| Basic Information | |
|---|---|
| Family ID | F069403 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MASERVLEVPVRRHVLDSERPFSAVLDGIFGGISQPDIGLLF |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.74 % |
| % of genes near scaffold ends (potentially truncated) | 94.35 % |
| % of genes from short scaffolds (< 2000 bps) | 94.35 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.355 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.613 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.226 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.613 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.14% β-sheet: 0.00% Coil/Unstructured: 82.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 52.42 |
| PF13191 | AAA_16 | 4.84 |
| PF00005 | ABC_tran | 4.84 |
| PF00230 | MIP | 2.42 |
| PF01569 | PAP2 | 1.61 |
| PF01934 | HepT-like | 0.81 |
| PF00753 | Lactamase_B | 0.81 |
| PF13472 | Lipase_GDSL_2 | 0.81 |
| PF03625 | DUF302 | 0.81 |
| PF00378 | ECH_1 | 0.81 |
| PF13474 | SnoaL_3 | 0.81 |
| PF08388 | GIIM | 0.81 |
| PF13399 | LytR_C | 0.81 |
| PF02594 | DUF167 | 0.81 |
| PF01609 | DDE_Tnp_1 | 0.81 |
| PF13561 | adh_short_C2 | 0.81 |
| PF06441 | EHN | 0.81 |
| PF00535 | Glycos_transf_2 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 2.42 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.81 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.81 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.81 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.81 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.81 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.81 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.81 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.35 % |
| Unclassified | root | N/A | 5.65 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459005|F1BAP7Q02IB50S | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10089140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1218 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10315301 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005093|Ga0062594_101414597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 707 | Open in IMG/M |
| 3300005344|Ga0070661_100435687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 1041 | Open in IMG/M |
| 3300005366|Ga0070659_102020782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 518 | Open in IMG/M |
| 3300005435|Ga0070714_101307894 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300005437|Ga0070710_11127704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 577 | Open in IMG/M |
| 3300005439|Ga0070711_100861905 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005445|Ga0070708_100197306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1883 | Open in IMG/M |
| 3300005456|Ga0070678_102045609 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005591|Ga0070761_10532693 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005591|Ga0070761_10896076 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005591|Ga0070761_11004110 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005602|Ga0070762_10570456 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005610|Ga0070763_10734443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 580 | Open in IMG/M |
| 3300005712|Ga0070764_10434351 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005834|Ga0068851_10655820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 643 | Open in IMG/M |
| 3300005843|Ga0068860_100325679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1508 | Open in IMG/M |
| 3300005921|Ga0070766_11118704 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300006028|Ga0070717_11910286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 536 | Open in IMG/M |
