| Basic Information | |
|---|---|
| Family ID | F069618 |
| Family Type | Metagenome |
| Number of Sequences | 123 |
| Average Sequence Length | 56 residues |
| Representative Sequence | YPILGSSQPEGLSFVACPDRSGSSDALGEFANGYDRVESGSVVHDGVGKALL |
| Number of Associated Samples | 63 |
| Number of Associated Scaffolds | 123 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 48.74 % |
| % of genes near scaffold ends (potentially truncated) | 82.11 % |
| % of genes from short scaffolds (< 2000 bps) | 96.75 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.106 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.561 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.561 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (97.561 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.11 % |
| All Organisms | root | All Organisms | 30.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009148|Ga0105243_11988568 | Not Available | 615 | Open in IMG/M |
| 3300013297|Ga0157378_12036627 | Not Available | 624 | Open in IMG/M |
| 3300014745|Ga0157377_11410452 | Not Available | 550 | Open in IMG/M |
| 3300015267|Ga0182122_1022598 | Not Available | 693 | Open in IMG/M |
| 3300015267|Ga0182122_1068077 | Not Available | 511 | Open in IMG/M |
| 3300015268|Ga0182154_1042190 | Not Available | 590 | Open in IMG/M |
| 3300015268|Ga0182154_1063131 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 526 | Open in IMG/M |
| 3300015269|Ga0182113_1039373 | Not Available | 660 | Open in IMG/M |
| 3300015269|Ga0182113_1046381 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 630 | Open in IMG/M |
| 3300015269|Ga0182113_1077158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 541 | Open in IMG/M |
| 3300015269|Ga0182113_1083683 | Not Available | 527 | Open in IMG/M |
| 3300015269|Ga0182113_1087413 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 520 | Open in IMG/M |
| 3300015274|Ga0182188_1038985 | Not Available | 570 | Open in IMG/M |
| 3300015275|Ga0182172_1039694 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 610 | Open in IMG/M |
| 3300015276|Ga0182170_1038817 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 615 | Open in IMG/M |
| 3300015276|Ga0182170_1056532 | Not Available | 553 | Open in IMG/M |
| 3300015277|Ga0182128_1037064 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 627 | Open in IMG/M |
| 3300015277|Ga0182128_1042599 | Not Available | 603 | Open in IMG/M |
| 3300015279|Ga0182174_1049978 | Not Available | 592 | Open in IMG/M |
| 3300015279|Ga0182174_1068068 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 540 | Open in IMG/M |
| 3300015281|Ga0182160_1030321 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 672 | Open in IMG/M |
| 3300015282|Ga0182124_1055727 | Not Available | 565 | Open in IMG/M |
| 3300015282|Ga0182124_1071694 | Not Available | 524 | Open in IMG/M |
| 3300015283|Ga0182156_1029185 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 693 | Open in IMG/M |
| 3300015283|Ga0182156_1038199 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 642 | Open in IMG/M |
| 3300015285|Ga0182186_1057338 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 562 | Open in IMG/M |
