300010044 | Serpentine Soil | KRLGAVLACIREQQIARAEPRSKKAPRRRDQSDARLFKVG* |
| Ga0126373_125357161 | 3300010048 | Tropical Forest Soil | RRVDQGAIADNKRLGSVLAMIRDEQLRREPERRSGPRRRDQRDARLFKVG* |
| Ga0123353_128099181 | 3300010167 | Termite Gut | ENKHLGAALAFIRQEQLRREPERRSGPRRRDQRDTRLFKVG* |
| Ga0074045_100026691 | 3300010341 | Bog Forest Soil | DNKRLGPLLAMIRDQQLRRELERRSGPRRRDQRDARLFKDG* |
| Ga0126376_100883831 | 3300010359 | Tropical Forest Soil | AVLTMIRNEQLRRGPERRSGPRRRDQRPARLFKVG* |
| Ga0126379_101144031 | 3300010366 | Tropical Forest Soil | NKHLGAVLTMIRNEQLRRGPERRSGPRRRDQRPARLFKVG* |
| Ga0126383_115317561 | 3300010398 | Tropical Forest Soil | ENKQLGAVLAFIREEQLRRGPAQRSGPRRRDQSDPRLFKVG* |
| Ga0137393_104868551 | 3300011271 | Vadose Zone Soil | DNKRLGAVLAMIRNQQLRRGSEGRSGPRRHDQRDARLFKVG* |
| Ga0137361_119320472 | 3300012362 | Vadose Zone Soil | QVDQGVIADNKRLGPLLAMIRDEQLRRGPQHRSGPRRRDQRDAHLFKVG* |
| Ga0137396_101470541 | 3300012918 | Vadose Zone Soil | GAIADNKRLGAVLAMIRDQQQRCEPGHRSQRAPRRRDQRDARLFKVG* |
| Ga0164301_107108492 | 3300012960 | Soil | AALAFIRDQQLRREPERRSGPRRRDQRDARLFKVG* |
| Ga0126369_121625112 | 3300012971 | Tropical Forest Soil | VEIGGRDLRQVPAKQTAIVENKHLGAALAFIRDQQLRRELERRSGPRRRDQRDARLFKVG |
| Ga0164307_110939452 | 3300012987 | Soil | ADNKRLGPVLAMIRDEQLRRGPERRSGPRRRDQRDARLFKVG* |
| Ga0164306_104370281 | 3300012988 | Soil | VDQGAIADNKRLGPVLAMIRDEQLRRGPERRSGPRRRDQRDARLFKVG* |
| Ga0182024_118173282 | 3300014501 | Permafrost | AALALIREQQIERAERRSTKAPRRRDQRDARLFKVG* |
| Ga0182036_104776431 | 3300016270 | Soil | DQGAIADNKRLGPILAMIRDGQLRRGPERRSGRRRRDQRDTRLFKVR |
| Ga0182041_102128001 | 3300016294 | Soil | AVIVENKQLGAALAFIREQQLRRGPERRSGPRRPDQRDARLFKVG |
| Ga0182041_103771261 | 3300016294 | Soil | DQGAIADNKRLGPVLAMIRDEQLRRGPQRRSGPRRRDQRDARLFKVG |
| Ga0182041_108046042 | 3300016294 | Soil | ENKQLGAALAFIRDQQLRREPEHHSDRAPRRRDQHNSRLIRVG |
| Ga0182033_105627942 | 3300016319 | Soil | VDQGAIADNKRLGPVLAMIRDEQLRRGPERRSGPRRRDQRDARLFKVG |
| Ga0182033_110991681 | 3300016319 | Soil | ADNKRLGPILAMIRDEQLRRGPERRSGPRRRDQRDARRFKIG |
| Ga0182033_115322331 | 3300016319 | Soil | GVIADNKHLAAALTMIRNEQLRRGPERRSGPRRRDQRDTRLFKVGRLL |
