NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069403

Metagenome / Metatranscriptome Family F069403

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069403
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 43 residues
Representative Sequence MASERVLEVPVRRHVLDSERPFSAVLDGIFGGISQPDIGLLF
Number of Associated Samples 109
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 92.74 %
% of genes near scaffold ends (potentially truncated) 94.35 %
% of genes from short scaffolds (< 2000 bps) 94.35 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.355 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(26.613 % of family members)
Environment Ontology (ENVO) Unclassified
(28.226 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.613 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.14%    β-sheet: 0.00%    Coil/Unstructured: 82.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF12697Abhydrolase_6 52.42
PF13191AAA_16 4.84
PF00005ABC_tran 4.84
PF00230MIP 2.42
PF01569PAP2 1.61
PF01934HepT-like 0.81
PF00753Lactamase_B 0.81
PF13472Lipase_GDSL_2 0.81
PF03625DUF302 0.81
PF00378ECH_1 0.81
PF13474SnoaL_3 0.81
PF08388GIIM 0.81
PF13399LytR_C 0.81
PF02594DUF167 0.81
PF01609DDE_Tnp_1 0.81
PF13561adh_short_C2 0.81
PF06441EHN 0.81
PF00535Glycos_transf_2 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 2.42
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.81
COG1872Uncharacterized conserved protein YggU, UPF0235/DUF167 familyFunction unknown [S] 0.81
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.81
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 0.81
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.81
COG3293TransposaseMobilome: prophages, transposons [X] 0.81
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.81
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 0.81
COG5421TransposaseMobilome: prophages, transposons [X] 0.81
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.81
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.35 %
UnclassifiedrootN/A5.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459005|F1BAP7Q02IB50SAll Organisms → cellular organisms → Bacteria510Open in IMG/M
3300003505|JGIcombinedJ51221_10089140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1218Open in IMG/M
3300003505|JGIcombinedJ51221_10315301All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300005093|Ga0062594_101414597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30707Open in IMG/M
3300005344|Ga0070661_100435687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw301041Open in IMG/M
3300005366|Ga0070659_102020782All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30518Open in IMG/M
3300005435|Ga0070714_101307894All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300005437|Ga0070710_11127704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia577Open in IMG/M
3300005439|Ga0070711_100861905All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300005445|Ga0070708_100197306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1883Open in IMG/M
3300005456|Ga0070678_102045609All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005591|Ga0070761_10532693All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005591|Ga0070761_10896076All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300005591|Ga0070761_11004110All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300005602|Ga0070762_10570456All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300005610|Ga0070763_10734443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium580Open in IMG/M
3300005712|Ga0070764_10434351All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300005834|Ga0068851_10655820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30643Open in IMG/M
3300005843|Ga0068860_100325679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1508Open in IMG/M
3300005921|Ga0070766_11118704All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300006028|Ga0070717_11910286All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30536Open in IMG/M
3300006052|Ga0075029_100574139All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300006162|Ga0075030_101117518Not Available620Open in IMG/M
3300006163|Ga0070715_10085110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1443Open in IMG/M
3300006175|Ga0070712_100130815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1902Open in IMG/M