| 3300006052|Ga0075029_100574139 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300006162|Ga0075030_101117518 | Not Available | 620 | Open in IMG/M |
| 3300006163|Ga0070715_10085110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1443 | Open in IMG/M |
| 3300006175|Ga0070712_100130815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1902 | Open in IMG/M |
| 3300006358|Ga0068871_100590597 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300009545|Ga0105237_12415361 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009624|Ga0116105_1126763 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300009634|Ga0116124_1204719 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010360|Ga0126372_11555880 | Not Available | 699 | Open in IMG/M |
| 3300010371|Ga0134125_10237021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2028 | Open in IMG/M |
| 3300010371|Ga0134125_11490782 | Not Available | 737 | Open in IMG/M |
| 3300010376|Ga0126381_102639124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 719 | Open in IMG/M |
| 3300010876|Ga0126361_10590972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acidicola | 506 | Open in IMG/M |
| 3300011271|Ga0137393_11672321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300012189|Ga0137388_11143563 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300013105|Ga0157369_10950053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
| 3300013307|Ga0157372_10227273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2163 | Open in IMG/M |
| 3300014162|Ga0181538_10127702 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| 3300014164|Ga0181532_10121717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → unclassified Kribbella → Kribbella sp. VKM Ac-2568 | 1599 | Open in IMG/M |
| 3300014200|Ga0181526_10639076 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300016294|Ga0182041_11441229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300016319|Ga0182033_11888675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300017821|Ga0187812_1091960 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300017928|Ga0187806_1037403 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300017928|Ga0187806_1200247 | Not Available | 676 | Open in IMG/M |
| 3300018019|Ga0187874_10455764 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300019268|Ga0181514_1572033 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300020580|Ga0210403_11096528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300020581|Ga0210399_10030029 | All Organisms → cellular organisms → Bacteria | 4338 | Open in IMG/M |
| 3300020583|Ga0210401_10523255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 1048 | Open in IMG/M |
| 3300021170|Ga0210400_10359413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1199 | Open in IMG/M |
| 3300021178|Ga0210408_10322715 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300021180|Ga0210396_10215032 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300021180|Ga0210396_11247626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300021180|Ga0210396_11689473 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021358|Ga0213873_10311296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia acidicola | 510 | Open in IMG/M |
| 3300021402|Ga0210385_11283472 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021404|Ga0210389_10573175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 887 | Open in IMG/M |
| 3300021406|Ga0210386_10066591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2890 | Open in IMG/M |
| 3300021474|Ga0210390_11635809 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300021559|Ga0210409_10799907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 816 | Open in IMG/M |
| 3300021559|Ga0210409_11057091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 686 | Open in IMG/M |