| 3300015285|Ga0182186_1080404 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 508 | Open in IMG/M |
| 3300015287|Ga0182171_1023917 | Not Available | 730 | Open in IMG/M |
| 3300015287|Ga0182171_1086789 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 505 | Open in IMG/M |
| 3300015288|Ga0182173_1070797 | Not Available | 534 | Open in IMG/M |
| 3300015289|Ga0182138_1059363 | Not Available | 568 | Open in IMG/M |
| 3300015289|Ga0182138_1068779 | Not Available | 544 | Open in IMG/M |
| 3300015294|Ga0182126_1015502 | Not Available | 848 | Open in IMG/M |
| 3300015295|Ga0182175_1042787 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 645 | Open in IMG/M |
| 3300015295|Ga0182175_1051171 | Not Available | 613 | Open in IMG/M |
| 3300015296|Ga0182157_1091651 | Not Available | 522 | Open in IMG/M |
| 3300015296|Ga0182157_1102689 | Not Available | 503 | Open in IMG/M |
| 3300015298|Ga0182106_1052426 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 618 | Open in IMG/M |
| 3300015298|Ga0182106_1080513 | Not Available | 543 | Open in IMG/M |
| 3300015299|Ga0182107_1086806 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 533 | Open in IMG/M |
| 3300015299|Ga0182107_1087259 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 532 | Open in IMG/M |
| 3300015300|Ga0182108_1032955 | Not Available | 716 | Open in IMG/M |
| 3300015300|Ga0182108_1069975 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 574 | Open in IMG/M |
| 3300015300|Ga0182108_1092278 | Not Available | 526 | Open in IMG/M |
| 3300015302|Ga0182143_1063918 | Not Available | 585 | Open in IMG/M |
| 3300015302|Ga0182143_1089140 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 528 | Open in IMG/M |
| 3300015303|Ga0182123_1022004 | Not Available | 768 | Open in IMG/M |
| 3300015304|Ga0182112_1086369 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 536 | Open in IMG/M |
| 3300015305|Ga0182158_1071682 | Not Available | 565 | Open in IMG/M |
| 3300015305|Ga0182158_1078994 | Not Available | 548 | Open in IMG/M |
| 3300015305|Ga0182158_1090532 | Not Available | 526 | Open in IMG/M |
| 3300015307|Ga0182144_1084086 | Not Available | 545 | Open in IMG/M |
| 3300015307|Ga0182144_1084618 | Not Available | 544 | Open in IMG/M |
| 3300015308|Ga0182142_1069286 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 589 | Open in IMG/M |
| 3300015314|Ga0182140_1038910 | Not Available | 700 | Open in IMG/M |
| 3300015321|Ga0182127_1063441 | Not Available | 623 | Open in IMG/M |
| 3300015322|Ga0182110_1036766 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 730 | Open in IMG/M |
| 3300015322|Ga0182110_1074694 | Not Available | 591 | Open in IMG/M |
| 3300015322|Ga0182110_1107888 | Not Available | 526 | Open in IMG/M |
| 3300015323|Ga0182129_1063958 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 603 | Open in IMG/M |
| 3300015323|Ga0182129_1092342 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 540 | Open in IMG/M |
| 3300015341|Ga0182187_1089463 | Not Available | 671 | Open in IMG/M |
| 3300015341|Ga0182187_1162896 | Not Available | 543 | Open in IMG/M |
| 3300015341|Ga0182187_1178825 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 524 | Open in IMG/M |
| 3300015342|Ga0182109_1138664 | Not Available | 603 | Open in IMG/M |