| Ga0182032_101128171 | 3300016357 | Soil | IADNKHLGAVLAMIRDEQLRRGPPHRRSGSRRRDQRDARLFKVG |
| Ga0182032_108210822 | 3300016357 | Soil | GAALTFIREEQLRREPQRRSTGAPRRRDQRGARLFKVG |
| Ga0182034_103905672 | 3300016371 | Soil | LGAALTFIREEQLRREPQRRSTGAPRRRDQRGARLFKVG |
| Ga0182034_105008962 | 3300016371 | Soil | QGAIADNKRLGAVLTMIRDEQLRRGPQRRSGPRRRDQRDARLFKVG |
| Ga0182040_100178921 | 3300016387 | Soil | PVLAMIRDEQLRRGPERRTGPRRRDQRDARLFKVG |
| Ga0182040_103690821 | 3300016387 | Soil | QVDQGAIADNKHLGAVLTMIRDEQRRRGPRPRSGPRRRDQRLFKVG |
| Ga0182040_108177423 | 3300016387 | Soil | VELAYRTSDKIRQVSQAVIVDNKQLGAALAFIREQQLRRGPERRSGPRRRDQRDARLFKV |
| Ga0182040_116129822 | 3300016387 | Soil | IVENKQLGAALAFIREQQLRRGPERRSGPRRRDQRDARLFKVG |
| Ga0182038_102358241 | 3300016445 | Soil | VDQGAIADNKRLGAVLAMIRDEQLRRGSKGRSGPRRRDQRDARLFKVG |
| Ga0182038_105611742 | 3300016445 | Soil | SQAAIVENKQLGAALAFIREEQLRREPKRRSGPRRRDQHNPRLFKVG |
| Ga0187808_104048852 | 3300017942 | Freshwater Sediment | QAAIVENKQLGAALAFIREEKLRREPERRSGPRRRDQRDARLFKVG |
| Ga0187804_103105981 | 3300018006 | Freshwater Sediment | LGAALAFIREQQLRREPLRRSTKAPRRRDQRDVRLFKVG |
| Ga0187772_106735081 | 3300018085 | Tropical Peatland | KLRHVPQAAISENKRLGAALAFIREQQIERAEARRRDQRDARLFKVG |
| Ga0187770_115700172 | 3300018090 | Tropical Peatland | GAIADNKQLGAVLAMIRDNQLRRGTERRSGPRRRDQRDARLFKVG |
| Ga0066655_104422901 | 3300018431 | Grasslands Soil | QVDQGAIADRKRLGAVLAMIRDEQLQRGPERRSGPRRRDQRDARLFKVG |
| Ga0066669_123958411 | 3300018482 | Grasslands Soil | NKRLGAILAMIRDEQLRRGSKGRSGPRRRDQRDARFFKVG |
| Ga0210399_102543501 | 3300020581 | Soil | RSARSTGAIADNKRLGPLLAMIRDQQQRCEPGHRSQRAPRRRDQRDARLFKVG |
| Ga0210404_100336731 | 3300021088 | Soil | DQGAIADNKQLGPVLAMIRDEQLRRGPERRSGPRRRDQRDVRLFKVG |
| Ga0213872_101505722 | 3300021361 | Rhizosphere | AAGAVLAMIRDKQLRRGTEQRSGPRRRDQRDARLFKVG |
| Ga0213882_103322352 | 3300021362 | Exposed Rock | AAIIDNKHLGAALALIRDQQLRREPERRSGPRRRDQRDARLFKVG |
| Ga0210387_101773841 | 3300021405 | Soil | LGPVLAMIRDEQLRRGPERRSGPRRRDQRDARLFKVG |
| Ga0210398_111354491 | 3300021477 | Soil | VSQASIVENKQLGAALAFIRDQQLSREPEHRSDRAPRRRDQHNPRLFKVG |
| Ga0210402_109235332 | 3300021478 | Soil | EVEPSPNKRLGAALTFIREEQLRREPQRRSTKAPHRRDQRDARLFKVG |