3300006358|Ga0068871_100590597All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300009545|Ga0105237_12415361All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300009624|Ga0116105_1126763All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300009634|Ga0116124_1204719All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300010360|Ga0126372_11555880Not Available699Open in IMG/M
3300010371|Ga0134125_10237021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2028Open in IMG/M
3300010371|Ga0134125_11490782Not Available737Open in IMG/M
3300010376|Ga0126381_102639124All Organisms → cellular organisms → Bacteria → Terrabacteria group719Open in IMG/M
3300010876|Ga0126361_10590972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acidicola506Open in IMG/M
3300011271|Ga0137393_11672321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia526Open in IMG/M
3300012189|Ga0137388_11143563All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300013105|Ga0157369_10950053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria881Open in IMG/M
3300013307|Ga0157372_10227273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2163Open in IMG/M
3300014162|Ga0181538_10127702All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300014164|Ga0181532_10121717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-25681599Open in IMG/M
3300014200|Ga0181526_10639076All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300016294|Ga0182041_11441229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300016319|Ga0182033_11888675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300017821|Ga0187812_1091960All Organisms → cellular organisms → Bacteria995Open in IMG/M
3300017928|Ga0187806_1037403All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300017928|Ga0187806_1200247Not Available676Open in IMG/M
3300018019|Ga0187874_10455764All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300019268|Ga0181514_1572033All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300020580|Ga0210403_11096528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300020581|Ga0210399_10030029All Organisms → cellular organisms → Bacteria4338Open in IMG/M
3300020583|Ga0210401_10523255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw301048Open in IMG/M
3300021170|Ga0210400_10359413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1199Open in IMG/M
3300021178|Ga0210408_10322715All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300021180|Ga0210396_10215032All Organisms → cellular organisms → Bacteria1714Open in IMG/M
3300021180|Ga0210396_11247626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300021180|Ga0210396_11689473All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300021358|Ga0213873_10311296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acidicola510Open in IMG/M
3300021402|Ga0210385_11283472All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300021404|Ga0210389_10573175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30887Open in IMG/M
3300021406|Ga0210386_10066591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2890Open in IMG/M
3300021474|Ga0210390_11635809All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300021559|Ga0210409_10799907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia816Open in IMG/M
3300021559|Ga0210409_11057091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola686Open in IMG/M
3300021560|Ga0126371_11043079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30958Open in IMG/M
3300021861|Ga0213853_11051133All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300022500|Ga0242643_115803All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300022523|Ga0242663_1023923All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300022523|Ga0242663_1031178All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300022525|Ga0242656_1103759All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300022722|Ga0242657_1060638All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300022726|Ga0242654_10129137All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300022726|Ga0242654_10306357All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300024245|Ga0247677_1045401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30639Open in IMG/M
3300024271|Ga0224564_1034486All Organisms → cellular organisms → Bacteria959Open in IMG/M