| 3300021560|Ga0126371_11043079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 958 | Open in IMG/M |
| 3300021861|Ga0213853_11051133 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300022500|Ga0242643_115803 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300022523|Ga0242663_1023923 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300022523|Ga0242663_1031178 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300022525|Ga0242656_1103759 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300022722|Ga0242657_1060638 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300022726|Ga0242654_10129137 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300022726|Ga0242654_10306357 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300024245|Ga0247677_1045401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 639 | Open in IMG/M |
| 3300024271|Ga0224564_1034486 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300025320|Ga0209171_10264557 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300025414|Ga0208935_1035092 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300025906|Ga0207699_11156151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 573 | Open in IMG/M |
| 3300025910|Ga0207684_10450442 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300025916|Ga0207663_10110356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1866 | Open in IMG/M |
| 3300025916|Ga0207663_11346605 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025917|Ga0207660_11114676 | Not Available | 643 | Open in IMG/M |
| 3300025936|Ga0207670_11705432 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300026078|Ga0207702_11186905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
| 3300026116|Ga0207674_10068369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3575 | Open in IMG/M |
| 3300026489|Ga0257160_1098141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 527 | Open in IMG/M |
| 3300027029|Ga0208731_1023351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 668 | Open in IMG/M |
| 3300027047|Ga0208730_1015359 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300027066|Ga0208236_1005946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 769 | Open in IMG/M |
| 3300027119|Ga0209522_1037312 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300027165|Ga0208608_111383 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300027171|Ga0207947_1009456 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300027504|Ga0209114_1106845 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027635|Ga0209625_1027896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1255 | Open in IMG/M |
| 3300027692|Ga0209530_1129768 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300027767|Ga0209655_10301756 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300027775|Ga0209177_10064195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1079 | Open in IMG/M |
| 3300027775|Ga0209177_10370771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 566 | Open in IMG/M |
| 3300027787|Ga0209074_10232617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 708 | Open in IMG/M |
| 3300027812|Ga0209656_10096607 | Not Available | 1559 | Open in IMG/M |
| 3300027812|Ga0209656_10234165 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300027884|Ga0209275_10299475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 892 | Open in IMG/M |
| 3300027889|Ga0209380_10043526 | All Organisms → cellular organisms → Bacteria | 2545 | Open in IMG/M |
| 3300028381|Ga0268264_10433256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1270 | Open in IMG/M |
| 3300028906|Ga0308309_10569048 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300028906|Ga0308309_10635876 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300030056|Ga0302181_10376576 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300030524|Ga0311357_11365792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
| 3300030872|Ga0265723_1004892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 779 | Open in IMG/M |
| 3300031090|Ga0265760_10114991 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300031474|Ga0170818_114121231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. uw30 | 579 | Open in IMG/M |
| 3300031640|Ga0318555_10495520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300031708|Ga0310686_119676506 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031723|Ga0318493_10683846 | Not Available | 575 | Open in IMG/M |
| 3300031771|Ga0318546_10430979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 922 | Open in IMG/M |
| 3300031782|Ga0318552_10242130 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300031782|Ga0318552_10368556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300031792|Ga0318529_10173413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 997 | Open in IMG/M |
| 3300031823|Ga0307478_10933364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
| 3300031894|Ga0318522_10169831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 824 | Open in IMG/M |
| 3300031947|Ga0310909_10517617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300032067|Ga0318524_10451222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300032783|Ga0335079_11286183 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300032805|Ga0335078_10001727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 33003 | Open in IMG/M |
| 3300033290|Ga0318519_10224722 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.23% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.42% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022500 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024245 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK18 | Environmental | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027066 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes) | Environmental | Open in IMG/M |
| 3300027119 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027165 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF035 (SPAdes) | Environmental | Open in IMG/M |
| 3300027171 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF039 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E41_06691940 | 2170459005 | Grass Soil | VASEQVLDIPVRRHVLTSERPFQVVLDGIFGGISQPDIGA |
| JGIcombinedJ51221_100891403 | 3300003505 | Forest Soil | MASEQVVDVLVRRHVFDTDRPFADILDGVFGGISQPDIEL |
| JGIcombinedJ51221_103153012 | 3300003505 | Forest Soil | MSSERVLEVPLCRHILDSERPFASVLDGIFGGISQPDVGLLFS |
| Ga0062594_1014145971 | 3300005093 | Soil | MASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISQPDIEA |
| Ga0070661_1004356872 | 3300005344 | Corn Rhizosphere | MASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISQPDIEALFSKLAARTS |
| Ga0070659_1020207822 | 3300005366 | Corn Rhizosphere | MASEQVLEVPLRRHVFDSERPFAAVLDGIFGGISQPDIEALFSKLAA |
| Ga0070714_1013078942 | 3300005435 | Agricultural Soil | MASEQVLDVSMRRHVFDSERPFSSVLDGIFDGISQPDIGLLFSKLA |
| Ga0070710_111277041 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MASQRVLEILMRRHVFDSERPFASVLDGVSGGISQPDIGQLFSKLA |
| Ga0070711_1008619051 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MATEEVLDVLIRRHVIDSQRPFSAVLDSIFGGISQPDIEA |
| Ga0070708_1001973062 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MASEQVLDVAVRRHVLTSERPFQVVLDGIYDGISQPDIGALFATLAASLPLSRGW* |
| Ga0070678_1020456092 | 3300005456 | Miscanthus Rhizosphere | VASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIEALFATLAAST |
| Ga0070761_105326931 | 3300005591 | Soil | VASEQVLDIPVRRHVLTSERPFPVVLDGIYDGISQPDIGALFATLAASTSYA |
| Ga0070761_108960762 | 3300005591 | Soil | VASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIGALFATLAASTSY |
| Ga0070761_110041101 | 3300005591 | Soil | MASERVLEVPVRRHVLDSERPFSAVLDGIFGGISQPDIGLLFSKL |
| Ga0070762_105704562 | 3300005602 | Soil | VASEHVLDVLVRRHVFDSERPFLDVLDAIFGGISQPDIEALFGKL |
| Ga0070763_107344431 | 3300005610 | Soil | LASEEVLDVLVRRHVIDSDRPFSSVLDGIFGGITRPDI |
| Ga0070764_104343512 | 3300005712 | Soil | MASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPD |
| Ga0068851_106558202 | 3300005834 | Corn Rhizosphere | MASEQVLEVPLRRHVFDSERPFAAVLDGIFGGISQPDIEA |
| Ga0068860_1003256791 | 3300005843 | Switchgrass Rhizosphere | MASEQVLEVPMRRHVFDSERPFAAVLDGIFGGISQPDIEALFS |
| Ga0070766_111187042 | 3300005921 | Soil | VNPVASEQVLDIPVRRHVLTSERPFTVVLDGIYDGISQPDIEALLA |
| Ga0070717_119102861 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MASEHVLEVLMRRHVFNSERPFATVLDGIYGGISQPDIGQLFSKLAAS |
| Ga0075029_1005741392 | 3300006052 | Watersheds | MASEHVLEVPVRRHVLDTERPFSAILDGVFGGISQPDIGLLFSQLTASTSYQE |
| Ga0075030_1011175183 | 3300006162 | Watersheds | MPSECVLEVLVRRHVFDSERPFLDVLDAIFGGISRPDIEALFGQLAAST |
| Ga0070715_100851101 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MASEQVLEVSVRRHVLDSDRSFSDVLNGVYGGISQPDIGQLFSRL |
| Ga0070712_1001308151 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MATEHVLEIPVRRYIIESERTFASVLDGIFGGISR |
| Ga0068871_1005905971 | 3300006358 | Miscanthus Rhizosphere | VASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIEALF |
| Ga0105237_124153611 | 3300009545 | Corn Rhizosphere | VASEQVLDVVMRRHIFDTDRPFQAVLDGIFDGISRPDIG |
| Ga0116105_11267632 | 3300009624 | Peatland | VASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIGALF |
| Ga0116124_12047191 | 3300009634 | Peatland | VASEQVLDIPVRHHVLTSERPFQVVLDGIYAGISQ |
| Ga0126372_115558802 | 3300010360 | Tropical Forest Soil | MVTEHVLEVPVRRHIIESERPFATVLDGIFGGISQPDIGPLFSDLEAS |
| Ga0134125_102370214 | 3300010371 | Terrestrial Soil | MGSEQVLEVLTRRHVFDSERPFSSVLEGIFGGISQPDIGLLFSQL |
| Ga0134125_114907822 | 3300010371 | Terrestrial Soil | MATEHVLEIPVRRYIIESERTFASVLDGIFGGISRPDVGPLFSDLEAST |
| Ga0126381_1026391241 | 3300010376 | Tropical Forest Soil | MASEQVLEVLVRRHVFDSERPFPAVLEGIFGGISEPDIGQLFSKLEAST |
| Ga0126361_105909721 | 3300010876 | Boreal Forest Soil | VAVEQVLVVPIHRHIIESERPFGNVMDGIFDGISRPDIRSLFSDLE |
| Ga0137393_116723212 | 3300011271 | Vadose Zone Soil | MVSENVIQVLVRRHVIHSGRPFSAVLDGIFGGISRPDIG |
| Ga0137388_111435631 | 3300012189 | Vadose Zone Soil | VASEQVLDIPVRRHVLTSERPFQVVLDGIFGGISQPDI |
| Ga0157369_109500532 | 3300013105 | Corn Rhizosphere | MATEHALEVPVRRHFIESEQPFASVLDGIFGGVSRPDIGPLFSDLEASTSY |
| Ga0157372_102272731 | 3300013307 | Corn Rhizosphere | MASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISQPDIEALFSKLA |
| Ga0181538_101277022 | 3300014162 | Bog | VASEQVLDIPVRHHVLTSERPFQVVLDGIYAGISQPDIGALFA |
| Ga0181532_101217173 | 3300014164 | Bog | VASKQVLDIPVRRHVLTSERPFQDVLDGIYGGISQPDIGALFATLAPS |
| Ga0181526_106390762 | 3300014200 | Bog | VASEQVLDIPVRRHVLTSEQSFQVVLDGIYDGISQPDIGALFARLAAS |
| Ga0182041_114412292 | 3300016294 | Soil | VGSENVMEVLVRRHVIDTERPFPDVLDGIWGGISQP |
| Ga0182033_118886752 | 3300016319 | Soil | DVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR |
| Ga0187812_10919602 | 3300017821 | Freshwater Sediment | MATEQVLDVVVRRHVLDSDRPFQAVLDGIFGGITRPDIDA |
| Ga0187806_10374031 | 3300017928 | Freshwater Sediment | VASEQVLDIPVRRHVLTSERPFQDVLDGIYGGISQPDIG |
| Ga0187806_12002471 | 3300017928 | Freshwater Sediment | MATEQVLEVSIRRHIIESERPFAKVMDGIFGGISRGAGAV |
| Ga0187874_104557642 | 3300018019 | Peatland | VASEHVLDIPVRRHVLTSERPFQVVLDGIYDGISQPD |
| Ga0181514_15720331 | 3300019268 | Peatland | VASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQTDIGALFATLAASTSYA |
| Ga0210403_110965281 | 3300020580 | Soil | MATEHVLEVAVRRHIIESERPFASVLDGIFGGISRPDIGPLFRDL |
| Ga0210399_100300291 | 3300020581 | Soil | VASEHVLDIPVRRHVLTSGRPFQVVLDGIYAGISQPGIGTLF |
| Ga0210401_105232551 | 3300020583 | Soil | MGSEQVLDVAVRRHVFDSELPFQAVLDGIFGGISRP |
| Ga0210400_103594131 | 3300021170 | Soil | MGSEQVLDVAVRRHVFDSELPFQAVLDGIFGGISQP |
| Ga0210408_103227151 | 3300021178 | Soil | MASEQVLDVAVRRHIFTSEWPFQVVLDGIFGGISQTSGR |
| Ga0210396_102150323 | 3300021180 | Soil | VASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDIGALFATLAAS |
| Ga0210396_112476262 | 3300021180 | Soil | VASEQVLVIPVRRHALTSERPFQFVLDGIYDGISQPDIGALFATLAASTS |
| Ga0210396_116894732 | 3300021180 | Soil | VASEQVLDIPVRRHVLTSERPFQVVLDGIYAGISQPDIGAL |
| Ga0213873_103112962 | 3300021358 | Rhizosphere | MESEQVLDVPIRRYIIESERSFPDVLDGIFGGISRPDITSLFGDLEASTS |
| Ga0210385_112834721 | 3300021402 | Soil | VASEQVLDIPVRRHVLTSERPFQVVLDGIYGGISQPDIGALFARLAASTS |
| Ga0210389_105731752 | 3300021404 | Soil | MGSEQVLDVAVRRHVFDSQLPFQAVLDGIFGGISQPD |
| Ga0210386_100665911 | 3300021406 | Soil | MGSEQVLDVAVRRHVFDSELPFQAVLDGIFGGISRPD |
| Ga0210390_116358091 | 3300021474 | Soil | VASEQVLDISVRRYVLTSERPFQVVLDGIFGGISQPDIGALFAKL |
| Ga0210409_107999071 | 3300021559 | Soil | MATEHVLEVAVRRHIIESERPFASVLDGIFGGISRPDIGPLSRDL |
| Ga0210409_110570912 | 3300021559 | Soil | MASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRP |
| Ga0126371_110430791 | 3300021560 | Tropical Forest Soil | MGSERVLDVALRRHVFDSEVPFQAVVNGIFSGISQPDIDALFGK |
| Ga0213853_110511332 | 3300021861 | Watersheds | MATEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITR |
| Ga0242643_1158032 | 3300022500 | Soil | VNQVASERVLDVLVRRHVFESEQPFLDVLDAIFGGISQPDIE |
| Ga0242663_10239232 | 3300022523 | Soil | MESEHVLEVTVRRHVIDSERPFATVLRGIFDGISQPDIEKLFGQLAA |
| Ga0242663_10311781 | 3300022523 | Soil | MASERVLEIPVRRHVLDSERPFSDVLDGIFGGISQPDIGLLFS |
| Ga0242656_11037592 | 3300022525 | Soil | VASEHVLDVLVRRHVFDSERPFPDVLDAIFGGISQPDIEALFGKLAASTS |
| Ga0242657_10606382 | 3300022722 | Soil | MASERVLEVPVRRHVLDSERPFSAVLDGIFGGISQPDIGLLF |
| Ga0242654_101291371 | 3300022726 | Soil | VASEHVLDVLVRRHVFDSERPFPDVLDAIFGGISQPDIEAL |
| Ga0242654_103063571 | 3300022726 | Soil | VNQVASERVLDVLVRRHVFESEQPFLDVLDAIFGGISQPDIEALFGKLAA |
| Ga0247677_10454012 | 3300024245 | Soil | MASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISHPDIE |
| Ga0224564_10344862 | 3300024271 | Soil | MASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPDIGALFGKL |
| Ga0209171_102645571 | 3300025320 | Iron-Sulfur Acid Spring | VASEQVLDIPVRRHVFTSERPFQVVLDGIYTGISQPDLGALFA |
| Ga0208935_10350921 | 3300025414 | Peatland | VASEQVLDIPVRHHVLTSERPFQVVLDGIYAGISQPDIGALFAKLAA |
| Ga0207699_111561511 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MASEQVLEVPMRRHVFDSERSFAAVLDGIFGGISQPDIEALFSK |
| Ga0207684_104504421 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VASEQVLDIPVRRHVLTSERSFRVVLDGIYDGISQPDIGALFATLAASTSY |
| Ga0207663_101103561 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MASEQVLEVPLRRHVFDSERPLAAVLDGIFGGISHPD |
| Ga0207663_113466052 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGSEQVLEVLTRRHVFDSERPFSNVLEGIFGGSCRTAE |
| Ga0207660_111146761 | 3300025917 | Corn Rhizosphere | MASEQVLEVSVRRHILDSDRPFSDVLNGVYGGISQPDIGQLFSRLAATP |
| Ga0207670_117054321 | 3300025936 | Switchgrass Rhizosphere | MASEQLLDVAVRRHIFTSERPFADVLDGIFAGISQPDIGALFAKLAASTSY |
| Ga0207702_111869051 | 3300026078 | Corn Rhizosphere | MATEHALEVPVRRHFIESEQPFASVLDGIFGGVSRPDIGPL |
| Ga0207674_100683693 | 3300026116 | Corn Rhizosphere | MASEQVLEVPLRCHVFDSERPLAAVLDGIFGGISQPDIEALFSKL |
| Ga0257160_10981411 | 3300026489 | Soil | MASEQVLEVLMRSHTFDSERPFDSVLDGIFGGISQ |
| Ga0208731_10233511 | 3300027029 | Forest Soil | MGSEQVLDVAVRRHVFDSELPFQAVLDGIFGGISQPDIESLFGKL |
| Ga0208730_10153592 | 3300027047 | Forest Soil | MATEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPDIGALF |
| Ga0208236_10059461 | 3300027066 | Forest Soil | VASEQVLDISVRRHVLTSERPFQAVLDGIYEGISQPDIGALFARLAVIS |
| Ga0209522_10373121 | 3300027119 | Forest Soil | MATEQVIEVPLRRYVIDSERSISAVLDGIFGGISQPDVPSLFAKLAA |
| Ga0208608_1113831 | 3300027165 | Forest Soil | MASERVLEIPVRRHVLDSERPFSDVLDGIFGGISQPDIGLLF |
| Ga0207947_10094561 | 3300027171 | Forest Soil | VASEHVLDVLVRRHVFDSERPFPDVLDTIFGGISQPD |
| Ga0209114_11068451 | 3300027504 | Forest Soil | VASEQVLDIPVRRHVLTSERPFQDVLDGIYGGISQPDIGALFTRLASS |
| Ga0209625_10278963 | 3300027635 | Forest Soil | REKPVASERVLDIAVRRHVLTSKQPFQVILDGIYAGIGQPDIGALFAKLAAAL |
| Ga0209530_11297682 | 3300027692 | Forest Soil | VASEQVLDIPVRRHVLTSDRPFQVVLDGIYGGISQPDIGALFAT |
| Ga0209655_103017561 | 3300027767 | Bog Forest Soil | VASEHVLDIPVRRHMLTSDRPFQAVLDGIYGGISQPDIGALF |
| Ga0209177_100641951 | 3300027775 | Agricultural Soil | MGTTSEDVLEVLVRRHVFASERPFPAVLDGIFGGISRPDIEVLDL |
| Ga0209177_103707712 | 3300027775 | Agricultural Soil | VVELVLDVLVRRNVFDSERPFPDVLDAIFGGISQPDIEALFGK |
| Ga0209074_102326171 | 3300027787 | Agricultural Soil | MGVVSENVLKVLVHRHVFDSDRPFSAVLDGIFGGIS |
| Ga0209656_100966071 | 3300027812 | Bog Forest Soil | MATEQVLEVSIRRHIIESERPFANVLDGIFGGISRPDTGALFSDLEASI |
| Ga0209656_102341651 | 3300027812 | Bog Forest Soil | VASEQVLDIPVRRHVLTSERPFQVVLDGIYAGISQPD |
| Ga0209275_102994751 | 3300027884 | Soil | MPSERVLDVPLRRHVLDSERPFSAVLDGIFGGISQPDIGLLFTKLAAS |
| Ga0209380_100435263 | 3300027889 | Soil | MASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPDIGALFGKLA |
| Ga0268264_104332563 | 3300028381 | Switchgrass Rhizosphere | MASEQVLEVPLRRHVFDSERPFAAVLDGIFGGISQPDI |
| Ga0308309_105690482 | 3300028906 | Soil | VASEHVLHIPVRRHVLTSERPFQVVLDGIYTGNSQPDLGALFATLAASTSYEE |
| Ga0308309_106358762 | 3300028906 | Soil | VASEQVLDIPVRRHVLTSERPFQVVLDGIYDGISQPDTGALF |
| Ga0302181_103765761 | 3300030056 | Palsa | VAPEQAFEVVVRRHVLTSDRPFQVVLDGIYGGISQPDIGALFARL |
| Ga0311357_113657921 | 3300030524 | Palsa | MASEQVLEIVVRRHIFTSNQPFPAVLDGIFGAISQPDIGQLFS |
| Ga0265723_10048921 | 3300030872 | Soil | VASEEVLDIPVRRHVLTSERPFPVVLDGIYGGISQPDIGALFALAA |
| Ga0265760_101149912 | 3300031090 | Soil | MASEQVLDVVVRRHVFDSDRPFEAVLDGIFGGITRPDIGPLLGKLAAS |
| Ga0170818_1141212312 | 3300031474 | Forest Soil | MASEQVLEVPMRRHVFDTERPFAAVLDGIFGGISQPD |
| Ga0318555_104955202 | 3300031640 | Soil | GCASMETMAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR |
| Ga0310686_1196765062 | 3300031708 | Soil | MSQMASEQVLDVVVRRHVFDSDRPFQAVLDGIFGGITRPDIGPLLGKLAAS |
| Ga0318493_106838461 | 3300031723 | Soil | MKSEHALDVVVRRHVFASDRPFDQVLAGIFGGISQPDIA |
| Ga0318546_104309791 | 3300031771 | Soil | EQVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR |
| Ga0318552_102421302 | 3300031782 | Soil | VGSENVMEVLVRRHVIDTERPFPDVLDGIWGGISQPDIDALFSTL |
| Ga0318552_103685561 | 3300031782 | Soil | METMAAEQVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR |
| Ga0318529_101734132 | 3300031792 | Soil | METMAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR |
| Ga0307478_109333642 | 3300031823 | Hardwood Forest Soil | MASEHVLEVLVRRHVLDSERPFAAVLDGIYQGISRPDIGALFGQLAASGSF |
| Ga0318522_101698312 | 3300031894 | Soil | METMAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITT |
| Ga0310909_105176172 | 3300031947 | Soil | MAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR |
| Ga0318524_104512221 | 3300032067 | Soil | RCPDPGGCASMETMAAEKVLDVVMRRHVFDSDRPFDQVLAGIFGGISEPDITTIR |
| Ga0335079_112861832 | 3300032783 | Soil | MASEQVLDVAVRRHVLTSERPFADVMDGIFAGISRPDIGALFAK |
| Ga0335078_1000172714 | 3300032805 | Soil | MATEQVLQVPIRRYTFESERPFVNVLDGIFGGISQPDTGRC |
| Ga0318519_102247222 | 3300033290 | Soil | MATEHVLEVPVRRHIIDSGQPFASVLDGIFGGISQPDIGPLFSDLEA |
| ⦗Top⦘ |