| 3300015342|Ga0182109_1166668 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 563 | Open in IMG/M |
| 3300015342|Ga0182109_1220467 | Not Available | 505 | Open in IMG/M |
| 3300015343|Ga0182155_1128787 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 619 | Open in IMG/M |
| 3300015343|Ga0182155_1140882 | Not Available | 599 | Open in IMG/M |
| 3300015344|Ga0182189_1216567 | Not Available | 513 | Open in IMG/M |
| 3300015345|Ga0182111_1109322 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 685 | Open in IMG/M |
| 3300015346|Ga0182139_1081245 | Not Available | 766 | Open in IMG/M |
| 3300015351|Ga0182161_1070317 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 847 | Open in IMG/M |
| 3300015351|Ga0182161_1138979 | Not Available | 653 | Open in IMG/M |
| 3300015351|Ga0182161_1164341 | Not Available | 611 | Open in IMG/M |
| 3300015351|Ga0182161_1164361 | Not Available | 611 | Open in IMG/M |
| 3300015351|Ga0182161_1170555 | Not Available | 603 | Open in IMG/M |
| 3300015351|Ga0182161_1247928 | Not Available | 518 | Open in IMG/M |
| 3300015355|Ga0182159_1230416 | Not Available | 605 | Open in IMG/M |
| 3300015355|Ga0182159_1311161 | Not Available | 530 | Open in IMG/M |
| 3300015361|Ga0182145_1145405 | Not Available | 555 | Open in IMG/M |
| 3300015361|Ga0182145_1156851 | Not Available | 541 | Open in IMG/M |
| 3300017404|Ga0182203_1108138 | Not Available | 577 | Open in IMG/M |
| 3300017407|Ga0182220_1070343 | Not Available | 569 | Open in IMG/M |
| 3300017407|Ga0182220_1072359 | Not Available | 565 | Open in IMG/M |
| 3300017407|Ga0182220_1094955 | Not Available | 522 | Open in IMG/M |
| 3300017409|Ga0182204_1111569 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 513 | Open in IMG/M |
| 3300017410|Ga0182207_1165415 | Not Available | 513 | Open in IMG/M |
| 3300017410|Ga0182207_1178617 | Not Available | 500 | Open in IMG/M |
| 3300017411|Ga0182208_1050297 | Not Available | 674 | Open in IMG/M |
| 3300017411|Ga0182208_1060087 | Not Available | 639 | Open in IMG/M |
| 3300017413|Ga0182222_1041682 | Not Available | 645 | Open in IMG/M |
| 3300017420|Ga0182228_1102038 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 548 | Open in IMG/M |
| 3300017420|Ga0182228_1111146 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 531 | Open in IMG/M |
| 3300017424|Ga0182219_1032210 | Not Available | 794 | Open in IMG/M |
| 3300017425|Ga0182224_1103456 | Not Available | 586 | Open in IMG/M |
| 3300017425|Ga0182224_1122269 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 556 | Open in IMG/M |
| 3300017430|Ga0182192_1100139 | Not Available | 609 | Open in IMG/M |
| 3300017430|Ga0182192_1117082 | Not Available | 577 | Open in IMG/M |
| 3300017433|Ga0182206_1113886 | Not Available | 560 | Open in IMG/M |
| 3300017433|Ga0182206_1140729 | Not Available | 523 | Open in IMG/M |
| 3300017433|Ga0182206_1142086 | Not Available | 521 | Open in IMG/M |
| 3300017436|Ga0182209_1055371 | Not Available | 724 | Open in IMG/M |
| 3300017436|Ga0182209_1122378 | Not Available | 564 | Open in IMG/M |
| 3300017438|Ga0182191_1071956 | Not Available | 687 | Open in IMG/M |
| 3300017442|Ga0182221_1127214 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 552 | Open in IMG/M |
