Metagenome Family F069561

Basic Information
Family ID	F069561
Family Type	Metagenome
Number of Sequences	123
Average Sequence Length	44 residues
Representative Sequence	MNTEFIRYIKYAGAFVSPKDMTKYSYRPYLVEKAVLGMSSGLILI
Number of Associated Samples	69
Number of Associated Scaffolds	123

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	4.20 %
% of genes near scaffold ends (potentially truncated)	57.72 %
% of genes from short scaffolds (< 2000 bps)	94.31 %
Associated GOLD sequencing projects	69
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Most Common Taxonomy
Group	Unclassified (66.667 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (83.740 % of family members)
Environment Ontology (ENVO)	Unclassified (94.309 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (87.805 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 123 Family Scaffolds
PF00078	RVT_1	29.27
PF08284	RVP_2	4.88

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
All Organisms	root	All Organisms	33.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
cellular organisms	root	All Organisms → cellular organisms	33.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	32.52 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	30.08 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	30.08 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	30.08 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	30.08 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	29.27 %
Acetobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	29.27 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	29.27 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	29.27 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	29.27 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	28.46 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	28.46 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	28.46 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	28.46 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	28.46 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	27.64 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	27.64 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	18.70 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	18.70 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	13.01 %
Rottboelliinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae	4.88 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.81 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	13.01 %
Coix	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix	4.88 %
Saccharum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum	0.81 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	13.01 %
Coix lacryma-jobi	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	4.88 %
Saccharum officinarum complex	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex	0.81 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	66.67 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	13.01 %
Coix lacryma-jobi	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	4.88 %
Saccharum spontaneum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum	0.81 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.81 %
Acetobacter malorum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005339\|Ga0070660_101191960	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acetobacter → Acetobacter malorum	645	Open in IMG/M