| Ga0126371_137373942 | 3300021560 | Tropical Forest Soil | AVLAMVRDKQLRRGTEQRSGPRRRDQRDARLFKVG |
| Ga0247787_10649171 | 3300022893 | Soil | LGAVLAVIREQQIARAEPRSKKAPRRRDQSDARLFKVG |
| Ga0207663_101740364 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | NKRLGPVLAMIRDEQLRRGPERRSAKAPRRRDQRDTDLFKVG |
| Ga0207644_108535002 | 3300025931 | Switchgrass Rhizosphere | KRLGAVLAFIREQQIARAEPRSRKAPRRRDQRDARLFKVG |
| Ga0257152_10175611 | 3300026369 | Soil | LGAVLAMIRDQQQRCEPGHRSQRAPRRRDQRDARLFKVG |
| Ga0207824_10382632 | 3300026990 | Tropical Forest Soil | VEQGAIADNKQLGAVLTMIRDKQLRRGTEQRSGPRRRDQRDARLFKVG |
| Ga0207776_10057591 | 3300027035 | Tropical Forest Soil | ADNKHLGAVLAVIRDEQLRRGPQRRSGPRRRDQRDARLFKVG |
| Ga0207766_10062091 | 3300027042 | Tropical Forest Soil | LGAVLTMIRDKQLRRGTEQRSGPRRRDQRDARLFKVG |
| Ga0207800_10328182 | 3300027043 | Tropical Forest Soil | NKRLGPILAMIRDEQLRRGPERRSGPRRRDQHNSRLFKVG |
| Ga0209214_10266362 | 3300027071 | Forest Soil | GAIADNKRLGAVLAMIRDQQLGREPQHRSQRAPRRRDQRDARLFKVG |
| Ga0209447_100983921 | 3300027701 | Bog Forest Soil | AALAFIREQQIERAETRSAKAPRRRDQPDARLFKVG |
| Ga0209656_102231541 | 3300027812 | Bog Forest Soil | LGPILAMIRDEQLRRSPERRSGPRRRDQRDARLFKVG |
| Ga0209040_102213811 | 3300027824 | Bog Forest Soil | ENKRLGAALAFIREEQLRREPQGRSTKAPRRRDHRDARLFKVG |
| Ga0209180_104022262 | 3300027846 | Vadose Zone Soil | DKRLGSALAMIRDEQLRRGSERRSGPRRRDQRDARLLKVG |
| Ga0209068_109350231 | 3300027894 | Watersheds | QGAIVENKQLGAALAFIREEQLRRGPGRRSGPRRRDQRDARLFKVG |
| Ga0318541_104445642 | 3300031545 | Soil | AAIVENKHLGAALAFIREQQLRRGSETRSGPRRRDQRDARLFKVG |
| Ga0318528_105816641 | 3300031561 | Soil | KHLGAVLAMISDEKLRRGLRRRCGPRRHDQRDARLFKVG |
| Ga0318528_107139621 | 3300031561 | Soil | AIADNKRLGAVWAVIRDGQLHRGPQRRSGPRRRDRHDARLFKVG |
| Ga0318573_102589771 | 3300031564 | Soil | KQLGAVLAMIRDKQRWHGTEQRSGPRRRDQRDARLFKVG |
| Ga0318574_102924911 | 3300031680 | Soil | HLGAVLAMIRDEQLRRGPSRRSGPRRRDQRDARLFKVG |
| Ga0318572_100922191 | 3300031681 | Soil | ICHVDQGAIADNKRLGPVLAMIRDEQLRRGHEPRSGPRRRDQRNARLFKVG |
| Ga0310686_1021918301 | 3300031708 | Soil | RLRAVLTFIRDEQLRRQPLRRSTKAPRRRDQHDPRLLKVG |
| Ga0306917_102641304 | 3300031719 | Soil | KHLGAALAFIREQQLRRGSETRSGPRRRDQRDARLFKVG |
