| Basic Information | |
|---|---|
| Family ID | F069411 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LVSAERGDLQNEFIEITEDEASQIVDRIRATVTGASNG |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.68 % |
| % of genes near scaffold ends (potentially truncated) | 87.90 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.581 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.710 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.355 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.79% β-sheet: 0.00% Coil/Unstructured: 71.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF08044 | DUF1707 | 17.74 |
| PF03992 | ABM | 8.06 |
| PF11716 | MDMPI_N | 4.03 |
| PF13483 | Lactamase_B_3 | 3.23 |
| PF13602 | ADH_zinc_N_2 | 3.23 |
| PF05016 | ParE_toxin | 1.61 |
| PF02566 | OsmC | 1.61 |
| PF00005 | ABC_tran | 1.61 |
| PF13551 | HTH_29 | 1.61 |
| PF00296 | Bac_luciferase | 1.61 |
| PF10604 | Polyketide_cyc2 | 1.61 |
| PF08897 | DUF1841 | 1.61 |
| PF11987 | IF-2 | 0.81 |
| PF05988 | DUF899 | 0.81 |
| PF08448 | PAS_4 | 0.81 |
| PF13560 | HTH_31 | 0.81 |
| PF04672 | Methyltransf_19 | 0.81 |
| PF00990 | GGDEF | 0.81 |
| PF13738 | Pyr_redox_3 | 0.81 |
| PF13358 | DDE_3 | 0.81 |
| PF08240 | ADH_N | 0.81 |
| PF12697 | Abhydrolase_6 | 0.81 |
| PF13669 | Glyoxalase_4 | 0.81 |
| PF01370 | Epimerase | 0.81 |
| PF05685 | Uma2 | 0.81 |
| PF07929 | PRiA4_ORF3 | 0.81 |
| PF04191 | PEMT | 0.81 |
| PF02607 | B12-binding_2 | 0.81 |
| PF00970 | FAD_binding_6 | 0.81 |
| PF13466 | STAS_2 | 0.81 |
| PF13302 | Acetyltransf_3 | 0.81 |
| PF13701 | DDE_Tnp_1_4 | 0.81 |
| PF01575 | MaoC_dehydratas | 0.81 |
| PF12680 | SnoaL_2 | 0.81 |
| PF14016 | DUF4232 | 0.81 |
| PF03795 | YCII | 0.81 |
| PF00496 | SBP_bac_5 | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.61 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.61 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.61 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.81 |
| COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.39 % |
| Unclassified | root | N/A | 26.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459024|GZRSKLJ01BPOO3 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300000956|JGI10216J12902_101127386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1246 | Open in IMG/M |
| 3300004635|Ga0062388_101756117 | Not Available | 635 | Open in IMG/M |
| 3300005435|Ga0070714_101604466 | Not Available | 635 | Open in IMG/M |
| 3300005467|Ga0070706_101488308 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005530|Ga0070679_100567382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1078 | Open in IMG/M |
| 3300005537|Ga0070730_10114589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1853 | Open in IMG/M |
| 3300005537|Ga0070730_10473378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → environmental samples → uncultured Pseudonocardia sp. | 806 | Open in IMG/M |
| 3300005541|Ga0070733_10376340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia pseudovaccinii | 943 | Open in IMG/M |
| 3300005610|Ga0070763_10167022 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300006059|Ga0075017_100461365 | Not Available | 960 | Open in IMG/M |
| 3300006163|Ga0070715_10063355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1630 | Open in IMG/M |