3300005718\|Ga0068866_11116442	Not Available	565	Open in IMG/M
3300009990\|Ga0105132_120308	Not Available	650	Open in IMG/M
3300010373\|Ga0134128_13177824	Not Available	504	Open in IMG/M
3300010403\|Ga0134123_11401770	Not Available	739	Open in IMG/M
3300012070\|Ga0153963_1066269	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	569	Open in IMG/M
3300012996\|Ga0157358_1059672	Not Available	873	Open in IMG/M
3300012997\|Ga0157359_1050437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	1154	Open in IMG/M
3300013000\|Ga0157360_1255130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	568	Open in IMG/M
3300013023\|Ga0157366_1193268	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	565	Open in IMG/M
3300013296\|Ga0157374_11334198	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	740	Open in IMG/M
3300013297\|Ga0157378_12434805	Not Available	575	Open in IMG/M
3300014486\|Ga0182004_10006581	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	9477	Open in IMG/M
3300014486\|Ga0182004_10019777	Not Available	5097	Open in IMG/M
3300014486\|Ga0182004_10057134	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	2172	Open in IMG/M
3300014745\|Ga0157377_11684150	Not Available	511	Open in IMG/M
3300015267\|Ga0182122_1010529	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	846	Open in IMG/M
3300015267\|Ga0182122_1011361	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	828	Open in IMG/M
3300015267\|Ga0182122_1067344	Not Available	513	Open in IMG/M
3300015268\|Ga0182154_1010983	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	838	Open in IMG/M
3300015269\|Ga0182113_1010648	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	951	Open in IMG/M
3300015269\|Ga0182113_1032808	Not Available	696	Open in IMG/M
3300015269\|Ga0182113_1085158	Not Available	524	Open in IMG/M
3300015269\|Ga0182113_1094361	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	507	Open in IMG/M
3300015274\|Ga0182188_1008211	Not Available	845	Open in IMG/M
3300015274\|Ga0182188_1011143	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	782	Open in IMG/M
3300015274\|Ga0182188_1024820	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	640	Open in IMG/M
3300015274\|Ga0182188_1047601	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	541	Open in IMG/M
3300015276\|Ga0182170_1019745	Not Available	739	Open in IMG/M
3300015277\|Ga0182128_1011146	All Organisms → cellular organisms → Eukaryota	867	Open in IMG/M
3300015277\|Ga0182128_1077019	Not Available	507	Open in IMG/M
3300015279\|Ga0182174_1007413	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	995	Open in IMG/M
3300015279\|Ga0182174_1012552	Not Available	862	Open in IMG/M
3300015282\|Ga0182124_1055818	Not Available	564	Open in IMG/M
3300015282\|Ga0182124_1075757	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	516	Open in IMG/M
3300015282\|Ga0182124_1075924	Not Available	515	Open in IMG/M
3300015285\|Ga0182186_1083346	Not Available	502	Open in IMG/M
3300015286\|Ga0182176_1022782	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	760	Open in IMG/M
3300015286\|Ga0182176_1061058	Not Available	560	Open in IMG/M
3300015286\|Ga0182176_1061902	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	558	Open in IMG/M
3300015286\|Ga0182176_1071154	Not Available	534	Open in IMG/M
3300015287\|Ga0182171_1035036	Not Available	658	Open in IMG/M