| Ga0318501_105098281 | 3300031736 | Soil | AALAFIREEQLRRGPAQRSGPRRRDQSDPRLFKVG |
| Ga0306918_115165481 | 3300031744 | Soil | VDQGAIADNKHLGAVLAMIRDEQLRRGPPHRRSGSRRRDQRDARLFKVG |
| Ga0306918_115824671 | 3300031744 | Soil | KHLGAVLAMIRDEQLRRGPQRRSGPRRRDQRDARLFKVG |
| Ga0318509_101995721 | 3300031768 | Soil | KHLGAVLAVIHDEQLRHGLQRRSGPRRRDQRDARLFKVG |
| Ga0318566_103417091 | 3300031779 | Soil | VRHIDQGAIADNKHLGVVLTMIRDEQLRRGPQRRSGPPRRDQRDARLFKVG |
| Ga0318566_106009601 | 3300031779 | Soil | AIIDNKWLGAALAFIREQQIERAEVRSTKAPRRRDQRDARLFKVG |
| Ga0318550_103392402 | 3300031797 | Soil | NKRLGPILAMIRDEQLRRGTERRSGPRRRDQRDARLFKVG |
| Ga0318568_105868462 | 3300031819 | Soil | GAIADNKQLGAVLAMIRDKQRWHGTEQRSGPRRRDQRDARLFKVG |
| Ga0318517_105261791 | 3300031835 | Soil | ADNKRLGPVLAMIRDEQLRRGHEPRSGPRRRDQRNARLFKVG |
| Ga0306919_100832631 | 3300031879 | Soil | VENKHLGAALAFIREQQLRRGSETRSGPRRRDQRDARLFKVG |
| Ga0306919_101675303 | 3300031879 | Soil | CTFDKSRQVDQGAIADNKHLGAVLAMIRDEQLRGPQRRSGPRRRDQRDAHLFKVG |
| Ga0306919_105500931 | 3300031879 | Soil | IIENKHLGAALALIRDQQLRREPERRSGPRRRDQRDARLFKVG |
| Ga0306919_111376662 | 3300031879 | Soil | IVENKRLGAALAFIREEQLRRGPQRRGTKAPRRRDQRDPRLFKVG |
| Ga0306919_112300082 | 3300031879 | Soil | VVYKRLGAALAFIREEQLRRGPERRSGPRRRDQHDPRLFKVG |
| Ga0306925_105437963 | 3300031890 | Soil | LGAVLAMIRDEQLRRGPQRRSGPRRRDQRDARLFKVG |
| Ga0306925_120141851 | 3300031890 | Soil | VENKRLGAALTFIREEQLRREPSRRSMKAPRRRDQRDARLFKVG |
| Ga0318536_101348672 | 3300031893 | Soil | KRLGPVLAMIRDEQLRRGPERRSGPRRRDQRDARLFKVG |
| Ga0318536_102558912 | 3300031893 | Soil | FDKVRHIDQGAIADNKHLGVVLTMIRDEQLRRGPQRRSGPPRRDQRDARLFKVG |
| Ga0318520_102973721 | 3300031897 | Soil | GAIADNKRLGAVWAVIRDGQLHRGPQRRSGPRRRDRHDARLFKVG |
| Ga0306921_119976172 | 3300031912 | Soil | ADNKHLGAVLAMIRDEQLRRGPQRRSGPRRRDQRDARLFKVG |
| Ga0310916_114537942 | 3300031942 | Soil | DNKHLGAVLAMIREEQLRRGPERRSERAPCRRDQRNARLFKVG |
| Ga0310913_112657671 | 3300031945 | Soil | ENKHLGAALAFIRDQQLRREPEHRSNRAPRRRDQRDARLFKIG |
| Ga0310910_104604792 | 3300031946 | Soil | VTQAAIVENKQLGAALAFIRDQQLRRKPERRSGPRRRDQRDARLFKVG |
| Ga0310909_100671917 | 3300031947 | Soil | ENKRLGAALTFIREEQLRREPSRRSMKAPRRRDQRDARLFKVG |