| 3300017442|Ga0182221_1154310 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 518 | Open in IMG/M |
| 3300017680|Ga0182233_1066142 | Not Available | 645 | Open in IMG/M |
| 3300017682|Ga0182229_1085381 | Not Available | 551 | Open in IMG/M |
| 3300017683|Ga0182218_1077819 | Not Available | 621 | Open in IMG/M |
| 3300017683|Ga0182218_1097059 | Not Available | 580 | Open in IMG/M |
| 3300017683|Ga0182218_1138138 | Not Available | 520 | Open in IMG/M |
| 3300017683|Ga0182218_1140605 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 517 | Open in IMG/M |
| 3300017683|Ga0182218_1150878 | Not Available | 505 | Open in IMG/M |
| 3300017684|Ga0182225_1144319 | Not Available | 502 | Open in IMG/M |
| 3300017689|Ga0182231_1065949 | Not Available | 684 | Open in IMG/M |
| 3300017689|Ga0182231_1119089 | Not Available | 516 | Open in IMG/M |
| 3300017690|Ga0182223_1087123 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 556 | Open in IMG/M |
| 3300017690|Ga0182223_1121111 | Not Available | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 97.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0105243_119885681 | 3300009148 | Miscanthus Rhizosphere | GVGMSCVRYPILSFSQPEGLSFVACPDRSVLSDALGEFANGYDRAESESIVRDGVGIALL |
| Ga0157378_120366272 | 3300013297 | Miscanthus Rhizosphere | GVSGVRYLILGSSQPEGLSFVACPDRSGSSDALGEFANGCDRAESGSVVRDGVGIALL* |
| Ga0157377_114104521 | 3300014745 | Miscanthus Rhizosphere | LSFSQPQGLSFVACLDRSGLSDALGELANGYDRVKSGSVVHDGVDIALLWHSTAPLLITR |
| Ga0182122_10225981 | 3300015267 | Miscanthus Phyllosphere | LSYVRYPVLGFSQPEGLSFVACLDRSGSSDALCELANKYDQVESGSVVHDGVDTA |
| Ga0182122_10680771 | 3300015267 | Miscanthus Phyllosphere | MCYPILGFSQPEGLSFVPCSNRSGSSDALSEFANGYDRVESRSVVHDGVGIAL |
| Ga0182154_10421901 | 3300015268 | Miscanthus Phyllosphere | VSGVRYIILSSSQPEGLSFVACPDCSGSSDALGEFANGYDRVESRSVVCDGVGIALL* |
| Ga0182154_10631311 | 3300015268 | Miscanthus Phyllosphere | LVGVGLSFVRYPALDFSQLKGLRFVACVDGSGSIDTLGELANGYDRVESGSIICDGVGVALM* |
| Ga0182113_10393731 | 3300015269 | Miscanthus Phyllosphere | VSCVRYLILGSSQPEGLSFIACPDRSGSSDALGEFANGYERVESGSIVHDGVG |
| Ga0182113_10463811 | 3300015269 | Miscanthus Phyllosphere | GLSFVHYPILGFSQPEGLTFVACLDRSSSSDALGELANGYDRVESRSIISDGVGIALL* |
| Ga0182113_10771581 | 3300015269 | Miscanthus Phyllosphere | RAPLGLVGVGLSFVCYSILGFSQLEGLSFVTCLDRLGSSDALGEFANGCDRVESGSIVHDGVGIALL* |
| Ga0182113_10836831 | 3300015269 | Miscanthus Phyllosphere | PEPCWSLVGVGLSCVRYPVLDFSQPEGLSFVPYPNGSGSSDAHGEFANGCDRVESRSIVRDGVGIALL* |
| Ga0182113_10874131 | 3300015269 | Miscanthus Phyllosphere | APEPCWALVGVSVSCVRYPILGSSQPEGLSFVACPDRSGSSDALAKLANRHIRVKSRSIVRDGVSIALM* |
| Ga0182188_10389851 | 3300015274 | Miscanthus Phyllosphere | MCVYPILGSSQLEGLSFVACPDRSGSSDVFGEFTNGYDRAESGSIIRDRVGIALL |
| Ga0182172_10396941 | 3300015275 | Miscanthus Phyllosphere | LLGLVGVGLSFVRYPILGFSQLEGLSFVACLDHSGSSDALDELTNGYDRVESGSIVHDGVSIALL* |
| Ga0182170_10371661 | 3300015276 | Miscanthus Phyllosphere | LEGLSFVACPDRSGSSDALGELANGYDRVESASVVCDGVSIALL* |
| Ga0182170_10388171 | 3300015276 | Miscanthus Phyllosphere | YPVLGSSESEGLSFVACPDRSGSSDVLGEFANRYDRVESGSIVRDGVSIALL* |
| Ga0182170_10565321 | 3300015276 | Miscanthus Phyllosphere | APEPRGALVGVGLRYVRYPVLSFSQPEGLSFVACRDRSGSSDALGEFANGCDQVESRSIVRDGVGIALL* |