3300015288\|Ga0182173_1026003	Not Available	708	Open in IMG/M
3300015288\|Ga0182173_1082453	Not Available	509	Open in IMG/M
3300015289\|Ga0182138_1009780	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	932	Open in IMG/M
3300015291\|Ga0182125_1075352	Not Available	539	Open in IMG/M
3300015291\|Ga0182125_1086145	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	517	Open in IMG/M
3300015292\|Ga0182141_1061794	Not Available	571	Open in IMG/M
3300015292\|Ga0182141_1076556	Not Available	536	Open in IMG/M
3300015292\|Ga0182141_1091555	Not Available	507	Open in IMG/M
3300015294\|Ga0182126_1035427	Not Available	674	Open in IMG/M
3300015295\|Ga0182175_1059535	Not Available	587	Open in IMG/M
3300015296\|Ga0182157_1034388	Not Available	697	Open in IMG/M
3300015298\|Ga0182106_1015909	Not Available	870	Open in IMG/M
3300015298\|Ga0182106_1041728	Not Available	660	Open in IMG/M
3300015298\|Ga0182106_1050246	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	626	Open in IMG/M
3300015298\|Ga0182106_1059825	Not Available	594	Open in IMG/M
3300015299\|Ga0182107_1058994	Not Available	600	Open in IMG/M
3300015299\|Ga0182107_1099084	Not Available	511	Open in IMG/M
3300015300\|Ga0182108_1018027	Not Available	849	Open in IMG/M
3300015300\|Ga0182108_1096149	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum spontaneum	519	Open in IMG/M
3300015302\|Ga0182143_1044142	Not Available	652	Open in IMG/M
3300015303\|Ga0182123_1028269	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	718	Open in IMG/M
3300015304\|Ga0182112_1053524	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	618	Open in IMG/M
3300015304\|Ga0182112_1073031	Not Available	564	Open in IMG/M
3300015305\|Ga0182158_1025991	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Rottboelliinae → Coix → Coix lacryma-jobi	755	Open in IMG/M
3300015307\|Ga0182144_1054088	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	622	Open in IMG/M
3300015308\|Ga0182142_1042915	Not Available	678	Open in IMG/M
3300015308\|Ga0182142_1045147	Not Available	668	Open in IMG/M
3300015308\|Ga0182142_1054168	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	634	Open in IMG/M
3300015308\|Ga0182142_1085965	Not Available	551	Open in IMG/M
3300015311\|Ga0182182_1012365	Not Available	1062	Open in IMG/M
3300015316\|Ga0182121_1097205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	595	Open in IMG/M
3300015321\|Ga0182127_1042258	All Organisms → cellular organisms → Eukaryota	703	Open in IMG/M
3300015322\|Ga0182110_1055954	Not Available	645	Open in IMG/M
3300015323\|Ga0182129_1025760	Not Available	785	Open in IMG/M
3300015323\|Ga0182129_1046794	Not Available	661	Open in IMG/M
3300015323\|Ga0182129_1076474	Not Available	572	Open in IMG/M
3300015323\|Ga0182129_1092853	Not Available	539	Open in IMG/M
3300015323\|Ga0182129_1107655	Not Available	514	Open in IMG/M
3300015331\|Ga0182131_1124429	Not Available	552	Open in IMG/M
3300015341\|Ga0182187_1064646	Not Available	750	Open in IMG/M
3300015341\|Ga0182187_1078251	Not Available	703	Open in IMG/M
3300015341\|Ga0182187_1147896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	562	Open in IMG/M
3300015341\|Ga0182187_1159877	Not Available	546	Open in IMG/M
3300015341\|Ga0182187_1169862	Not Available	534	Open in IMG/M
3300015342\|Ga0182109_1015468	Not Available	1276	Open in IMG/M
3300015343\|Ga0182155_1214299	Not Available	512	Open in IMG/M
3300015344\|Ga0182189_1205080	Not Available	524	Open in IMG/M