| 3300006579|Ga0074054_10000342 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300009098|Ga0105245_10886054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 934 | Open in IMG/M |
| 3300009700|Ga0116217_10713763 | Not Available | 620 | Open in IMG/M |
| 3300009824|Ga0116219_10013631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5180 | Open in IMG/M |
| 3300009839|Ga0116223_10042413 | All Organisms → cellular organisms → Bacteria | 3017 | Open in IMG/M |
| 3300010339|Ga0074046_10919598 | Not Available | 507 | Open in IMG/M |
| 3300010360|Ga0126372_10533567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1110 | Open in IMG/M |
| 3300010362|Ga0126377_10140427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2258 | Open in IMG/M |
| 3300010371|Ga0134125_12312248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 584 | Open in IMG/M |
| 3300010376|Ga0126381_100295647 | All Organisms → cellular organisms → Bacteria | 2215 | Open in IMG/M |
| 3300010396|Ga0134126_11691794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 695 | Open in IMG/M |
| 3300010867|Ga0126347_1337194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 662 | Open in IMG/M |
| 3300010876|Ga0126361_10639225 | Not Available | 567 | Open in IMG/M |
| 3300010876|Ga0126361_10639697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 1148 | Open in IMG/M |
| 3300010876|Ga0126361_10976446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3024 | Open in IMG/M |
| 3300010880|Ga0126350_11647497 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300011270|Ga0137391_11443612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300012176|Ga0153952_1134159 | Not Available | 545 | Open in IMG/M |
| 3300012200|Ga0137382_10643866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 758 | Open in IMG/M |
| 3300012208|Ga0137376_10617511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 937 | Open in IMG/M |
| 3300012211|Ga0137377_10044648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4073 | Open in IMG/M |
| 3300012351|Ga0137386_10995725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 597 | Open in IMG/M |
| 3300012362|Ga0137361_10618330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 992 | Open in IMG/M |
| 3300012363|Ga0137390_12002098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 505 | Open in IMG/M |
| 3300012685|Ga0137397_11024586 | Not Available | 606 | Open in IMG/M |
| 3300012958|Ga0164299_10078937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1644 | Open in IMG/M |
| 3300012958|Ga0164299_11665755 | Not Available | 505 | Open in IMG/M |
| 3300012960|Ga0164301_10071868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1878 | Open in IMG/M |
| 3300012989|Ga0164305_10092871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1915 | Open in IMG/M |
| 3300012989|Ga0164305_11939289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300013100|Ga0157373_10197304 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
| 3300014838|Ga0182030_10012319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 17146 | Open in IMG/M |
| 3300015245|Ga0137409_11353154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 556 | Open in IMG/M |