| Ga0182128_10370641 | 3300015277 | Miscanthus Phyllosphere | VSSVRYPVLGSSQPKGLSFFACPDCPGSSDVLGEFANGYDRVESGSVVRDGVGIALL* |
| Ga0182128_10425991 | 3300015277 | Miscanthus Phyllosphere | YPILGSSQLEGLSFVACPDRSGSSDALDEFANGYDRVEFGFVIRDRVGIAFL* |
| Ga0182174_10499781 | 3300015279 | Miscanthus Phyllosphere | PILGSSQPEGLSFVSCLDRSGSSDALGEIANGYDRVESGSIVHDRVGIALL* |
| Ga0182174_10680681 | 3300015279 | Miscanthus Phyllosphere | VSGVRYLILGSSQLEGLSFVVCPVRSGSSDALGEFANGYDRVESGSVVRDRVGIALL |
| Ga0182160_10303211 | 3300015281 | Miscanthus Phyllosphere | PEGLSFVPCPDRSGSSDALGEFTNGHDRVESGSVVQDGVSIALL* |
| Ga0182124_10557271 | 3300015282 | Miscanthus Phyllosphere | GSSQPEGLSFVAYPDRSGSSDALGEFANGCDRAKSGAVVHDGVGIVLL* |
| Ga0182124_10716941 | 3300015282 | Miscanthus Phyllosphere | VSYVRYPILGSSQLEGLSFVACPDRLGSSDALGEFTNGYDRVESGSVVHDEVGIALL* |
| Ga0182156_10291851 | 3300015283 | Miscanthus Phyllosphere | ILSFSQPEGLSFVACLNHSGLSDALGELANGYDRVESRSVIHDGVGIALF* |
| Ga0182156_10381991 | 3300015283 | Miscanthus Phyllosphere | LGLVGVSLSFVRYPILGFSQSEGLSFVTCLDRSGSNDALGELANGYDRVESRSVVRGGVGIALMWHFTAP* |
| Ga0182186_10573381 | 3300015285 | Miscanthus Phyllosphere | GSSQPEGLSFVACPDRSGSSDALGEFANGYDRVESRSVVHDGVGIALL* |
| Ga0182186_10804041 | 3300015285 | Miscanthus Phyllosphere | SPRAPLGLVGVDLSFVRYPILGFSQPEGLSFVACLDRLGLSNALGELANGYDRVESGSIVRDGVGIALL* |
| Ga0182171_10239171 | 3300015287 | Miscanthus Phyllosphere | LSCVRYPVLGFSQPEGLSFVACLDRSSLSDALSELANGYDRVEFGSIVHNRVDIALLWHSTALLPSTQQM |
| Ga0182171_10867891 | 3300015287 | Miscanthus Phyllosphere | QLEGLSFVTCPDRSSSSDALGEFVNGYDRAESGSIIRNGVGIALL* |
| Ga0182173_10707971 | 3300015288 | Miscanthus Phyllosphere | VSCVRYPILGSSQLEGLSFVACPDRLSSSDALSEFANGYDRVGSGSVVCDGV |
| Ga0182138_10593631 | 3300015289 | Miscanthus Phyllosphere | VSCVRYPVLGSSQPEGLSFVACPDRLSSSDALSEFANGYDRVGSGSVVCDGVS |
| Ga0182138_10687791 | 3300015289 | Miscanthus Phyllosphere | RYPILGSSQPEGLSFVACPDRSGSSDALGEFANGCDRAESGSVIRDGVSIALW* |
| Ga0182126_10155022 | 3300015294 | Miscanthus Phyllosphere | GVHYLILGSSQPEGLSFVACPDRSGSSDALGEFANGYDRVESRSVVRDRVGIALL* |
| Ga0182175_10427871 | 3300015295 | Miscanthus Phyllosphere | SFVRYPILSFSQLVGLSFVTCLDGSGSSDVLGELANGYDRVESGSVVHDGVGIGLL* |
| Ga0182175_10511711 | 3300015295 | Miscanthus Phyllosphere | VSDVRYLILVSSQPEGMSFVACPDRSGSSDTLGEFANGYDRMESGFVVRDEVGITL |
| Ga0182157_10916511 | 3300015296 | Miscanthus Phyllosphere | VSYVRYPILGSSKPEGLSFVACPDRSGSSDVLGELANGYDRAESGSVI |
| Ga0182157_11026891 | 3300015296 | Miscanthus Phyllosphere | MGLIGAGLSFVCYPILGFSQPKGLSFVICLDRLGLSDALGELANEYDRVESGSIIRNGVS |
| Ga0182106_10524262 | 3300015298 | Miscanthus Phyllosphere | VCLSCVNYLIPGFSQPEGLSFVPCPDHLGSSDALDEFANGYDRVESRSVVRDEVGIALL* |
| Ga0182106_10805131 | 3300015298 | Miscanthus Phyllosphere | MRYLVLGFSQPEGLSFVACLDRSGLSDALGELANGYDRVKSRSVVHDGVG |
| Ga0182107_10868061 | 3300015299 | Miscanthus Phyllosphere | LVLGFSQPKGLSFVPCPDLSGSSDALGEFANGYDRVESGSVVHDGIGIALL* |
| Ga0182107_10872591 | 3300015299 | Miscanthus Phyllosphere | VSSAPEPHWALVGVGLSCVHYPILSFSQLEGLSFVACPDRSGLSDALGELANGYDRVESGSVVHDGVGIALL* |
| Ga0182108_10329551 | 3300015300 | Miscanthus Phyllosphere | LSFVRYPVLGFSQPEGLSFVACLVGSGSSDALGELANGYDRVKSGSVVRDEVGITLL* |
| Ga0182108_10699751 | 3300015300 | Miscanthus Phyllosphere | GFSQLEGLSFVPCPDRSGLSDALCEFANGYDRVESGSVICDEVGIALL* |
| Ga0182108_10922781 | 3300015300 | Miscanthus Phyllosphere | LGLVGVGLSFVRYPILGFSQPEGLSFVACLDRSGSSDALGELANGYDRVESGFVVHDGVGIALL* |
| Ga0182143_10639181 | 3300015302 | Miscanthus Phyllosphere | VRYPVLGFSQPEGLSFVTCLDHSGLSDALGELANRYDRVESRSIVRDRVGIALL* |
| Ga0182143_10891401 | 3300015302 | Miscanthus Phyllosphere | VGVSCVRYPILGSSQLEGLSFVACPDRSGSSDALDEFANGYDRVESGSVICDGVSVALL* |
| Ga0182123_10170001 | 3300015303 | Miscanthus Phyllosphere | RGALVGVGLRYVRYPVLSFSQPEGLSFVACLDRSGSSDALGEFANGYDRVESGSVVHDRIDIALLWHSTAPLPATR* |
| Ga0182123_10220041 | 3300015303 | Miscanthus Phyllosphere | PILGSSQPEELSFVACPDRSSSSDALGEFANGYDRAEFESVVRDGVGIVLL* |
| Ga0182112_10863691 | 3300015304 | Miscanthus Phyllosphere | MRYPILGFSQSEGLSFVACLDRSGSSDALSELANAYDQVEYGSVVHDGVGIALIWHSTTP |
| Ga0182158_10716821 | 3300015305 | Miscanthus Phyllosphere | VSCVRYPILGSSQSEGLSFVACPDHSGSSDALGELANLYDRAESGSIIRDGVGIALL* |
| Ga0182158_10789941 | 3300015305 | Miscanthus Phyllosphere | PRWALVGVGLSCVRYPVLGFSQPEGLSFIGCLDCSGSSDALGELANEYDRVESRSVVHDGVGIALL* |
| Ga0182158_10905321 | 3300015305 | Miscanthus Phyllosphere | VRYPILGSSQPEGLSFVACPDRSGSSDVLGEFANWYDRVEFGSVVRDGVGMALL* |
| Ga0182144_10840861 | 3300015307 | Miscanthus Phyllosphere | MGLVGVGLSFVRYPILGFSQLEGLSFVACLDRSGLSDALGELANGYDRVESGSVIRDGVGIALL* |
| Ga0182144_10846181 | 3300015307 | Miscanthus Phyllosphere | VRYPILGFSQLEGLSFVPCPDHLGSSDSLGELANRYDQVESGSIIHDG |
| Ga0182142_10692862 | 3300015308 | Miscanthus Phyllosphere | MGLIGAGLSFVRYPILGFSQLEGLSFVACLDHSGLSDALSELANGYDRVESGSVVRDGVGIAHL* |
| Ga0182140_10389101 | 3300015314 | Miscanthus Phyllosphere | VSYVRYPILGASQPKGLSFVACPDHLGSSDALSEFTNGCDRAESGFVVHDGVGIALL |
| Ga0182127_10634411 | 3300015321 | Miscanthus Phyllosphere | LSFVRYPILGFSQLEGLSFVACLDHLGSSDALDELANGYDLVESGFVVYDGVGIALL* |
| Ga0182110_10367661 | 3300015322 | Miscanthus Phyllosphere | VSGVHYPILDFSQPEGLSFVPCPDRSGSSDALSEFANGYDRVESGSVIRDGVGIALL* |
| Ga0182110_10746941 | 3300015322 | Miscanthus Phyllosphere | LGLVGVSLSFVRYPILGFSQPEGLSFVACLDRSGSSDALSELTNGYDRGESGSIVHDRVGKPSCDIPL |
| Ga0182110_11078881 | 3300015322 | Miscanthus Phyllosphere | ALSDLSRCWCEFCVRYPILGFSQLEGLSFVACLDRSGSSDVLGEFANGYDRVKSGSVVHDGVSIALL* |
| Ga0182129_10639581 | 3300015323 | Miscanthus Phyllosphere | LVGVSLSCVRYPILGFSQPEGLSFVACLDRSGSSDALGELANGYDQVESGSVICDGVGIALL* |
| Ga0182129_10923421 | 3300015323 | Miscanthus Phyllosphere | WALVGVGVSCVCYPILGSSQPKGLSFVASPDRSGSSDTLGEFANGYDQVESGSVICDRVGIALL* |
| Ga0182187_10894631 | 3300015341 | Miscanthus Phyllosphere | PLGLVGVDLSFVHYPILGFSQIEGLSFVACLNRSGSSDTLSELANGYDRVESGSVVHDGVGRALL* |
| Ga0182187_11628961 | 3300015341 | Miscanthus Phyllosphere | LSCVHYLILGFSPPERLSFVACLDRSGSSDVLSEVANGYDRVESGSFVRDGVDIAL |
| Ga0182187_11788251 | 3300015341 | Miscanthus Phyllosphere | YPILGSSQPEGLSFVACPDRSSSSDALGEFTNRYDRVESGSVIHDGVGIALL* |
| Ga0182187_11870131 | 3300015341 | Miscanthus Phyllosphere | VRYPILGSSQPEGLSFVSCLDRSGSSDALGEIANGYDRVESGFVVH |
| Ga0182109_11386641 | 3300015342 | Miscanthus Phyllosphere | PLGLVRVGLSCVRYPILGFSQLEGLRFVTCLDRLGLSDVLSELANGYDRVESMSVIRDGVGIALL* |
| Ga0182109_11666681 | 3300015342 | Miscanthus Phyllosphere | VGVGLSCVCYPILGFSQLEGLSFVACPNCSGLSDVLSEFANRYDRVESGSIVHDGVGIALL* |