| Ga0310909_107413891 | 3300031947 | Soil | KRLGAALTFIRDEQLRREPQRRSTGAPRRRDQRGARLFKVG |
| Ga0306926_105880324 | 3300031954 | Soil | NKRLGAVLAMIRDQQLQRQPEHRSTKAPRRHDQQNARLFKVG |
| Ga0306926_129342682 | 3300031954 | Soil | QVDQGAIADNKHMGAVLAMISDEQLRRGPQRRSGPCRRDQRDARLLKVG |
| Ga0306922_101689811 | 3300032001 | Soil | FDKIRQVSQAVIVENKQLGAALAFIREQQLRRGPERRSGPRRRDQRDARLFKVG |
| Ga0318545_100065016 | 3300032042 | Soil | HVDQGAIADNKHLGAVLAMIRDEQLRRGPQPRSGPRRRDQGDARLFKVG |
| Ga0318545_100267891 | 3300032042 | Soil | NKRLGPVLAMIRDEQLRRGPERRSGPRRRDQRDARLFKVG |
| Ga0318545_102004962 | 3300032042 | Soil | GPILAMIRDEQLRRGTERRSGPRRRDQRDARLFKVG |
| Ga0318532_101164371 | 3300032051 | Soil | RLGAALTFIREAQLRREPPRRSMKAPRRRDQRDARLFKVG |
| Ga0318506_103058121 | 3300032052 | Soil | AIADNKRLGPVLAMIRDEQLRRGPERRSGPRRRDQRDARLFKVG |
| Ga0318575_102165681 | 3300032055 | Soil | NKRLGPVLAMIRDEQLRRGPLRRSGPRRRDQRDARLFKVG |
| Ga0318533_102783283 | 3300032059 | Soil | AVIVDNKQLGAALAFIREQQLRRGPERRSGPRRRDQRDARLFKVG |
| Ga0318533_105964111 | 3300032059 | Soil | IADNKRLGPVLAMIRDEQLRRGPQRRSGPRRRDQRDARLFKVG |
| Ga0318504_102617623 | 3300032063 | Soil | GAIADNKRLGPVLAMIRDEQLRRGHEPRSGPRRRDQRNARLFKVG |
| Ga0318504_104715701 | 3300032063 | Soil | RLGPILAMIRDEQLRRGTERRSGPRRRDQRDARLFKVG |
| Ga0318514_101438732 | 3300032066 | Soil | LGAVLAMIRDEQLRRGPPHRRSGSRRRDQRDARLFKVG |
| Ga0306924_103947071 | 3300032076 | Soil | AALAFIREEQLRRGPERRSAKATRRHDQSDTRLFKVG |
| Ga0318577_101268401 | 3300032091 | Soil | NKQLGAALAFIREEQPRREPERRSGPRRRDQRDARLFKVG |
| Ga0318577_104186071 | 3300032091 | Soil | AAIIENKHLGAALALIRDQQLRREPERRSGPRRRDQRDARLFKVG |
| Ga0318540_103442762 | 3300032094 | Soil | GPILAMIRDEQLRRGPERRSGPRRRDQRDARRFKIG |
| Ga0306920_1018241112 | 3300032261 | Soil | KHLGAALAFIRDQQLRREPEHRSNRAPRRRDQRDARLFKIG |
| Ga0306920_1029364811 | 3300032261 | Soil | KRLGAVLGMIRDEQLRRGPERRSGPRRRDQRDVRLFKVG |
| Ga0335072_102321856 | 3300032898 | Soil | LGAALAFIRDQQLRRQPERRSGPRRRDQHDAHLFKVG |
| Ga0310914_105267343 | 3300033289 | Soil | GAIADNKHLGAVLAIIREEQLRRGPERRSGPRRRDQRDARLFKVG |
| Ga0310914_111685241 | 3300033289 | Soil | LAMIREEQLRRGPERRSERAPCRRDQRNARLFKVG |
| ⦗Top⦘ |