3300015345\|Ga0182111_1194335	Not Available	550	Open in IMG/M
3300015346\|Ga0182139_1029662	All Organisms → cellular organisms → Eukaryota	1087	Open in IMG/M
3300015346\|Ga0182139_1075116	Not Available	787	Open in IMG/M
3300015346\|Ga0182139_1123249	Not Available	656	Open in IMG/M
3300015346\|Ga0182139_1140474	Not Available	624	Open in IMG/M
3300015346\|Ga0182139_1167170	Not Available	584	Open in IMG/M
3300015346\|Ga0182139_1197311	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	548	Open in IMG/M
3300015346\|Ga0182139_1231179	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	514	Open in IMG/M
3300015346\|Ga0182139_1243553	Not Available	503	Open in IMG/M
3300015347\|Ga0182177_1134448	Not Available	637	Open in IMG/M
3300015347\|Ga0182177_1178976	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	572	Open in IMG/M
3300015347\|Ga0182177_1185249	Not Available	564	Open in IMG/M
3300015350\|Ga0182163_1158974	Not Available	704	Open in IMG/M
3300015351\|Ga0182161_1228165	Not Available	536	Open in IMG/M
3300015351\|Ga0182161_1233317	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	531	Open in IMG/M
3300015361\|Ga0182145_1101414	Not Available	626	Open in IMG/M
3300015361\|Ga0182145_1111389	Not Available	606	Open in IMG/M
3300017404\|Ga0182203_1139288	Not Available	531	Open in IMG/M
3300017410\|Ga0182207_1163340	Not Available	516	Open in IMG/M
3300017411\|Ga0182208_1109064	Not Available	531	Open in IMG/M
3300017425\|Ga0182224_1104485	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	584	Open in IMG/M
3300017427\|Ga0182190_1144374	Not Available	526	Open in IMG/M
3300017438\|Ga0182191_1062545	Not Available	719	Open in IMG/M
3300017443\|Ga0182193_1159728	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	542	Open in IMG/M
3300017443\|Ga0182193_1183458	Not Available	515	Open in IMG/M
3300017680\|Ga0182233_1104310	Not Available	526	Open in IMG/M
3300017681\|Ga0182226_1095617	Not Available	559	Open in IMG/M
3300017683\|Ga0182218_1058086	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	678	Open in IMG/M
3300017684\|Ga0182225_1074630	Not Available	617	Open in IMG/M
3300017684\|Ga0182225_1119160	Not Available	534	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	98.37%
Environmental	Environmental	1.63%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	94.31%
Fungi	Host-Associated → Fungi	4.06%
Terrestrial	Environmental → Terrestrial	1.63%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	86.99%
Mycelium	Host-Associated → Fungi → Mycelium	4.06%
Rhizosphere	Host-Associated → Plants → Rhizosphere	3.25%
Roots	Host-Associated → Plants → Roots	2.44%
Soil	Environmental → Terrestrial → Soil	1.63%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.81%
Unclassified	Host-Associated → Plants → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	86.99%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	4.06%
Unclassified	Host-Associated → Plants → Roots → Unclassified	2.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.44%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.63%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.81%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.81%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	86.99%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	4.06%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	2.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.44%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.63%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.81%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	0.81%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	83.74%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	3.25%