| Ga0182109_12204671 | 3300015342 | Miscanthus Phyllosphere | ALVGVGLSCVRYPVLGFSQPEGLSFVACPNRSGLNDALGEFANGYDRVESGSVIHDGVGIALL* |
| Ga0182155_11287871 | 3300015343 | Miscanthus Phyllosphere | MPHWALVGVGLSYVRYPILGFSQSEGLSFVAYLDRSGLSDALGELANGYDRVESRSIVRDGVGIALL* |
| Ga0182155_11408821 | 3300015343 | Miscanthus Phyllosphere | MVGVSLSCVSYPILSSSQLEGLSFVACLDHSGLSDTLGELANRYDRVESRSVVRDGVG |
| Ga0182189_12165672 | 3300015344 | Miscanthus Phyllosphere | LGFSQPEGLSFVTCLDRLGSSDVLGELANGYDRVESGSVIRDEVGIALL* |
| Ga0182111_11093221 | 3300015345 | Miscanthus Phyllosphere | VSCVRYPILRSSQPEGLSFVACPDRSGTSDALGEFANGCDRVESGSIIHDGVGIALL |
| Ga0182139_10812451 | 3300015346 | Miscanthus Phyllosphere | LSFVHYSVLGLSQPEGLSFVAFLDRSSLSDVLGELANGYDRVESGSVIRDGVGIT |
| Ga0182161_10703171 | 3300015351 | Miscanthus Phyllosphere | LGLVGVGLSFVRYPVLGFSQPEGLSFVACLVGSGSRDALGELANGYDRVKSGSVVRDEVGITLL* |
| Ga0182161_11389791 | 3300015351 | Miscanthus Phyllosphere | SFVRYPVLGFSQPEGLSFVAFLDRSGSSDVLGELTNGYDRMESEFVVRDEVGIALL* |
| Ga0182161_11643412 | 3300015351 | Miscanthus Phyllosphere | VSYVRYPILGSSQPEGLSFVACPDRSGSSDALGEFANGCDRVESRSVLRDGVDIA |
| Ga0182161_11643611 | 3300015351 | Miscanthus Phyllosphere | VRYPVLGFSQPEGLSFVACLDRSGSSDALGEFPNGYDRVESGSVVRDRVGIALL |
| Ga0182161_11705551 | 3300015351 | Miscanthus Phyllosphere | VSCVRYPILGSSQPEGLSFVACPDRSGSSDALGEFANGYDRVEYGSVIHD |
| Ga0182161_12479281 | 3300015351 | Miscanthus Phyllosphere | VSCVRYPVLGSSQPEGLSFVACPDRSGSSDALGEFTNGYDRAKSGSIIHD |
| Ga0182159_12304161 | 3300015355 | Miscanthus Phyllosphere | VSCVRYPVLGSSQPEGLSFIACPDRSGSSDALGDFTNGYDRVESGSVVHDGVG |
| Ga0182159_13111611 | 3300015355 | Miscanthus Phyllosphere | MLDSLQPEGLSFVACPDRSGSSDALGEFANGCDRVESESVVRDGVGIALV* |
| Ga0182145_11454051 | 3300015361 | Miscanthus Phyllosphere | WLLVGVGLSCVCYPILDFSQPEGLSFIPCPDRSSSSDALSEFANGYDRVESGPVVHDGVGIALL* |
| Ga0182145_11568511 | 3300015361 | Miscanthus Phyllosphere | VGFSCVRYPILSFSQPEGLSFVTCPDRSGSSDALGEFTNGYDRVEFESVVRDGVDIALL* |
| Ga0182203_11081381 | 3300017404 | Miscanthus Phyllosphere | MRYPILDFSQPEGLSFVACLDRSGLSDALGELANGSDRVEFGSVVHDGV |
| Ga0182220_10703431 | 3300017407 | Miscanthus Phyllosphere | LVGVSLSFVRYPILGFSQPEWLSFVACLDRSSFSDVLDELSNGYDRVESRSVVRDGVG |
| Ga0182220_10723591 | 3300017407 | Miscanthus Phyllosphere | VRYLVLGFSQLEGLSFVAWLDRLGLSDVLDELTNGYDRVEFGSVVCDGVGIALL |
| Ga0182220_10949551 | 3300017407 | Miscanthus Phyllosphere | PILDSSQPEELSFVASPDRLGSSDALGEFTNGYDRAESRSIICDRVSIALL |
| Ga0182204_11115691 | 3300017409 | Miscanthus Phyllosphere | VSCVRYPIIGSSQPEGLSFVSCPYRLGSSDAISEFANRYDRVESRSVVFDGVGIAL |
| Ga0182207_11654151 | 3300017410 | Miscanthus Phyllosphere | VSCVRYPILGSSHLEGLSFVACPDRSGLSDALGEFANGCDRAESGSVVHDGV |
| Ga0182207_11786171 | 3300017410 | Miscanthus Phyllosphere | LSYVRYPFLGFSQPEGLSFVACLDRSGSSDALGKLANGYDRVEFESVVRDGVDIVLL |
| Ga0182208_10502971 | 3300017411 | Miscanthus Phyllosphere | PILGSSQPEGLSFVACPDRSGLSDTLGEFANRCDRVEFGSVVHDGVDIALL |
| Ga0182208_10600871 | 3300017411 | Miscanthus Phyllosphere | VRYPILGSSQPEGLSFVACPDRSGSSDALGEFANGYDRVESGFIVHDRVG |
| Ga0182222_10416821 | 3300017413 | Miscanthus Phyllosphere | LVGVGLSCVHYLILGFSPPERLSFVACLDRSGSSDALSELANGYERVESGSVVRDGVRIALTNDGPGFHSFIPVSE |
| Ga0182228_11020381 | 3300017420 | Miscanthus Phyllosphere | MGLIGAGLSFVRYPVLGFSQLEGLSFVACLDHSGLSDALSELANGYDRVESGSIVRDGVGIALL |
| Ga0182228_11111462 | 3300017420 | Miscanthus Phyllosphere | ALLGLSRVGVSFVHYPVLGFSQPEGLNFVACPIRSGSSDVLGEFANRYDRVESRSIVHEGVDIALL |
| Ga0182219_10322101 | 3300017424 | Miscanthus Phyllosphere | VRYPILDSSQPEGLSFVACPDRSGSSDMLGEFANGYDRVESGSVVHDR |
| Ga0182224_11034561 | 3300017425 | Miscanthus Phyllosphere | VSCVRYPVIGSSQSKGLSFVACPDRSGSSDVLGEFANGYDRVESGSVVRDGVGI |
| Ga0182224_11222691 | 3300017425 | Miscanthus Phyllosphere | VSYVRYRILGSSQLKGLSFVACPDRSGSSDTLGEFANGYDRVESWSVVRDGVSIALL |
| Ga0182192_11001391 | 3300017430 | Miscanthus Phyllosphere | VLSFSQLGGLSFVACPDRSGSSDTLSEFANGYDRVESGSVVRDGVGIAIL |
| Ga0182192_11170821 | 3300017430 | Miscanthus Phyllosphere | VSCVRYPILGSSQPEGLSFVACPDRSGSSDVLGEFANECDRVESGSVVHDGV |
| Ga0182206_11138862 | 3300017433 | Miscanthus Phyllosphere | FSQLEGLSFVPCPDRSGLSDALCEFANGYDRVESGSVICDEVGIALL |
| Ga0182206_11407291 | 3300017433 | Miscanthus Phyllosphere | YPILGSSQPEGLSFVACPDCLGSSDALGEFANGYDRAESGSVIHDEVSIAHL |
| Ga0182206_11420861 | 3300017433 | Miscanthus Phyllosphere | VRYPVLGFSQLEELSFVPCPDRSGLSDALGEFTNGYDRVESGSVIHDGVSIALL |
| Ga0182206_11581661 | 3300017433 | Miscanthus Phyllosphere | SQPEELSFVVCPDRSGSSDALSEFANGYDRVESGSVVHDGADIVLL |
| Ga0182209_10553711 | 3300017436 | Miscanthus Phyllosphere | VSCVRYPVLGSSQPEGLSFVACPDRLGSSDALGEFANRYDQVESGSVVHDGVDI |
| Ga0182209_11223781 | 3300017436 | Miscanthus Phyllosphere | MRYPILGFSQSEGLSFVACLDRSGSSDTLGELANGYGLVESGSIVRDGVGIALLXHSTAL |
| Ga0182191_10719561 | 3300017438 | Miscanthus Phyllosphere | VSCVCYPVLDSSQPEGLSFVACPDRSGLTDALGEFANGYDRVESGFVVHDRVSIVLL |
| Ga0182221_11272141 | 3300017442 | Miscanthus Phyllosphere | YPILGSSQPEGLSFVACPDRSGSSDALGEFANGYDRVESGSVVHDGVGKALL |
| Ga0182221_11543101 | 3300017442 | Miscanthus Phyllosphere | LGFSQPEGLSFVACLDRSGLSDALSELANGYDRVESGSVVRDGVGIVLL |
| Ga0182233_10661421 | 3300017680 | Miscanthus Phyllosphere | VSCVRYPILGSSQPEGLSFVVCPDRSGSSDTLGEFTNGYDRAEFGSVIHDGV |
| Ga0182229_10853812 | 3300017682 | Miscanthus Phyllosphere | MGVDVSIVRYPILGSSQPERLSFVACPDRLGSNDALGEFTNGCDRVESRSIVHDR |
| Ga0182218_10778191 | 3300017683 | Miscanthus Phyllosphere | YPILGFSQPEGLSFVACLDRSGSSDALGEFANRYDRVESGSIVHDGVGIALL |
| Ga0182218_10970591 | 3300017683 | Miscanthus Phyllosphere | LGSSQSEGLSFVACPDRSGSSDALGEFANGYDRAESGSVVRDEVGIALL |
| Ga0182218_11381381 | 3300017683 | Miscanthus Phyllosphere | YPILGSSQSEGLSFVACPDRSGSSDALGEFTNGYDRAESGFVVRDGVGIALL |
| Ga0182218_11406051 | 3300017683 | Miscanthus Phyllosphere | GLSCVRYPILSFSQPEGLSFVPCPDHSGSSDALSEFANGCDRVESGSIVRDGVGIALL |
| Ga0182218_11508781 | 3300017683 | Miscanthus Phyllosphere | LSCVHYLVLGFSQLEGLSFVACPDRSGLSDALSEFANGYDRVESGSVIPDGVGIAL |
| Ga0182225_11443191 | 3300017684 | Miscanthus Phyllosphere | VRYSVLGFSQPEGLNFVAYPDRSGSSDEAGEFANGYDRVESGSIVRDG |
| Ga0182231_10659491 | 3300017689 | Miscanthus Phyllosphere | VRYPILGSSQLEGLSFVACPNRSCLSDALGEFANGCDRVEFGFVVHDGVGIDLL |
| Ga0182231_11190891 | 3300017689 | Miscanthus Phyllosphere | GLSCVRYPILSFSQPEGMSFVPCPDRSGSSDALGEFANGYDRVESGSVVHDRVGIALL |
| Ga0182223_10871231 | 3300017690 | Miscanthus Phyllosphere | LSCVRYPVLGFSQLEGLSFVACLDRSGSSDALGELANGYDRVESRSVVRNGVGIAL |
| Ga0182223_11211111 | 3300017690 | Miscanthus Phyllosphere | FSQPEGLSFVTCPVRSSSSDALGELANGYDRVESGSVIHDRVGIALL |
| ⦗Top⦘ |