| 3300016404|Ga0182037_10775939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
| 3300017821|Ga0187812_1051466 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300017926|Ga0187807_1096257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 929 | Open in IMG/M |
| 3300017942|Ga0187808_10046130 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300017942|Ga0187808_10072050 | Not Available | 1483 | Open in IMG/M |
| 3300017942|Ga0187808_10471750 | Not Available | 579 | Open in IMG/M |
| 3300017943|Ga0187819_10563119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 647 | Open in IMG/M |
| 3300017948|Ga0187847_10228948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1012 | Open in IMG/M |
| 3300017966|Ga0187776_11145887 | Not Available | 580 | Open in IMG/M |
| 3300017966|Ga0187776_11491902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella aluminosa | 519 | Open in IMG/M |
| 3300017973|Ga0187780_10982496 | Not Available | 615 | Open in IMG/M |
| 3300018001|Ga0187815_10394722 | Not Available | 589 | Open in IMG/M |
| 3300018038|Ga0187855_10315806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
| 3300018062|Ga0187784_11490291 | Not Available | 536 | Open in IMG/M |
| 3300018086|Ga0187769_10403179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300018086|Ga0187769_10529051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
| 3300018086|Ga0187769_11255885 | Not Available | 560 | Open in IMG/M |
| 3300020582|Ga0210395_10828904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 689 | Open in IMG/M |
| 3300020582|Ga0210395_10933183 | Not Available | 644 | Open in IMG/M |
| 3300021401|Ga0210393_11621101 | Not Available | 513 | Open in IMG/M |
| 3300021420|Ga0210394_11126994 | Not Available | 676 | Open in IMG/M |
| 3300021432|Ga0210384_10516486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
| 3300021433|Ga0210391_11298474 | Not Available | 561 | Open in IMG/M |
| 3300021474|Ga0210390_10431533 | Not Available | 1113 | Open in IMG/M |
| 3300021477|Ga0210398_10595668 | Not Available | 898 | Open in IMG/M |
| 3300021478|Ga0210402_12026264 | Not Available | 501 | Open in IMG/M |
| 3300021861|Ga0213853_10229094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Gandjariella → Gandjariella thermophila | 840 | Open in IMG/M |
| 3300022533|Ga0242662_10177734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
| 3300025913|Ga0207695_10675443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 914 | Open in IMG/M |
| 3300025916|Ga0207663_10235074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1341 | Open in IMG/M |
| 3300025917|Ga0207660_11136913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 636 | Open in IMG/M |
| 3300025939|Ga0207665_10018905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4528 | Open in IMG/M |
| 3300026121|Ga0207683_10293275 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300026551|Ga0209648_10793204 | Not Available | 517 | Open in IMG/M |
| 3300027775|Ga0209177_10024146 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Gandjariella → Gandjariella thermophila | 1534 | Open in IMG/M |
| 3300027895|Ga0209624_10772034 | Not Available | 632 | Open in IMG/M |
| 3300027908|Ga0209006_10404658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