Fungus Garden	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden	3.25%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	2.44%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.44%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.63%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.81%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	0.81%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012070	Attine ant fungus gardens microbial communities from Florida, USA - TSFL047 MetaG	Host-Associated	Open in IMG/M
3300012996	Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta capiguara ACBM2	Host-Associated	Open in IMG/M
3300012997	Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta capiguara ACBM3	Host-Associated	Open in IMG/M
3300013000	Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM1	Host-Associated	Open in IMG/M
3300013023	Fungus gardens microbial communities from leaf cutter ant in Botucatu, State of S?o Paulo, Brazil - Atta bisphaerica ABBM1	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F069561

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070660_1011919602	3300005339	Corn Rhizosphere	MKTEFIKYMKYAGEFVSPEDITRYSYNPYLVEKAVFGISLAHILI*
Ga0068866_111164422	3300005718	Miscanthus Rhizosphere	YAGAFVKPKDMTRYSYNPYLVENAVFGISWGLILI*
Ga0105132_1203082	3300009990	Switchgrass Associated	MKTEFIRYIKYAGALVRPKDITRYSYSPYLVEKAVFGISQ
Ga0134128_131778241	3300010373	Terrestrial Soil	MKYAGAFVSPKDMTRYSYNPYLVKKAVLGISCGLILI*
Ga0134123_114017701	3300010403	Terrestrial Soil	MKTEFIKYIKYAGALVRPKDITRYSYSPYLVEKAVFGISQGLI
Ga0153963_10662692	3300012070	Attine Ant Fungus Gardens	MNTEFIIYMKKAGALVNPKDMTRYSYRPYLVEKAVLGISSSLIFI*
Ga0157358_10596722	3300012996	Fungus Garden	MNTEFIMYMKKAGALVNPKDMTRYSYRPYLVEKAVLGISSSLIFI*
Ga0157359_10504372	3300012997	Fungus Garden	MNTEFIMYIKKAGALVNPKDMTRYSYNPYLVKKAVFG
Ga0157360_12551301	3300013000	Fungus Garden	MNTEFIIYMKKAGALVNLKDMTRYLYRSYLVEKAVLGISSSLIPNFYLVVA*
Ga0157366_11932682	3300013023	Fungus Garden	MNTEFIVYMKKAGALVNSKDMTRYSYKPYLVEKAVLGISSSLIFIW*
Ga0157374_113341981	3300013296	Miscanthus Rhizosphere	MNTEFIRYVKYAGAFVSPKDMTKDSYRPYLVEKEVLGMSSDLILI*
Ga0157378_124348051	3300013297	Miscanthus Rhizosphere	MKTEFMRYMNNAGALVRPKDMTRYSQRPYLVEKVVFGI
Ga0182004_100065818	3300014486	Root	MRYMKWSGASVRTKDMMRYSYNPYLIEKAVLGTSSGWILI*
Ga0182004_100197777	3300014486	Root	KTEFIRYIKYAGAFVNPKDMTRYSYNPYLVEKAVFGISCGQILI*
Ga0182004_100571341	3300014486	Root	YAGAFVNPKDMTRYSYNPYLVEKAVFGISCGRILIW*
Ga0157377_116841501	3300014745	Miscanthus Rhizosphere	GIKTEFMRYMKNAGALVRPKDMTRYSYSPYLVKKAVFSISCGLILI*
Ga0182122_10105292	3300015267	Miscanthus Phyllosphere	MNTKFITYIKYAGAFVSLKDMTKYSYKPYLVEKAVLGMSFGLILI*
Ga0182122_10113611	3300015267	Miscanthus Phyllosphere	MKTEFIRYMKKAGALVRPKDITRYSYNPYLVEKAVLG
Ga0182122_10673441	3300015267	Miscanthus Phyllosphere	KTEFIRYMKKAGALVRPKDITRYSYNPFLVEKAVFGISCGLILI*
Ga0182154_10109831	3300015268	Miscanthus Phyllosphere	NTEFMRYMKWAGALVNPKDMTRYSFRPYLVEKAVLGMSSNLILI*
Ga0182113_10106482	3300015269	Miscanthus Phyllosphere	MNTEFIRYIKYAGAFVSPKDMTKYSYRPYLVEKAVFGISFGLILI*