3300025320|Ga0209171_10264557All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300025414|Ga0208935_1035092All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300025906|Ga0207699_11156151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30573Open in IMG/M
3300025910|Ga0207684_10450442All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300025916|Ga0207663_10110356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1866Open in IMG/M
3300025916|Ga0207663_11346605All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300025917|Ga0207660_11114676Not Available643Open in IMG/M
3300025936|Ga0207670_11705432All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300026078|Ga0207702_11186905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300026116|Ga0207674_10068369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3575Open in IMG/M
3300026489|Ga0257160_1098141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30527Open in IMG/M
3300027029|Ga0208731_1023351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30668Open in IMG/M
3300027047|Ga0208730_1015359All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300027066|Ga0208236_1005946All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola769Open in IMG/M
3300027119|Ga0209522_1037312All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300027165|Ga0208608_111383All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300027171|Ga0207947_1009456All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300027504|Ga0209114_1106845All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300027635|Ga0209625_1027896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1255Open in IMG/M
3300027692|Ga0209530_1129768All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300027767|Ga0209655_10301756All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300027775|Ga0209177_10064195All Organisms → cellular organisms → Bacteria → Terrabacteria group1079Open in IMG/M
3300027775|Ga0209177_10370771All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium566Open in IMG/M
3300027787|Ga0209074_10232617All Organisms → cellular organisms → Bacteria → Terrabacteria group708Open in IMG/M
3300027812|Ga0209656_10096607Not Available1559Open in IMG/M
3300027812|Ga0209656_10234165All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300027884|Ga0209275_10299475All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola892Open in IMG/M
3300027889|Ga0209380_10043526All Organisms → cellular organisms → Bacteria2545Open in IMG/M
3300028381|Ga0268264_10433256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1270Open in IMG/M
3300028906|Ga0308309_10569048All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300028906|Ga0308309_10635876All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300030056|Ga0302181_10376576All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300030524|Ga0311357_11365792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia605Open in IMG/M
3300030872|Ga0265723_1004892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola779Open in IMG/M
3300031090|Ga0265760_10114991All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300031474|Ga0170818_114121231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30579Open in IMG/M
3300031640|Ga0318555_10495520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300031708|Ga0310686_119676506All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300031723|Ga0318493_10683846Not Available575Open in IMG/M
3300031771|Ga0318546_10430979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria922Open in IMG/M
3300031782|Ga0318552_10242130All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300031782|Ga0318552_10368556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia732Open in IMG/M
3300031792|Ga0318529_10173413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria997Open in IMG/M
3300031823|Ga0307478_10933364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia726Open in IMG/M
3300031894|Ga0318522_10169831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia824Open in IMG/M
3300031947|Ga0310909_10517617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300032067|Ga0318524_10451222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria673Open in IMG/M
3300032783|Ga0335079_11286183All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300032805|Ga0335078_10001727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia33003Open in IMG/M
3300033290|Ga0318519_10224722All Organisms → cellular organisms → Bacteria1079Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil26.61%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil8.87%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil8.87%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.06%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.23%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.42%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.42%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.42%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.42%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.61%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.61%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.61%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.61%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.81%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.81%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459005Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009634Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021358Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022500Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022525Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022726Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024245Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18EnvironmentalOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025414Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300027029Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes)EnvironmentalOpen in IMG/M
3300027047Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes)EnvironmentalOpen in IMG/M
3300027066Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes)EnvironmentalOpen in IMG/M
3300027119Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027165Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF035 (SPAdes)EnvironmentalOpen in IMG/M
3300027171Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030872Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E41_066919402170459005Grass SoilVASEQVLDIPVRRHVLTSERPFQVVLDGIFGGISQPDIGA
JGIcombinedJ51221_1008914033300003505Forest SoilMASEQVVDVLVRRHVFDTDRPFADILDGVFGGISQPDIEL
JGIcombinedJ51221_1031530123300003505Forest SoilMSSERVLEVPLCRHILDSERPFASVLDGIFGGISQPDVGLLFS
Ga0062594_10141459713300005093SoilMASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISQPDIEA
Ga0070661_10043568723300005344Corn RhizosphereMASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISQPDIEALFSKLAARTS
Ga0070659_10202078223300005366Corn RhizosphereMASEQVLEVPLRRHVFDSERPFAAVLDGIFGGISQPDIEALFSKLAA
Ga0070714_10130789423300005435Agricultural SoilMASEQVLDVSMRRHVFDSERPFSSVLDGIFDGISQPDIGLLFSKLA
Ga0070710_1112770413300005437Corn, Switchgrass And Miscanthus RhizosphereMASQRVLEILMRRHVFDSERPFASVLDGVSGGISQPDIGQLFSKLA
Ga0070711_10086190513300005439Corn, Switchgrass And Miscanthus RhizosphereMATEEVLDVLIRRHVIDSQRPFSAVLDSIFGGISQPDIEA
Ga0070708_10019730623300005445Corn, Switchgrass And Miscanthus RhizosphereMASEQVLDVAVRRHVLTSERPFQVVLDGIYDGISQPDIGALFATLAASLPLSRGW*
Ga0070678_10204560923300005456Miscanthus RhizosphereVASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIEALFATLAAST
Ga0070761_1053269313300005591SoilVASEQVLDIPVRRHVLTSERPFPVVLDGIYDGISQPDIGALFATLAASTSYA
Ga0070761_1089607623300005591SoilVASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIGALFATLAASTSY
Ga0070761_1100411013300005591SoilMASERVLEVPVRRHVLDSERPFSAVLDGIFGGISQPDIGLLFSKL
Ga0070762_1057045623300005602SoilVASEHVLDVLVRRHVFDSERPFLDVLDAIFGGISQPDIEALFGKL
Ga0070763_1073444313300005610SoilLASEEVLDVLVRRHVIDSDRPFSSVLDGIFGGITRPDI
Ga0070764_1043435123300005712SoilMASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPD
Ga0068851_1065582023300005834Corn RhizosphereMASEQVLEVPLRRHVFDSERPFAAVLDGIFGGISQPDIEA
Ga0068860_10032567913300005843Switchgrass RhizosphereMASEQVLEVPMRRHVFDSERPFAAVLDGIFGGISQPDIEALFS
Ga0070766_1111870423300005921SoilVNPVASEQVLDIPVRRHVLTSERPFTVVLDGIYDGISQPDIEALLA
Ga0070717_1191028613300006028Corn, Switchgrass And Miscanthus RhizosphereMASEHVLEVLMRRHVFNSERPFATVLDGIYGGISQPDIGQLFSKLAAS
Ga0075029_10057413923300006052WatershedsMASEHVLEVPVRRHVLDTERPFSAILDGVFGGISQPDIGLLFSQLTASTSYQE
Ga0075030_10111751833300006162WatershedsMPSECVLEVLVRRHVFDSERPFLDVLDAIFGGISRPDIEALFGQLAAST
Ga0070715_1008511013300006163Corn, Switchgrass And Miscanthus RhizosphereMASEQVLEVSVRRHVLDSDRSFSDVLNGVYGGISQPDIGQLFSRL
Ga0070712_10013081513300006175Corn, Switchgrass And Miscanthus RhizosphereMATEHVLEIPVRRYIIESERTFASVLDGIFGGISR
Ga0068871_10059059713300006358Miscanthus RhizosphereVASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIEALF
Ga0105237_1241536113300009545Corn RhizosphereVASEQVLDVVMRRHIFDTDRPFQAVLDGIFDGISRPDIG
Ga0116105_112676323300009624PeatlandVASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIGALF
Ga0116124_120471913300009634PeatlandVASEQVLDIPVRHHVLTSERPFQVVLDGIYAGISQ
Ga0126372_1155588023300010360Tropical Forest SoilMVTEHVLEVPVRRHIIESERPFATVLDGIFGGISQPDIGPLFSDLEAS
Ga0134125_1023702143300010371Terrestrial SoilMGSEQVLEVLTRRHVFDSERPFSSVLEGIFGGISQPDIGLLFSQL
Ga0134125_1149078223300010371Terrestrial SoilMATEHVLEIPVRRYIIESERTFASVLDGIFGGISRPDVGPLFSDLEAST
Ga0126381_10263912413300010376Tropical Forest SoilMASEQVLEVLVRRHVFDSERPFPAVLEGIFGGISEPDIGQLFSKLEAST
Ga0126361_1059097213300010876Boreal Forest SoilVAVEQVLVVPIHRHIIESERPFGNVMDGIFDGISRPDIRSLFSDLE
Ga0137393_1167232123300011271Vadose Zone SoilMVSENVIQVLVRRHVIHSGRPFSAVLDGIFGGISRPDIG
Ga0137388_1114356313300012189Vadose Zone SoilVASEQVLDIPVRRHVLTSERPFQVVLDGIFGGISQPDI
Ga0157369_1095005323300013105Corn RhizosphereMATEHALEVPVRRHFIESEQPFASVLDGIFGGVSRPDIGPLFSDLEASTSY
Ga0157372_1022727313300013307Corn RhizosphereMASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISQPDIEALFSKLA
Ga0181538_1012770223300014162BogVASEQVLDIPVRHHVLTSERPFQVVLDGIYAGISQPDIGALFA
Ga0181532_1012171733300014164BogVASKQVLDIPVRRHVLTSERPFQDVLDGIYGGISQPDIGALFATLAPS
Ga0181526_1063907623300014200BogVASEQVLDIPVRRHVLTSEQSFQVVLDGIYDGISQPDIGALFARLAAS
Ga0182041_1144122923300016294SoilVGSENVMEVLVRRHVIDTERPFPDVLDGIWGGISQP
Ga0182033_1188867523300016319SoilDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR
Ga0187812_109196023300017821Freshwater SedimentMATEQVLDVVVRRHVLDSDRPFQAVLDGIFGGITRPDIDA
Ga0187806_103740313300017928Freshwater SedimentVASEQVLDIPVRRHVLTSERPFQDVLDGIYGGISQPDIG
Ga0187806_120024713300017928Freshwater SedimentMATEQVLEVSIRRHIIESERPFAKVMDGIFGGISRGAGAV
Ga0187874_1045576423300018019PeatlandVASEHVLDIPVRRHVLTSERPFQVVLDGIYDGISQPD
Ga0181514_157203313300019268PeatlandVASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQTDIGALFATLAASTSYA
Ga0210403_1109652813300020580SoilMATEHVLEVAVRRHIIESERPFASVLDGIFGGISRPDIGPLFRDL
Ga0210399_1003002913300020581SoilVASEHVLDIPVRRHVLTSGRPFQVVLDGIYAGISQPGIGTLF
Ga0210401_1052325513300020583SoilMGSEQVLDVAVRRHVFDSELPFQAVLDGIFGGISRP
Ga0210400_1035941313300021170SoilMGSEQVLDVAVRRHVFDSELPFQAVLDGIFGGISQP
Ga0210408_1032271513300021178SoilMASEQVLDVAVRRHIFTSEWPFQVVLDGIFGGISQTSGR
Ga0210396_1021503233300021180SoilVASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIGALFATLAAS
Ga0210396_1124762623300021180SoilVASEQVLVIPVRRHALTSERPFQFVLDGIYDGISQPDIGALFATLAASTS
Ga0210396_1168947323300021180SoilVASEQVLDIPVRRHVLTSERPFQVVLDGIYAGISQPDIGAL
Ga0213873_1031129623300021358RhizosphereMESEQVLDVPIRRYIIESERSFPDVLDGIFGGISRPDITSLFGDLEASTS
Ga0210385_1128347213300021402SoilVASEQVLDIPVRRHVLTSERPFQVVLDGIYGGISQPDIGALFARLAASTS
Ga0210389_1057317523300021404SoilMGSEQVLDVAVRRHVFDSQLPFQAVLDGIFGGISQPD
Ga0210386_1006659113300021406SoilMGSEQVLDVAVRRHVFDSELPFQAVLDGIFGGISRPD
Ga0210390_1163580913300021474SoilVASEQVLDISVRRYVLTSERPFQVVLDGIFGGISQPDIGALFAKL
Ga0210409_1079990713300021559SoilMATEHVLEVAVRRHIIESERPFASVLDGIFGGISRPDIGPLSRDL
Ga0210409_1105709123300021559SoilMASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRP
Ga0126371_1104307913300021560Tropical Forest SoilMGSERVLDVALRRHVFDSEVPFQAVVNGIFSGISQPDIDALFGK
Ga0213853_1105113323300021861WatershedsMATEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITR
Ga0242643_11580323300022500SoilVNQVASERVLDVLVRRHVFESEQPFLDVLDAIFGGISQPDIE
Ga0242663_102392323300022523SoilMESEHVLEVTVRRHVIDSERPFATVLRGIFDGISQPDIEKLFGQLAA
Ga0242663_103117813300022523SoilMASERVLEIPVRRHVLDSERPFSDVLDGIFGGISQPDIGLLFS
Ga0242656_110375923300022525SoilVASEHVLDVLVRRHVFDSERPFPDVLDAIFGGISQPDIEALFGKLAASTS
Ga0242657_106063823300022722SoilMASERVLEVPVRRHVLDSERPFSAVLDGIFGGISQPDIGLLF
Ga0242654_1012913713300022726SoilVASEHVLDVLVRRHVFDSERPFPDVLDAIFGGISQPDIEAL
Ga0242654_1030635713300022726SoilVNQVASERVLDVLVRRHVFESEQPFLDVLDAIFGGISQPDIEALFGKLAA
Ga0247677_104540123300024245SoilMASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISHPDIE
Ga0224564_103448623300024271SoilMASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPDIGALFGKL
Ga0209171_1026455713300025320Iron-Sulfur Acid SpringVASEQVLDIPVRRHVFTSERPFQVVLDGIYTGISQPDLGALFA
Ga0208935_103509213300025414PeatlandVASEQVLDIPVRHHVLTSERPFQVVLDGIYAGISQPDIGALFAKLAA
Ga0207699_1115615113300025906Corn, Switchgrass And Miscanthus RhizosphereMASEQVLEVPMRRHVFDSERSFAAVLDGIFGGISQPDIEALFSK
Ga0207684_1045044213300025910Corn, Switchgrass And Miscanthus RhizosphereVASEQVLDIPVRRHVLTSERSFRVVLDGIYDGISQPDIGALFATLAASTSY
Ga0207663_1011035613300025916Corn, Switchgrass And Miscanthus RhizosphereMASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISHPD
Ga0207663_1134660523300025916Corn, Switchgrass And Miscanthus RhizosphereMGSEQVLEVLTRRHVFDSERPFSNVLEGIFGGSCRTAE
Ga0207660_1111467613300025917Corn RhizosphereMASEQVLEVSVRRHILDSDRPFSDVLNGVYGGISQPDIGQLFSRLAATP
Ga0207670_1170543213300025936Switchgrass RhizosphereMASEQLLDVAVRRHIFTSERPFADVLDGIFAGISQPDIGALFAKLAASTSY
Ga0207702_1118690513300026078Corn RhizosphereMATEHALEVPVRRHFIESEQPFASVLDGIFGGVSRPDIGPL
Ga0207674_1006836933300026116Corn RhizosphereMASEQVLEVPLRCHVFDSERPLAAVLDGIFGGISQPDIEALFSKL
Ga0257160_109814113300026489SoilMASEQVLEVLMRSHTFDSERPFDSVLDGIFGGISQ
Ga0208731_102335113300027029Forest SoilMGSEQVLDVAVRRHVFDSELPFQAVLDGIFGGISQPDIESLFGKL
Ga0208730_101535923300027047Forest SoilMATEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPDIGALF
Ga0208236_100594613300027066Forest SoilVASEQVLDISVRRHVLTSERPFQAVLDGIYEGISQPDIGALFARLAVIS
Ga0209522_103731213300027119Forest SoilMATEQVIEVPLRRYVIDSERSISAVLDGIFGGISQPDVPSLFAKLAA
Ga0208608_11138313300027165Forest SoilMASERVLEIPVRRHVLDSERPFSDVLDGIFGGISQPDIGLLF
Ga0207947_100945613300027171Forest SoilVASEHVLDVLVRRHVFDSERPFPDVLDTIFGGISQPD
Ga0209114_110684513300027504Forest SoilVASEQVLDIPVRRHVLTSERPFQDVLDGIYGGISQPDIGALFTRLASS
Ga0209625_102789633300027635Forest SoilREKPVASERVLDIAVRRHVLTSKQPFQVILDGIYAGIGQPDIGALFAKLAAAL
Ga0209530_112976823300027692Forest SoilVASEQVLDIPVRRHVLTSDRPFQVVLDGIYGGISQPDIGALFAT
Ga0209655_1030175613300027767Bog Forest SoilVASEHVLDIPVRRHMLTSDRPFQAVLDGIYGGISQPDIGALF
Ga0209177_1006419513300027775Agricultural SoilMGTTSEDVLEVLVRRHVFASERPFPAVLDGIFGGISRPDIEVLDL
Ga0209177_1037077123300027775Agricultural SoilVVELVLDVLVRRNVFDSERPFPDVLDAIFGGISQPDIEALFGK
Ga0209074_1023261713300027787Agricultural SoilMGVVSENVLKVLVHRHVFDSDRPFSAVLDGIFGGIS
Ga0209656_1009660713300027812Bog Forest SoilMATEQVLEVSIRRHIIESERPFANVLDGIFGGISRPDTGALFSDLEASI
Ga0209656_1023416513300027812Bog Forest SoilVASEQVLDIPVRRHVLTSERPFQVVLDGIYAGISQPD
Ga0209275_1029947513300027884SoilMPSERVLDVPLRRHVLDSERPFSAVLDGIFGGISQPDIGLLFTKLAAS
Ga0209380_1004352633300027889SoilMASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPDIGALFGKLA
Ga0268264_1043325633300028381Switchgrass RhizosphereMASEQVLEVPLRRHVFDSERPFAAVLDGIFGGISQPDI
Ga0308309_1056904823300028906SoilVASEHVLHIPVRRHVLTSERPFQVVLDGIYTGNSQPDLGALFATLAASTSYEE
Ga0308309_1063587623300028906SoilVASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDTGALF
Ga0302181_1037657613300030056PalsaVAPEQAFEVVVRRHVLTSDRPFQVVLDGIYGGISQPDIGALFARL
Ga0311357_1136579213300030524PalsaMASEQVLEIVVRRHIFTSNQPFPAVLDGIFGAISQPDIGQLFS
Ga0265723_100489213300030872SoilVASEEVLDIPVRRHVLTSERPFPVVLDGIYGGISQPDIGALFALAA
Ga0265760_1011499123300031090SoilMASEQVLDVVVRRHVFDSDRPFEAVLDGIFGGITRPDIGPLLGKLAAS
Ga0170818_11412123123300031474Forest SoilMASEQVLEVPMRRHVFDTERPFAAVLDGIFGGISQPD
Ga0318555_1049552023300031640SoilGCASMETMAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR
Ga0310686_11967650623300031708SoilMSQMASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPDIGPLLGKLAAS
Ga0318493_1068384613300031723SoilMKSEHALDVVVRRHVFASDRPFDQVLAGIFGGISQPDIA
Ga0318546_1043097913300031771SoilEQVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR
Ga0318552_1024213023300031782SoilVGSENVMEVLVRRHVIDTERPFPDVLDGIWGGISQPDIDALFSTL
Ga0318552_1036855613300031782SoilMETMAAEQVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR
Ga0318529_1017341323300031792SoilMETMAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR
Ga0307478_1093336423300031823Hardwood Forest SoilMASEHVLEVLVRRHVLDSERPFAAVLDGIYQGISRPDIGALFGQLAASGSF
Ga0318522_1016983123300031894SoilMETMAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITT
Ga0310909_1051761723300031947SoilMAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR
Ga0318524_1045122213300032067SoilRCPDPGGCASMETMAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR
Ga0335079_1128618323300032783SoilMASEQVLDVAVRRHVLTSERPFADVMDGIFAGISRPDIGALFAK
Ga0335078_10001727143300032805SoilMATEQVLQVPIRRYTFESERPFVNVLDGIFGGISQPDTGRC
Ga0318519_1022472223300033290SoilMATEHVLEVPVRRHIIDSGQPFASVLDGIFGGISQPDIGPLFSDLEA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.