| 3300027908|Ga0209006_11216237 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300028047|Ga0209526_10081634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2277 | Open in IMG/M |
| 3300028379|Ga0268266_11090844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 772 | Open in IMG/M |
| 3300028780|Ga0302225_10546656 | Not Available | 538 | Open in IMG/M |
| 3300028789|Ga0302232_10135741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1245 | Open in IMG/M |
| 3300028801|Ga0302226_10397461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300028806|Ga0302221_10512442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300028828|Ga0307312_10524730 | Not Available | 782 | Open in IMG/M |
| 3300028906|Ga0308309_10718697 | Not Available | 868 | Open in IMG/M |
| 3300028906|Ga0308309_10990017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 729 | Open in IMG/M |
| 3300029999|Ga0311339_10133543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2959 | Open in IMG/M |
| 3300030007|Ga0311338_11149983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300030399|Ga0311353_11201432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 626 | Open in IMG/M |
| 3300030399|Ga0311353_11491170 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300030524|Ga0311357_11301003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 624 | Open in IMG/M |
| 3300030617|Ga0311356_10903468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
| 3300030618|Ga0311354_10971405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300030741|Ga0265459_14131299 | Not Available | 509 | Open in IMG/M |
| 3300030906|Ga0302314_10923936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300031231|Ga0170824_117672448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
| 3300031234|Ga0302325_11164478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300031234|Ga0302325_13028199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300031236|Ga0302324_100146384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3881 | Open in IMG/M |
| 3300031525|Ga0302326_11607533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
| 3300031564|Ga0318573_10216234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1018 | Open in IMG/M |
| 3300031681|Ga0318572_10530012 | Not Available | 702 | Open in IMG/M |
| 3300031715|Ga0307476_10091280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → unclassified Streptosporangiales → Streptosporangiales bacterium | 2139 | Open in IMG/M |
| 3300031754|Ga0307475_10621942 | Not Available | 864 | Open in IMG/M |
| 3300031771|Ga0318546_11100644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300031795|Ga0318557_10295039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 744 | Open in IMG/M |
| 3300031859|Ga0318527_10312629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 669 | Open in IMG/M |
| 3300031910|Ga0306923_12153186 | Not Available | 561 | Open in IMG/M |
| 3300032001|Ga0306922_10466490 | Not Available | 1348 | Open in IMG/M |
| 3300032059|Ga0318533_10884685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Spongiactinospora → Spongiactinospora gelatinilytica | 655 | Open in IMG/M |
| 3300032160|Ga0311301_12028351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 670 | Open in IMG/M |
| 3300032261|Ga0306920_101216028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1088 | Open in IMG/M |
| 3300032892|Ga0335081_10948686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1008 | Open in IMG/M |
| 3300032893|Ga0335069_10024361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8309 | Open in IMG/M |
| 3300032893|Ga0335069_12166720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | 582 | Open in IMG/M |
| 3300032896|Ga0335075_11470760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 569 | Open in IMG/M |
| 3300033158|Ga0335077_10706187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1038 | Open in IMG/M |
| 3300033818|Ga0334804_001111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 15926 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.71% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 12.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.03% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 4.03% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.61% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.81% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012176 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD1_10057840 | 2170459024 | Grass Soil | SAERGDLLNEFIEITEDEANQIVERIRAKVTGTNSA |
| JGI10216J12902_1011273862 | 3300000956 | Soil | MNQTEADIWEFSPALISAERGDLQNKFIEITEDEANQIVARIRAKAASAGNG* |
| Ga0062388_1017561171 | 3300004635 | Bog Forest Soil | RSASLVSAERGDLLNEYIEITEDEANQIVERIRAIATGANSG* |
| Ga0070714_1016044663 | 3300005435 | Agricultural Soil | STSLISAERGDLQNEFVEITEDEANQIVARIRARVTGQSNG* |
| Ga0070706_1014883083 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | PELISAERGDLQYQFIEVTKDEANQIVARIRAEVSGASNS* |
| Ga0070679_1005673823 | 3300005530 | Corn Rhizosphere | LTWERTSLLVSSERGDLQYEFIEINEDEANQVVARIRAEVTGRSSA* |
| Ga0070730_101145891 | 3300005537 | Surface Soil | SLVSAERGDLQNEFIEITEGEANQIVDRIRATVTGASNS* |
| Ga0070730_104733782 | 3300005537 | Surface Soil | SLISAERGDLENDFIEITEDEANQIVARIRAEVTGASST* |
| Ga0070733_103763401 | 3300005541 | Surface Soil | LTWEFSPALISAERGDLQNTFIEISEDEANQIVARIRAEVTGAANT* |
| Ga0070763_101670224 | 3300005610 | Soil | ERGDLQNEFIEITETEANEIVERIRARVTGAGNS* |
| Ga0075017_1004613651 | 3300006059 | Watersheds | AERGDLQNEFIEITEEEANQIVARIRADVTGANGT* |
| Ga0070715_100633551 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EFSPELIAAERGDLQYDFIEITEDEANQIVARIRAEVTGTSNA* |
| Ga0074054_100003421 | 3300006579 | Soil | ERGDLLNEFIEITEDEANQIVARIRDEVAGRSSA* |
| Ga0105245_108860542 | 3300009098 | Miscanthus Rhizosphere | LVSSERGDLQYEFIEISEDEANQIVARIRAEVTGTGNA* |
| Ga0116217_107137632 | 3300009700 | Peatlands Soil | MLVSAERGDLQNEFIEITEDEANQIVARIRADVTGASST* |
| Ga0116219_100136317 | 3300009824 | Peatlands Soil | TVLLVSAERGDLQNEFTEITEDEANQIVERIRATVTGASNGHNG* |
| Ga0116223_100424131 | 3300009839 | Peatlands Soil | WEYSTSLISAQRGDLENEFIEITEDEANQIVERIRATVTGANNG* |
| Ga0074046_109195981 | 3300010339 | Bog Forest Soil | IWERSWLLVSVECVVMVKEFTEITEDEANQIAERIRATVTGANNG* |
| Ga0126372_105335672 | 3300010360 | Tropical Forest Soil | VSSERGDLQYEFIEISEDEANQVVARIRAEVTGAGDG* |
| Ga0126377_101404275 | 3300010362 | Tropical Forest Soil | LVSSERGDLQYEFIEISEDEANQVVARIRTEVTGTGNA* |
| Ga0134125_123122481 | 3300010371 | Terrestrial Soil | YSTSLISAERGDLQNEFVEITEDEANQIVARIRARVTGQSNG* |
| Ga0126381_1002956471 | 3300010376 | Tropical Forest Soil | LLVSSERGDLQYEFIEIAEGEANQIVARIRAEVTGTSNA* |
| Ga0134126_116917942 | 3300010396 | Terrestrial Soil | SLISAERGDLQNEFVEITEDEANQIVARIRARVTGQSNG* |
| Ga0126347_13371941 | 3300010867 | Boreal Forest Soil | ERPALLVSAERGDLVNAFIAISEAEADQIVERIRSTVTGAAGS* |
| Ga0126361_106392252 | 3300010876 | Boreal Forest Soil | VWERSVSLVSAERGDLQNEFVEITEEEANQIVDRIRARVTGASTG* |
| Ga0126361_106396971 | 3300010876 | Boreal Forest Soil | LCWEYSTSLISAERGDLDNQFIEITEGEANQIVERLRAKVTGPSSA* |
| Ga0126361_109764463 | 3300010876 | Boreal Forest Soil | ERTVLLVSAERGDLQNEFIEITEDEANQIVERIRAKVTGASSDK* |
| Ga0126350_116474972 | 3300010880 | Boreal Forest Soil | LVSAERGDLQNEFIEITEDEASQIVDRIRATVTGASNG* |
| Ga0137391_114436121 | 3300011270 | Vadose Zone Soil | ERGDLVNEFIEITKDEASQIVERIRATVTGANHS* |
| Ga0153952_11341592 | 3300012176 | Attine Ant Fungus Gardens | MLVSSERGDLQNDFIEITEGEAARIVAQIRADVTGANGT* |
| Ga0137382_106438661 | 3300012200 | Vadose Zone Soil | FSPELISAERGDLQYQFIEVTEDEANQIVARIRAEVTGTSNG* |
| Ga0137376_106175111 | 3300012208 | Vadose Zone Soil | PELISAERGDLQYQFIEVTEDEANQIVARIRAEVTGTSNG* |
| Ga0137377_100446487 | 3300012211 | Vadose Zone Soil | LVSSERGDLQYEFIEITEDEADQIVARIRAEVTGTSNA* |
| Ga0137386_109957251 | 3300012351 | Vadose Zone Soil | VSAERGDLANEFIEITEDEANQIVERIRARVTGASNG* |
| Ga0137361_106183303 | 3300012362 | Vadose Zone Soil | LVWKRTVLLVSAERGDLQNEFIEITEDEANQIVERIRATVTGGGH* |
| Ga0137390_120020982 | 3300012363 | Vadose Zone Soil | WKSSSTLVSAERGDLENEFIEITEAEATQIVERIRAKVTGASSA* |
| Ga0137397_110245861 | 3300012685 | Vadose Zone Soil | LIAAERGDLQYDFIEITEDEANQIVARIRAEVTGASNA* |
| Ga0164299_100789372 | 3300012958 | Soil | LVSSERGDLQYEFIEINEDEANQVVARIRADVTGRSSA* |
| Ga0164299_116657552 | 3300012958 | Soil | SAERGDLQNDFIEITEDEANQLVERIRARITGIR* |
| Ga0164301_100718684 | 3300012960 | Soil | LVSSERGDLQYEFIEINENEANQVVARIRAEVTGRSSA* |
| Ga0164305_100928712 | 3300012989 | Soil | LVSSERGDLQYEFVEISEDEANQVVARIRAEVTGRSSA* |
| Ga0164305_119392891 | 3300012989 | Soil | ERGDLQYEFIEITEDEANQIVARIRAEVTGTSNA* |
| Ga0157373_101973043 | 3300013100 | Corn Rhizosphere | LVSSERGDLQYEFIEINEDEANQVVARIRAEVTGRSSA* |
| Ga0182030_1001231916 | 3300014838 | Bog | SAERGDLQNEFIEITEDEANQIVDRIRAKVAGASNG* |
| Ga0137409_113531542 | 3300015245 | Vadose Zone Soil | SASLVSAERGDLLNEFLEITEDEANQIVARIRAEVTGTSNA* |
| Ga0182037_107759392 | 3300016404 | Soil | FSPLLISAERGDLQNEFIEITEDEANQIVERIRATVTGSNSS |
| Ga0187812_10514661 | 3300017821 | Freshwater Sediment | WEFSPSLLSAERGDLQNEFVEITEDEANQIVDRIRATVTGANSS |
| Ga0187807_10962572 | 3300017926 | Freshwater Sediment | LVSAERGDLENEFIEITEDEANRIVDRIRATVTGANDS |
| Ga0187808_100461301 | 3300017942 | Freshwater Sediment | SLLSAERGDLLNEFVEITEDEANQIVDRIRATVTGANSS |
| Ga0187808_100720502 | 3300017942 | Freshwater Sediment | ALSPSLATADGGDLQNEFIEITEDEANQIVDRIRATVTGASNS |
| Ga0187808_104717502 | 3300017942 | Freshwater Sediment | WEFSPSLVSAERGDLQNEFIEITEDEANQIVDRIRATVTGADGR |
| Ga0187819_105631191 | 3300017943 | Freshwater Sediment | SASLVSAERGDLLNQFIEITEDEANQIVERIRARVTGASSA |
| Ga0187847_102289482 | 3300017948 | Peatland | DLVWEFSPELISAERGDLQYEFIEITETEASEIVERIRARVTGASNG |
| Ga0187776_111458872 | 3300017966 | Tropical Peatland | TALLVSAERGDLKNEFIEITEDEANLIVERIRAKVTGSGDS |
| Ga0187776_114919022 | 3300017966 | Tropical Peatland | SAERGNLDNEFIEITEDEANQIVARIRAKVTGTSNG |
| Ga0187780_109824962 | 3300017973 | Tropical Peatland | VSAERGDLQNEFIEISEDEANQIVSRIRADVTGASSA |
| Ga0187815_103947221 | 3300018001 | Freshwater Sediment | SLVWKHTALLVSAERGDLKNEFVEITEDEANQIVERIRATVTGGTSDN |
| Ga0187855_103158063 | 3300018038 | Peatland | WERSASLVSAERGDLQNEFIEITETEASEIVERIRATVTG |
| Ga0187784_114902911 | 3300018062 | Tropical Peatland | LVWKHTALLVSAERGDLQNKFIEISEDEANQIVERIRATVTGGSGS |
| Ga0187769_104031793 | 3300018086 | Tropical Peatland | HLNWERTAMLVSAERGDLQNEFIEITEDEANRIVERIRAEVTSAGND |
| Ga0187769_105290511 | 3300018086 | Tropical Peatland | LVSAERGDLQNEFIEITEDEADQIVERIRATVTGAGNG |
| Ga0187769_112558851 | 3300018086 | Tropical Peatland | AERGDLENEFIEITEDEADQIVDRIRATVTGTDGR |
| Ga0210395_108289041 | 3300020582 | Soil | LIAAERGDLQYDFIEITEDEANQIVARIRAKVTGTGNA |
| Ga0210395_109331831 | 3300020582 | Soil | SLLSAERGDLQNEFIEITEGEANQIVDRIRATVTGTGNG |
| Ga0210393_116211012 | 3300021401 | Soil | LVSAERGDLQNEFVEIGEEEAERIVARIRASVAGG |
| Ga0210394_111269941 | 3300021420 | Soil | ERTAMLVSAERGDLDNEFIEITEEEANQIVARIRADVTRANGT |
| Ga0210384_105164863 | 3300021432 | Soil | VSLVSAERGDLQNEFIEITEDEANQIVDRIRATVTGAGNS |
| Ga0210391_112984743 | 3300021433 | Soil | WQRTPLLVSAERGDLKNEFIEITEGEANQIVDRIRTTVTGTSNG |
| Ga0210390_104315332 | 3300021474 | Soil | SPALIAAERGDLQNEFIEISEAEANRIVERIRTEVTGNPSSGSQ |
| Ga0210398_105956681 | 3300021477 | Soil | ERTALLVSAERGDLVNEFIEITETEANEIVERIRATVTGASKP |
| Ga0210402_120262641 | 3300021478 | Soil | ASLVSAERGDLLNEFIEITEDEADQIVARIRAEVTGTSHG |
| Ga0213853_102290942 | 3300021861 | Watersheds | SAERGDLQYEFIEISEDEANRIVERIRAAITGANNG |
| Ga0242662_101777342 | 3300022533 | Soil | WERTAMLVSSERGDLQYEFIEITEDEANQIVARIRAEVTGASDA |
| Ga0207695_106754431 | 3300025913 | Corn Rhizosphere | SLISAERGDLQNEFVEITEDEANQIVARIRARVTGQSTAKDA |
| Ga0207663_102350743 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LISAERGDLQNEFFEITEDEANQIVARIRARVTGQSTAKDA |
| Ga0207660_111369131 | 3300025917 | Corn Rhizosphere | ERGDLQNEFVENTEDEANQIVARIRARVTGQSTAKDA |
| Ga0207665_100189052 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LVSYERGDLQYEFIEITEDEANQIVARIRAEVTGTSNA |
| Ga0207683_102932754 | 3300026121 | Miscanthus Rhizosphere | LAWERTSLLVSSERGDLQYEFIEINEDEANQVVARIRAEVTGRSSA |
| Ga0209648_107932042 | 3300026551 | Grasslands Soil | MLVSAERGDLDNEFIEITEEEANQIVARIRADVTGANGS |
| Ga0209177_100241461 | 3300027775 | Agricultural Soil | SSERGDLQYEFIEISEDEANQVVARIRGEVTGTGNA |
| Ga0209624_107720342 | 3300027895 | Forest Soil | PALIAAERGDLQNDFIEITEDEANQIVESIRARVAGASGT |
| Ga0209006_104046583 | 3300027908 | Forest Soil | SAERGDLQNEFIEITEAEANQIVDRIRVTVTGASNS |
| Ga0209006_112162372 | 3300027908 | Forest Soil | SSERGDLQNEFVEITEEEANQIVARFRADVTDGSST |
| Ga0209526_100816343 | 3300028047 | Forest Soil | VSAERGDLLNEFIEITEDEASQIVARIRAKVTGASNG |
| Ga0268266_110908442 | 3300028379 | Switchgrass Rhizosphere | EYSTSLISAERGDLQNEFVEITEDEANQIVARIRARVTGQSTAKDA |
| Ga0302225_105466562 | 3300028780 | Palsa | LVSAERGDLANEFIEITEAEANEIVERIRATVTGTSNG |
| Ga0302232_101357411 | 3300028789 | Palsa | RDLIWERTALLVSAERGDLVNEFIEITEAEADEIVERIRATVTGTGNG |
| Ga0302226_103974611 | 3300028801 | Palsa | AERGDLVNEFIEITETEANEIVERIRATVTGTSNG |