Ga0182113_10328081	3300015269	Miscanthus Phyllosphere	MSSMNTTMNLSSSGMNTEFIRYIKYAGAFVSPKDMTKYSYRLYLVEKVVLGMSSGLILI*
Ga0182113_10851581	3300015269	Miscanthus Phyllosphere	MNTTMNLSSLGMNTEFIIYMKYAGAFVKPKDMTRYSYNLYLVEKVILGSSFGLILI*
Ga0182113_10943612	3300015269	Miscanthus Phyllosphere	EFMRYMKWAGALVSPKDMTRYSYRPYLVEKAVLGMSSDLILI*
Ga0182188_10082111	3300015274	Miscanthus Phyllosphere	RYMKYAGAFVSPKDMTKYSYRPYLVEKAILGISSGLILI*
Ga0182188_10111431	3300015274	Miscanthus Phyllosphere	MKTEFIRYMKKAGALVRPKDITRYSYNPYLVEKAVL
Ga0182188_10248202	3300015274	Miscanthus Phyllosphere	MNTKFIKYMKYARAFVRPKDMTRYSNKPYLVEKAILGASFGLILI*
Ga0182188_10476011	3300015274	Miscanthus Phyllosphere	MKTEFIRYMKKAGALVRPKDITRYSYSPYLVEKAVFGISCGLI
Ga0182170_10197451	3300015276	Miscanthus Phyllosphere	RYMKYAGAFVSPKDMTKYSYRPYLVEKAVLGISSSLILI*
Ga0182128_10111462	3300015277	Miscanthus Phyllosphere	FMRYMKNAGALVRPKDMTRYSYSPYLVEKAVFGISCGLILI*
Ga0182128_10770192	3300015277	Miscanthus Phyllosphere	RYMKYAGAFVSPKDMTKYSYRSYLVEKVVLGISSGLILI*
Ga0182174_10074132	3300015279	Miscanthus Phyllosphere	MNTEFISYMKYIGAFVSPKDMTKYSYRPYLVEKAVLRISFGLILI*
Ga0182174_10125522	3300015279	Miscanthus Phyllosphere	MNTEFIRYLKYAEAFVSPMDMTKYSYRPYLVEKAVLGMSFGLILI*
Ga0182124_10558181	3300015282	Miscanthus Phyllosphere	MSSMNTTMNLSSSGMNTEFIRYMKYAGAFVSPKDMTKYSCRPYLVDKIVLGMSYGLILI*
Ga0182124_10757571	3300015282	Miscanthus Phyllosphere	MNTEFIRYIKYVGAFVIPKDMTKYSYRPYLVEKAVLGMSSGLILI*
Ga0182124_10759241	3300015282	Miscanthus Phyllosphere	MKKAGALVRPKDITRYAYSPYLVEKVVFGISCGLILI*
Ga0182156_10619412	3300015283	Miscanthus Phyllosphere	NSGINTEFIRYIKCAGVLVNPKDITRYSYRPYLVENAVFGTSSGQILI*
Ga0182186_10833461	3300015285	Miscanthus Phyllosphere	KYMKYAGAFVRPKNMTRYSYKSYLVEKVVLGTSFGLILI*
Ga0182176_10227822	3300015286	Miscanthus Phyllosphere	MNTEFIRYMKYAGAFVSPKDMTKYSHRPYLVEKAVLGISSG
Ga0182176_10263092	3300015286	Miscanthus Phyllosphere	SGMKTEFIRYMKKARALVRPKDITRYSYNPYLVEKAILSIFCGLILI*
Ga0182176_10610581	3300015286	Miscanthus Phyllosphere	KNAGALVRPKDMTRYSYNPYLVEKAIFVISCGRILI*
Ga0182176_10619021	3300015286	Miscanthus Phyllosphere	TNLSSSGMNTEFIRYIKYAGAFVSPKDMTKYSYRPYLEEKTVLGMSSGLILI*
Ga0182176_10711542	3300015286	Miscanthus Phyllosphere	SGMNTKLIRYIKYAGAFVSPKDMIKYSYRPYLVEKAILGMSSSLILI*
Ga0182171_10350361	3300015287	Miscanthus Phyllosphere	MNTEFIRYIKYAGAFVSPKDMTKYSYRLYLVEKAVLGMYSGLILI*
Ga0182173_10260031	3300015288	Miscanthus Phyllosphere	MKTELIRYMKNAGALVRPKDMTRYSYSPYLVEKVVF
Ga0182173_10824531	3300015288	Miscanthus Phyllosphere	MNTTTNLSSWRMNTEFIMYMKYAGAFVRPNDMTRYSYKPYLVEKTVLGISFGLILI*
Ga0182138_10097802	3300015289	Miscanthus Phyllosphere	GINTEFIRYIKCAGALVNPKDITRYSYRPYLVENAVFGTSSGRILI*
Ga0182125_10753521	3300015291	Miscanthus Phyllosphere	IHQIHKMCGALVNPKDITRYSYIPYLVENAVFGTSSGQILI*
Ga0182125_10861451	3300015291	Miscanthus Phyllosphere	GIKTEFIRYMKNTGALVRPKDITRYSYNPYLVEKAVFGISCGLILI*
Ga0182141_10617941	3300015292	Miscanthus Phyllosphere	MNIKFIRYMKYAGAFVSPKDMTKYSYMPYLVEKAVLGMFSGLILI*
Ga0182141_10765561	3300015292	Miscanthus Phyllosphere	MNTEFIRYTEFKPKDMTRYSYNPYLVEKVVLGISS
Ga0182141_10915551	3300015292	Miscanthus Phyllosphere	MNTTTNLSSSGMNTEFIRYMKYAGAFVSPKDMTKYSYRPYLVEKVVLGMSFGLILI*
Ga0182126_10354273	3300015294	Miscanthus Phyllosphere	MNTEFIRYIKYAGAFVSPKDMTKYSYRPYLVEKAVLGMSFGLILI*
Ga0182175_10595351	3300015295	Miscanthus Phyllosphere	MKNAGALVRPKDITRYSYNPYLVEKAVFGTSCRLN
Ga0182157_10343882	3300015296	Miscanthus Phyllosphere	MNTEFIRYIKYTGAFVSPKDMTKYSYKPYLVEKAVLGMSFGLILI*
Ga0182106_10159092	3300015298	Miscanthus Phyllosphere	MNTEFMRYIKYAGAFISPKDMTKYTYMPYLMEKAVLGMSFGLILI*
Ga0182106_10417282	3300015298	Miscanthus Phyllosphere	MKYEGAFVSPKDMTKYSYMPYLVEKAVLGMSSGLILI*
Ga0182106_10502461	3300015298	Miscanthus Phyllosphere	MKTEFMRYMKNAGALMRPKDMTRYSYSPYLVEKAI
Ga0182106_10598251	3300015298	Miscanthus Phyllosphere	MNTEFIRYIKYAGAFVSSKDMTKYSYRPYLVEKAVLG
Ga0182107_10589942	3300015299	Miscanthus Phyllosphere	MNTEFIRYIKYAGAFVSPKDMAKYSYRPYLVEKAVLGISFRLILI*
Ga0182107_10990841	3300015299	Miscanthus Phyllosphere	MNTEFIIYMKYAIAFVRPKDVIKYSYMSYLVEKAVLDISSSL
Ga0182108_10180272	3300015300	Miscanthus Phyllosphere	MNTEFIRYIKYAGAFVSPKDMTKYSYRPYLVEKAVLGMSSGLILI*
Ga0182108_10961491	3300015300	Miscanthus Phyllosphere	TEFIRYIKYAGAFVKPKDMTRYSYKPYLVENAILGISCGLILI*
Ga0182143_10441421	3300015302	Miscanthus Phyllosphere	MNTTMNLSNSGMNTKFIRYMKYAEAFVSPKDMTKYSYRPYLVEKAVLGMSSGLILI*
Ga0182123_10282691	3300015303	Miscanthus Phyllosphere	MNTEFIRYIKYVGAFVSPKDMTKYSYKPYLVEKAVL
Ga0182112_10535241	3300015304	Miscanthus Phyllosphere	EFMRYMKNAGALVRPKDMTRYSYSPYLVEKVIFGISCGQILI*
Ga0182112_10730311	3300015304	Miscanthus Phyllosphere	MNTKFIIYMKHAGAFVSPKGMTKYPYKPYLVEKAVLGISFGLILI*
Ga0182158_10259911	3300015305	Miscanthus Phyllosphere	MTTEFIRYMKKAGALVRPKDITRYSYNPYLVEKAV
Ga0182144_10540882	3300015307	Miscanthus Phyllosphere	MNTEFIRNIKYAGAFVSPKDMTKYSYRPYLEEKAVLGMSSGLILI*
Ga0182142_10429152	3300015308	Miscanthus Phyllosphere	TKFIRYMKYAGAFVSPKDMTKYSYRPYLVVKAVLGISFGLILI*
Ga0182142_10451471	3300015308	Miscanthus Phyllosphere	MNTEFIRYMKYAGAFVSPKDMTKYSNRPYLVEKAVLGISFGLILI*
Ga0182142_10541681	3300015308	Miscanthus Phyllosphere	MNTKFIGYMKYAGTFVSPKDMTKYSYRPYLVEKAVLGMSSGLILI*
Ga0182142_10859651	3300015308	Miscanthus Phyllosphere	AGTFIKPKDMTRYSYNPYLVENAVFDISCGLILI*
Ga0182182_10123651	3300015311	Switchgrass Phyllosphere	MKYAGAFVSPKDMTRYSYNPYLVKKAVLGISCGLI
Ga0182121_10972052	3300015316	Switchgrass Phyllosphere	MKTTMNLSSSGMNTEFMRYMKWAGALVRPKDIIKYSYRPYRVEKVVLGIP
Ga0182127_10422581	3300015321	Miscanthus Phyllosphere	KTEFMRYMKNAGALVRPKDMTRYSYSPYLVEKAVFGISYGLILI*
Ga0182110_10559542	3300015322	Miscanthus Phyllosphere	MNTTSNLSYLGMNTKFIRYMKYAGAFISPKDMTKYSYMPYLVEKAVLGMSSGLILI*
Ga0182129_10257601	3300015323	Miscanthus Phyllosphere	KYAGALVKLKDITRYSYNPYLVEKAVLGTSSGLIFI*
Ga0182129_10366201	3300015323	Miscanthus Phyllosphere	TTNLSSSDMKTEFIRYMKKAGALVRPKDITRYSYSPYLVEKIVLGISCGLILI*
Ga0182129_10467941	3300015323	Miscanthus Phyllosphere	MNTTTNLSSSGMNTEFIRYMKYAGAFVSPKDMTKYSYMPYLVEKAVLGISSGLILI*
Ga0182129_10764741	3300015323	Miscanthus Phyllosphere	MNTEFIRYMKYVGAFVSLKDMTKYSYRPYLVEKAVLGIS
Ga0182129_10928531	3300015323	Miscanthus Phyllosphere	KTEFMRYIKNTGALVRPKDMTRYSYNPYLVEKVVFGISCDQILI*
Ga0182129_10935541	3300015323	Miscanthus Phyllosphere	SGMKTEFIRYMKKAGALVRPKDITRYSYSLYLVEKAVFGISRGLILI*
Ga0182129_11076551	3300015323	Miscanthus Phyllosphere	MRYMKNTRALVRPKNMTRYSYSPYLLEKAVFGISYGQILI
Ga0182131_11244292	3300015331	Switchgrass Phyllosphere	MNIEFMRYIKYAGAFVRPKDMTKYSYNPYRVEKAVLGISHG*
Ga0182187_10646462	3300015341	Miscanthus Phyllosphere	MALMNTTMNLSSSGMNTEFIRNIKYAGAFVSPKDMTKYSYRPYLEEKAVLGMSSGLILI*
Ga0182187_10782512	3300015341	Miscanthus Phyllosphere	EFIRYIKYTGAFVSPKDMTKYSYMPYLVEKAVLGMSSDLILI*
Ga0182187_11478962	3300015341	Miscanthus Phyllosphere	MNTTINLSSSGMNTEFIRYIKYAGVFVSPKDMTKYSYRPYLVEKAVLGMSFDLILI*
Ga0182187_11598772	3300015341	Miscanthus Phyllosphere	MKTEFMRYIKNAGALVRPKDMTRYSYNPYLVEKVVFGIFWV*