| Ga0302221_105124421 | 3300028806 | Palsa | LISAERGDLQNDFIEITVDEADQIVERIRTRVTGASNG |
| Ga0307312_105247302 | 3300028828 | Soil | ERTSLLVSSERGDLQYEFIEISEDEANQVVARIRTEVTGTGNA |
| Ga0308309_107186972 | 3300028906 | Soil | VSAERGDLKNEFIEITEGEANQIVDRIRATVTGTSNG |
| Ga0308309_109900171 | 3300028906 | Soil | VWKRTVLLVSAERGDLQNEFIEITEDEANQLVERIRAKVTGASNG |
| Ga0311339_101335431 | 3300029999 | Palsa | LVSAERGDLVNEFIEITETEANEIVERIRATVTGTSNG |
| Ga0311338_111499831 | 3300030007 | Palsa | AERGDLQNEFIEITEAEADGIVERIRATVTGSSNG |
| Ga0311353_112014322 | 3300030399 | Palsa | TAMLVSAERGDLDNEFIEITEEEANQIVARIRADVTGASST |
| Ga0311353_114911702 | 3300030399 | Palsa | VSAERGDLLNEFIEITETEANEIVERIRARVTGAGNS |
| Ga0311357_113010031 | 3300030524 | Palsa | RWEYSTTLISSERGDVQNEFIEITAEEANRIEARIRTEVTGATSG |
| Ga0311356_109034683 | 3300030617 | Palsa | LVSAERGDLVNEFIEITEAEGNEIVERIRATVTGTGNG |
| Ga0311354_109714053 | 3300030618 | Palsa | SWLLVSAERGDLVNEFIEITETEANEIVGRIRATVTGASKG |
| Ga0265459_141312991 | 3300030741 | Soil | SASLVSAERGDLQNEFIEITEEEANAIVERIRATVTG |
| Ga0302314_109239361 | 3300030906 | Palsa | WERTALLVSAERGDLVNEFIEITEAEGNEIVERIRATVTGTGNG |
| Ga0170824_1176724482 | 3300031231 | Forest Soil | AERGDLQNDFVEITEDEANQIVERIRAKVTGASNA |
| Ga0302325_111644781 | 3300031234 | Palsa | WERSASLVSAERGDLQNEFIEITEAEADGIVERIRATVTGSSNG |
| Ga0302325_130281992 | 3300031234 | Palsa | DLAWERATLLVSAERGDLTNEFIEITEDEANQIVAGIRTAVASANND |
| Ga0302324_1001463841 | 3300031236 | Palsa | TSLISAERGDLQNEFIEITETEANEIVERIRARVTGAGNS |
| Ga0302326_116075331 | 3300031525 | Palsa | ERTALLVSAERGDLVNEFIEITEAEANEIVERIRATVTGMRNG |
| Ga0318573_102162342 | 3300031564 | Soil | EFSPSLVSAERGDLLNEFIEVTEDEANQIVERIRATVTGSNSS |
| Ga0318572_105300122 | 3300031681 | Soil | SLVSAERGDLENEFVEITEDEANQIVDRIRATVPGANDSHRN |
| Ga0307476_100912801 | 3300031715 | Hardwood Forest Soil | AEHGDLQNEFVEITEEEAERIVARIRADVTGTEGA |
| Ga0307475_106219422 | 3300031754 | Hardwood Forest Soil | IWERSVSLVSAERGDLQNEFIEITEGEANQIVDRIRATITGTSNS |
| Ga0318546_111006441 | 3300031771 | Soil | AERGDLQNEFIEITEDEANQIVERIRAKVTGTSNA |
| Ga0318557_102950391 | 3300031795 | Soil | VSAERGDLKNEFIEITEDEANQIVDRIRATVTGANGS |
| Ga0318527_103126292 | 3300031859 | Soil | TSLVSAERGDLLNEFIEITEDEANQIVERIRARVTGASNG |
| Ga0306923_121531861 | 3300031910 | Soil | ERTAMLVSAERGDLDHEFIEITEEEANQIVARIRADVTGASSA |
| Ga0306922_104664903 | 3300032001 | Soil | LISAERGDLDNKFIEITEDEANQIVERIRAKVTGTNNA |
| Ga0318533_108846852 | 3300032059 | Soil | LVSAERGDLLNEFIEITEDEANQIVERIRATVTGSNSC |
| Ga0311301_120283511 | 3300032160 | Peatlands Soil | ASLVSAERGDLQNEYIEITEDEANQIVARIRTTVTGANNG |
| Ga0306920_1012160282 | 3300032261 | Soil | SWSLASAERGDLENEFIEITEDEANQIVDRIRATVTGANGK |
| Ga0335081_109486863 | 3300032892 | Soil | PELIAAERGDLQYEFFEITKDEANEIVERIRAEVTGTSNA |
| Ga0335069_100243611 | 3300032893 | Soil | RDRINLDNEFIEITEDEANQIVARIRAKVTGTSNG |
| Ga0335069_121667201 | 3300032893 | Soil | ELISAERGDLEFEFVEISPDEASQIVARIRAEVTGTGSA |
| Ga0335075_114707601 | 3300032896 | Soil | SAERGDLQNEFIEITEDEANRIVERIRADVTGTSST |
| Ga0335077_107061871 | 3300033158 | Soil | WERSASLVSAERGDLLNEFIEITEDEANQIVARIRAEATGTSNA |
| Ga0334804_001111_15793_15909 | 3300033818 | Soil | LVSAERGDLQNEFIEITEDEANQIVDRIRAKVAGASNG |
| ⦗Top⦘ |