Ga0182187_11698622	3300015341	Miscanthus Phyllosphere	MKYSGAFVRPKDMTRYSYNPYLVEKVVLGMSFSLILI*
Ga0182109_10154682	3300015342	Miscanthus Phyllosphere	MKTEFIRYIKYAGAFVKPKDMTRYSYKPYLVENAVLGISCGLIL
Ga0182155_12142991	3300015343	Miscanthus Phyllosphere	IKYAGAFVSPKDMTKYSYRPYLVEKGVLGMSSGLILI*
Ga0182189_12050802	3300015344	Miscanthus Phyllosphere	EFIRYMKKAGALVRPKDITRYSYNPYLVEKVVFGIFCGLILI*
Ga0182111_11943351	3300015345	Miscanthus Phyllosphere	FIRYIKYTGAFVKPNDMIRYLYNPYLVEKAVLGISYGLILIW*
Ga0182139_10296621	3300015346	Miscanthus Phyllosphere	KTEFIRYMKKARALVRPKDITRYSYSPYLVEKVVFGLSCGLILI*
Ga0182139_10751161	3300015346	Miscanthus Phyllosphere	MNTTMNLSSLGKNTEFIRYMKYARVFVSPKDMTKYSHRSYLVEKVVLGMSSSLILI*
Ga0182139_11232492	3300015346	Miscanthus Phyllosphere	SGIKTEFIRYMKKAGALVRPKDITRYSYNPYLVEKAIFGI*
Ga0182139_11404741	3300015346	Miscanthus Phyllosphere	IEFIRYMKKAGALVRPKDITRYLYNPYLVEKAVFGMSCGLILI*
Ga0182139_11671701	3300015346	Miscanthus Phyllosphere	MSSMNTTMNLSSSGMNTEFIRYIKYAGAFVSTKDMAKYSYRPYLVEKAVLGISFGLILI*
Ga0182139_11973112	3300015346	Miscanthus Phyllosphere	MNTEFIKYMKYAGAFVRQKDMTRYSCRPYLVEKIVLGMSSGLILI*
Ga0182139_12311793	3300015346	Miscanthus Phyllosphere	MNTEFIRYMKYVGAFVNPKDMTKYSYMTYLVEKAVLGISFG
Ga0182139_12435532	3300015346	Miscanthus Phyllosphere	MNTTMNLSGMGMNTEFIRYIRYAGAFVSPKDMTKYSYRPYLVEKAVLGISSSLILI*
Ga0182177_11344481	3300015347	Miscanthus Phyllosphere	MNIEFIRYIKYAGAFVSPKDMTKYSYKPYLVEKAVLGMSFGLILI*
Ga0182177_11789762	3300015347	Miscanthus Phyllosphere	MNTEFIKYMKYAGAFVRPKDMTRYSNKPYLVEKAILGASSGLILI*
Ga0182177_11852491	3300015347	Miscanthus Phyllosphere	MKYAGAFVRPKDMTRYSYKPYLVEKAILVISFGLILI*
Ga0182163_11589742	3300015350	Switchgrass Phyllosphere	MNTEFMSYMKCAGALVSPKDITRYSKNPYLVEKAVLGI
Ga0182161_12281651	3300015351	Miscanthus Phyllosphere	MNTEFIRYLKYVGAFVSPKDMTKYSYMPYLVEKAVL
Ga0182161_12333172	3300015351	Miscanthus Phyllosphere	MNTEFIRYMKYAGAFVSPKDMTKYSYRPYLVEKAVLGTSFGLILI*
Ga0182145_11014142	3300015361	Miscanthus Phyllosphere	MNTEFIRYIKYAGAFVSPKDMTKYSYRPYLVEKSVLGMFSDLILI*
Ga0182145_11113892	3300015361	Miscanthus Phyllosphere	MNTTMNLSSSGMNTKFITYIKYVGAFVSLKDMTKYSYKPYLVEKAVLGMSFGLILI*
Ga0182203_11392881	3300017404	Miscanthus Phyllosphere	KYARAFVSPKDMTKYSYRSYPVEKVVLGMSYGLILI
Ga0182207_11633401	3300017410	Miscanthus Phyllosphere	KKAGALVRPRDITWYSYNPYLVEKAVFGISCGLILI
Ga0182208_11090641	3300017411	Miscanthus Phyllosphere	MKTEFMRYIKNVGALVRPKDMTRYSYNPYLVEKAVFGISYGRILI
Ga0182224_11044852	3300017425	Miscanthus Phyllosphere	MNTEFIRCMKYAGAFVSQKDMTKYSYMPYLVEKAVLGISSSLILI
Ga0182190_11443741	3300017427	Miscanthus Phyllosphere	MNTEFIKYMKYAGAFVGPKDMTRYSHKPYLVEKAILGTSSGLILI
Ga0182191_10625452	3300017438	Miscanthus Phyllosphere	RYMKKAGALVRPKDITRYSYSPYLVEKVVFGLSCGLILI
Ga0182193_11597281	3300017443	Miscanthus Phyllosphere	MKTEFMRYMKNAGALMRPKDMTRYSYSPYLVEKVVFGIFWV
Ga0182193_11834581	3300017443	Miscanthus Phyllosphere	TEFIRYIKYAVTLVSPKDMTKYTYKPYLVEKAVLGMSSSLILI
Ga0182233_11043101	3300017680	Miscanthus Phyllosphere	SSSGMNTEFIRYIKYAGVFVSPKDMTKYSYRPYLVEKAVLGMSSDLNLI
Ga0182226_10956172	3300017681	Miscanthus Phyllosphere	YAGALVKPNDITRYSYNPYLVKKAVLGTSSGLIFI
Ga0182218_10580861	3300017683	Miscanthus Phyllosphere	GMNIEFIRYIKYAGAFVSPKDMTKYSYIPYLVEKAVLGMSSGLILI
Ga0182225_10746301	3300017684	Miscanthus Phyllosphere	KNIKYAGAFVKPKDMTRYSYNPYLVENTVFGISCGLILI
Ga0182225_11191601	3300017684	Miscanthus Phyllosphere	KKAGALVRPKDITRYSYNPYLVAKAVFGISYGLILI

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign