 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F069367 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VETIDYDKLDQPAVVRRGRHAVSAPAPAFDPSEIPAFLRKQAD |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.97 % |
| % of genes from short scaffolds (< 2000 bps) | 89.52 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.935 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (8.871 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.323 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.226 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.31% β-sheet: 0.00% Coil/Unstructured: 81.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF03331 | LpxC | 91.94 |
| PF05258 | DciA | 1.61 |
| PF04366 | Ysc84 | 0.81 |
| PF01551 | Peptidase_M23 | 0.81 |
| PF01960 | ArgJ | 0.81 |
| PF07517 | SecA_DEAD | 0.81 |
| PF03884 | YacG | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 91.94 |
| COG5512 | Predicted nucleic acid-binding protein, contains Zn-ribbon domain (includes truncated derivatives) | General function prediction only [R] | 1.61 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.81 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.81 |
| COG3024 | Endogenous inhibitor of DNA gyrase, YacG/DUF329 family | Replication, recombination and repair [L] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.94 % |
| All Organisms | root | All Organisms | 33.06 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.84% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.84% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.84% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.23% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.61% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.61% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.81% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.81% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.81% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.81% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.81% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009527 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Lower Cold Creek | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014054 | Permafrost microbial communities from Nunavut, Canada - A34_5cm_12M | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030048 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F24TB_100144881 | 3300000550 | Soil | IIDYDRLEQPAVIRKGRNPPSAGAGSNFDASEIPAFLRKQAD* |
| JGIcombinedJ13530_1003462512 | 3300001213 | Wetland | VHVETIDYDRLDQPAVMRKGRSAPSSSSAPAFDASEIPAFLRKQAD* |
| Ga0062595_1019165461 | 3300004479 | Soil | DKLDQPAVVRRGRQPSSLGAAASAFDPSDIPAFLRKQAD* |
| Ga0066680_105548441 | 3300005174 | Soil | MIDAVDYDKLYQPAVVRRGRAPSAAPGLAPFDASEIPAFLRKQAD* |
| Ga0066675_112264941 | 3300005187 | Soil | VDYDKLDQPAVVRRGRAPSSGNGLAAFDSSEIPAFLRKQAD* |
| Ga0070690_1013692771 | 3300005330 | Switchgrass Rhizosphere | TIDYEKLDQPAVARRRHPGSIAAPAFDPSEIPAFLRKQAD* |
| Ga0068869_1010783472 | 3300005334 | Miscanthus Rhizosphere | TDGLGVHVETIDYDRLDAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD* |
| Ga0068869_1019940492 | 3300005334 | Miscanthus Rhizosphere | ETIDYEKLDQPAVARRRHTASIAAPAFDPSDIPAFLRKQAD* |
| Ga0070680_1013893071 | 3300005336 | Corn Rhizosphere | ETVDYDKLDQPAVVRRRSTMQPQSMAFDATDIPAFLRKQAD* |
| Ga0070660_1005567282 | 3300005339 | Corn Rhizosphere | TETIDYEKLDQPAVARRRHPGSIAAPAFDPSEIPAFLRKQAD* |
| Ga0070689_1001844891 | 3300005340 | Switchgrass Rhizosphere | DGLGVHVETIDYDRLDAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD* |
| Ga0070689_1006125022 | 3300005340 | Switchgrass Rhizosphere | TETIDYEKLDQPAVARRRHTASIAAPAFDPSEIPAFLRKQAD* |
| Ga0070661_1005219301 | 3300005344 | Corn Rhizosphere | VETIDYDKLDQPAVVRRGRHAVSAPAPAFDPSEIPAFLRKQAD* |
| Ga0070669_1010129142 | 3300005353 | Switchgrass Rhizosphere | HVETIDYDRLDQPAVMRKGRAAPASSSAPAFDASEIPAFLRKQAD* |
| Ga0070688_1010343992 | 3300005365 | Switchgrass Rhizosphere | TDGLGVHVETIDYERLDAPAVMRKGRAATPAPSSPAFDASEIPAFLRKQAD* |
| Ga0070667_1003647583 | 3300005367 | Switchgrass Rhizosphere | ETIDYEKLDQPAVARRRHTASIAAPAFDPSEIPAFLRKQAD* |
| Ga0070709_113556922 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GVRVSETIDYDVLDQPAVVRRGRHTASVASPAFDASEIPAFLRKQAD* |
| Ga0070662_1001880851 | 3300005457 | Corn Rhizosphere | GTDGLGMHVETIDYDRLDQPAVMRKGRSAPSQGTAPAFDASEIPAFLRKQAD* |
| Ga0070685_104000472 | 3300005466 | Switchgrass Rhizosphere | IETIDYDRLDAPAVMRKGRPAPSAGASSAFDASDIPAFLRKQAD* |
| Ga0070686_1011802802 | 3300005544 | Switchgrass Rhizosphere | YDRLDAPAVMRKGRPAPSAGASSAFDASDIPAFLRKQAD* |
| Ga0070665_1023176492 | 3300005548 | Switchgrass Rhizosphere | VTETIDYEKLDQPAVARRRHPGSISAPAFDPSEIPAFLRKQAD* |
| Ga0070664_1004417162 | 3300005564 | Corn Rhizosphere | YEKLDQPAVARRRHPGSISAPAFDPSEIPAFLRKQAD* |
| Ga0068854_1005143261 | 3300005578 | Corn Rhizosphere | MHVETIDYDRLDQPAVMRKCRSAPSQGTAPAFDASEIPAFLRKQAD* |
| Ga0068851_104745011 | 3300005834 | Corn Rhizosphere | ETIDYDKLDQPAVVRRGRQPASVSSSLSFDPSDIPAFLRKQAD* |
| Ga0068863_1026587431 | 3300005841 | Switchgrass Rhizosphere | VHSEVIDYDKLEQPAVVRHGRSRGPGGGLSSFDATEIPAFLRKQAD* |
| Ga0068858_1017285692 | 3300005842 | Switchgrass Rhizosphere | DYEKLDQPAVARRRHPGSISAPAFDPSEIPAFLRKQAD* |
| Ga0068860_1025656531 | 3300005843 | Switchgrass Rhizosphere | ETIDYDRLDAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD* |
| Ga0068862_1019531872 | 3300005844 | Switchgrass Rhizosphere | VTETIDYEKLDQPAVARRRHTASIAAPAFDPSEIPAFLRKQAD* |
| Ga0070717_116363812 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LDKTPAVIRRGRTPSPATAGSGFDASDIPAFLRKQAD* |
| Ga0066656_105031212 | 3300006034 | Soil | GTDNLGLTMNDTVDYEKLDQPAVVRRGRSPSVGHGLAAFDSSEIPAFLRKQAD* |
| Ga0070715_109872601 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GMTVTETIDYDKLDQPAVVRRGRQPSAVATSAAFDPSDIPAFLRKQAD* |
| Ga0075522_1000508210 | 3300006638 | Arctic Peat Soil | GMLVSGRVDYDKLDQPAVVRRRSSLQPQSTAFDASDIPAFLRKQAD* |
| Ga0079221_107459332 | 3300006804 | Agricultural Soil | DYDKLDQPAVARRRHSVHAPAPAFDPSDIPAFLRKQND* |
| Ga0075425_1021647861 | 3300006854 | Populus Rhizosphere | VTETIDYDKLDQPAVARRRHPGSIAAPAFDPSEIPAFLRKQAD* |
| Ga0075424_1006518461 | 3300006904 | Populus Rhizosphere | DQPAVMRKGRAQPTTSAAPAFDASEIPAFLRKQAD* |
| Ga0075472_102961971 | 3300006917 | Aqueous | NYEELDQPAVMRKGRTAPAAGTAASFDASEIPAFLRKQAD* |
| Ga0066709_1045110031 | 3300009137 | Grasslands Soil | TPAVIRRGRTPAPSGAPSTGFDPSDIPAFLRKQAD* |
| Ga0105097_100351355 | 3300009169 | Freshwater Sediment | VEQIDDDKRGHPAVVRRRTAAPAASASAFDVSEIPAFLRKQAD* |
| Ga0105241_106885081 | 3300009174 | Corn Rhizosphere | VGMRVSETIDDEKLDQPAVVRRGRHATSVAAPAFDSSEIPAFLRKQAD* |
| Ga0105241_107067541 | 3300009174 | Corn Rhizosphere | TDNMGRHVETIDYDKPDQPAVVRRGRHAVATPSPAFDPSEIPAFLRKQAD* |
| Ga0114942_14117941 | 3300009527 | Groundwater | DNVGVPVEQINYEALDQPAVVRHGRRAPSAGSSAPAYDTSEIPAFLRKQAD* |
| Ga0105238_113099721 | 3300009551 | Corn Rhizosphere | TETIDYDKLDQPAVVRRGRQPASVSSSLSFDPSDIPAFLRKQAD* |
| Ga0116144_104083601 | 3300009687 | Anaerobic Digestor Sludge | GTDNLGVSVETIDYDKLDQPAVIRRRVPANAAASASDLEIPAFLRKQND* |
| Ga0134111_104797862 | 3300010329 | Grasslands Soil | KLDQPAVVRRGRAPSAAPGLAPFDASEIPAFLRKQAD* |
| Ga0134126_102732511 | 3300010396 | Terrestrial Soil | TINYDELDQPAVVRRGRHAVSAPTPAFDPSELPAFLRKQAD* |
| Ga0105246_124170931 | 3300011119 | Miscanthus Rhizosphere | LDAPAVMRKGRPAPSAGASSAFDASDIPAFLRKQAD* |
| Ga0137463_13719031 | 3300011444 | Soil | IGMPMSGQVGAHLSAHLGAPIDYEHLEAPAVIRKGRGAPSAGSVPSFDASDIPAFLRKQAD* |
| Ga0137381_102631993 | 3300012207 | Vadose Zone Soil | DRLERTPAVIRRGRTPAPSGPPSPGFDPSDIPAFLRKQAD* |
| Ga0137368_100054101 | 3300012358 | Vadose Zone Soil | TPAVIRRGRTPAPSGPPSPGFDPSDIPAFLRKQAD* |
| Ga0157354_10288592 | 3300012517 | Unplanted Soil | DYDKLDQPAVARRRHPGSIAAPAFDPSEIPAFLRKQAD* |
| Ga0136612_101303731 | 3300012680 | Polar Desert Sand | AIDYERLDQPAVMRKGRAPSSPSATASFDPSEIPAFLRRQAD* |
| Ga0137416_116141001 | 3300012927 | Vadose Zone Soil | VGVPMRDAVDYANLDLPTVVRSGRARAASPSLATFDASEIPAFLRKQAD* |
| Ga0164241_109592552 | 3300012943 | Soil | VDYDKLDQPAVVRRRSTMQPQSMAFDATDIPAFLRKQAD* |
| Ga0164308_116926971 | 3300012985 | Soil | DRLDAPAVMRKGRAASPAPSSAAFDASDIPAFLRKQAD* |
| Ga0164308_120239902 | 3300012985 | Soil | DAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD* |
| Ga0157371_108197602 | 3300013102 | Corn Rhizosphere | VTETIDYEKLDQPAVARRRHPGSIAAPAFDPSEIPAFLRKQAD* |
| Ga0157370_116795731 | 3300013104 | Corn Rhizosphere | VETIDYDKLDQPAVVRRGRHAVATPSPAFDPSEIPAFLRKQAD* |
| Ga0157374_119967912 | 3300013296 | Miscanthus Rhizosphere | GLGVRVETIDYDRLDQPAVMRKGRAQPGPSAAPAFDASEIPAFLRKEAD* |
| Ga0120135_10582952 | 3300014054 | Permafrost | DKTPAVVRRGRAAPPTDRGSAFDPADIPAFLRKQAD* |
| Ga0182019_103198381 | 3300014498 | Fen | TIDYERLDQPAVMRKGRAAPSSTAAPAFDASDIPAFLRKQAD* |
| Ga0157377_104401322 | 3300014745 | Miscanthus Rhizosphere | LEGHRLLTIDYDRLDAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD* |
| Ga0180063_12256441 | 3300014885 | Soil | AEAINYEDLDQPAVVRRGRAPAASMPPPAFDAAEVPAFLRKQAD* |
| Ga0157376_100411026 | 3300014969 | Miscanthus Rhizosphere | EQPAVVRHGRSRGPGAGLSSFDATEIPAFLRKQAD* |
| Ga0132256_1001040441 | 3300015372 | Arabidopsis Rhizosphere | NVGVRVSETIDYDKLDQPAVARRRHSVHAPAPAFDPSDIPAFLRKQND* |
| Ga0132257_1022416231 | 3300015373 | Arabidopsis Rhizosphere | KTPAVIRRGRTPSPASGASAFDASDIPAFLRKQAD* |
| Ga0132257_1041995641 | 3300015373 | Arabidopsis Rhizosphere | KLDQPAVVRRGRAPSSAPGLAPFDASEIPAFLRKQAD* |
| Ga0132255_1001320611 | 3300015374 | Arabidopsis Rhizosphere | LDQPAVVRRGRTPAARTAPAIDAAEIPAFLRKQAD* |
| Ga0132255_1018816301 | 3300015374 | Arabidopsis Rhizosphere | DNVAMTGGAPNYDDLDQPAVVRRGRTPAARTAPAIDAAEIPAFLRKQAD* |
| Ga0132255_1041979372 | 3300015374 | Arabidopsis Rhizosphere | SETIDYDKLDQPAVARRRHSTHAPAPAFDPSDIPAFLRKQND* |
| Ga0163161_117927122 | 3300017792 | Switchgrass Rhizosphere | HVETIDYERLDAPAVMRKGRAATPAPSSPAFDASEIPAFLRKQAD |
| Ga0187823_100442412 | 3300017993 | Freshwater Sediment | IDYDKLDQPAVVRRGRHAVATPSPAFDPSEIPAFLRKQAD |
| Ga0184628_106599762 | 3300018083 | Groundwater Sediment | MGGQLGETIDYDRLEQPAVIRKGRNAPSAGAGSNFDASEIPAFLRKQAD |
| Ga0190270_133500251 | 3300018469 | Soil | DYDRLDAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD |
| Ga0193730_10777581 | 3300020002 | Soil | DAVDYDKLDQPAVVRRGRAPSAGPGLAPFDASEIPAFLRKQAD |
| Ga0207642_108206282 | 3300025899 | Miscanthus Rhizosphere | LDAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD |
| Ga0207705_109895381 | 3300025909 | Corn Rhizosphere | VGRVETIDYEKLDQPAVARRRHTASIAAPAFDPSDIPAFLRKQAD |
| Ga0207660_113753161 | 3300025917 | Corn Rhizosphere | SGIMITETVDYDKLDQPAVVRRRSTMQPQSMAFDATDIPAFLRKQAD |
| Ga0207660_114549711 | 3300025917 | Corn Rhizosphere | DYEKLDQPAVARRRHTASIAAPAFDPSDIPAFLRKQAD |
| Ga0207681_117357521 | 3300025923 | Switchgrass Rhizosphere | LDQPAVFRHGRQPTRPVELTPFDVSEIPAFLRKQAD |
| Ga0207664_100524181 | 3300025929 | Agricultural Soil | SLDKTPAVIRRGRTPSPAAAGSGFDASDIPAFLRKQAD |
| Ga0207706_102210201 | 3300025933 | Corn Rhizosphere | GTDGLGMHVETIDYDRLDQPAVMRKGRSAPSQGTAPAFDASEIPAFLRKQAD |
| Ga0207689_109074822 | 3300025942 | Miscanthus Rhizosphere | DGLGVHVETIDYDRLDAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD |
| Ga0207658_100595205 | 3300025986 | Switchgrass Rhizosphere | TDGLGVHVETIDYDRLDAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD |
| Ga0207703_108556532 | 3300026035 | Switchgrass Rhizosphere | VHSEVIDYDKLEQPAVVRHGRSRGPGGGLSSFDATEIPAFLRKQAD |
| Ga0207678_110144381 | 3300026067 | Corn Rhizosphere | RLDAPAVMRKGRPAPSAGAASAFDASDIPAFLRKQAD |
| Ga0207678_115280541 | 3300026067 | Corn Rhizosphere | MRVTETIDYEKLDQPAVARRRHTASIAAPAFDPSEIPAFLRKQAD |
| Ga0207708_113108631 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MHVETIDYERLDQPAVMRKGRSAPSQGTAPAFDASEIPAFLRKQAD |
| Ga0207641_118500051 | 3300026088 | Switchgrass Rhizosphere | LGMQVETIDYDRLDQPAVMRKGRAAPASSSAPAFDASEIPAFLRKQAD |
| Ga0209967_10476112 | 3300027364 | Arabidopsis Thaliana Rhizosphere | IDYEKLDQPAVARRRHTAHVAAPAFDPSEIPAFLRKQAD |
| Ga0268266_122759562 | 3300028379 | Switchgrass Rhizosphere | YDRLDQPAVMRKGRSAPSQGTAPAFDASEIPAFLRKQAD |
| Ga0268264_118659672 | 3300028381 | Switchgrass Rhizosphere | NVGMRVTETIDYEKLDQPAVARRRHTASIAAPAFDPSEIPAFLRKQAD |
| Ga0268264_120145892 | 3300028381 | Switchgrass Rhizosphere | IDYDRLDAPAVMRKGRAASPAPSAAAFDASDIPAFLRKQAD |
| Ga0302166_101746762 | 3300028652 | Fen | VTSGPVNYDDLDQPAVVRRGRAPPAGATPAFDAAEIPAFLRKQAD |
| Ga0302160_101278072 | 3300028665 | Fen | IGVQVTGQMVETIDYDRLEAPAVIRKGRSTPTAGGSSSFDASDIPAFLRKQAD |
| Ga0302262_101776051 | 3300028743 | Fen | EAPAVIRKGRGMPNAGASSSFDASDIPAFLRKQAD |
| Ga0311332_106020032 | 3300029984 | Fen | VQLSGQMVETIDYDRLEAPAVIRKGRAAPGAGASSSFDASDVPAFLRKQAD |
| Ga0311336_100662045 | 3300029990 | Fen | IDYDRLESPAVIRKGRAPNPGAASSFDASDIPAFLRKQAD |
| Ga0311337_120330611 | 3300030000 | Fen | TQMVETIDYDRLEAPAVIRKGRGTPVAGGSSPFDASDIPAFLRKQAD |
| Ga0302273_10958791 | 3300030048 | Bog | TDNVGVTTGPVNYDDLDQPAVVRRGRAPPAGATPAFDAAEIPAFLRKQAD |
| Ga0302273_12042932 | 3300030048 | Bog | TIDYDRLEAPAVIRKGRSTPSAGGSSSFDASDIPAFLRKQAD |
| Ga0311349_110328412 | 3300030294 | Fen | LTVENIDYDRLEAPAVMRKGRTPSTGSAPSFDAADIPAFLRKQAD |
| Ga0311335_110469341 | 3300030838 | Fen | YERLDQPAVMRKGRSAPSAGAAQSFDPSEIPAFLRKQAD |
| Ga0311364_119637372 | 3300031521 | Fen | DGIGVQVTGQMVETIDYDRLEAPAVIRKGRSTPTAGGSSSFDASDIPAFLRKQAD |
| Ga0307408_1011316212 | 3300031548 | Rhizosphere | GVHIETIDYEKLDQPAVVRRRVSMPPSPSASFDAADIPAFLRKQAD |
| Ga0310886_109605882 | 3300031562 | Soil | ETIDYEKLDQPAVARRRHTASIAAPAFDPSDIPAFLRKQAD |
| Ga0302321_1027249251 | 3300031726 | Fen | ETIDYDRLEAPAVIRKGRSSPSAGGTSSFDASDIPAFLRKQAD |
| Ga0318501_107308332 | 3300031736 | Soil | DKLDQPAVVRRGRQPSGNASAPAFDPSEIPAFLRKQAD |
| Ga0310892_106629532 | 3300031858 | Soil | GTDGLGVHVETIDYERLDAPAVMRKGRAATPAPSSPAFDASEIPAFLRKQAD |
| Ga0318520_103112181 | 3300031897 | Soil | DRLERTPAVIRRGRAPAANSTAAGFDPSDIPAFLRKQAD |
| Ga0302322_1004824791 | 3300031902 | Fen | DYDRLEAPAVIRKGRSAPGASASSPFDASDIPAFLRKQAD |
| Ga0310900_106043062 | 3300031908 | Soil | VRVTETIDYEKLDQPAVARRRHPGSIAAPAFDPSEIPAFLRKQAD |
| Ga0315278_100195891 | 3300031997 | Sediment | RRDLDQPAVVRRGRSASSASAPSPAFDTTEIPAFLRKQAD |
| Ga0318558_105507052 | 3300032044 | Soil | NLGINVTETIDYDKLDQPAVVRRGRQPSGNASAPAFDPSEIPAFLRKQAD |
| Ga0315912_115529992 | 3300032157 | Soil | RINYEELDQPAVVRRGRSGGGGAPAPAFDAAEIPAFLRKQAD |
| Ga0307470_103644432 | 3300032174 | Hardwood Forest Soil | GVAVEKIKYEDLEQPAVVRRGRSPTAAAPSFDSTEIPAFLRKQAD |
| Ga0315271_103178331 | 3300032256 | Sediment | LDAPAVIRKGRAPSSAASPSFDASDVPAFLRKQAD |
| Ga0315287_109552642 | 3300032397 | Sediment | LEAPAVIRKGRSAPGAGTSSPFDASDIPAFLRKQAD |
| Ga0335081_100696525 | 3300032892 | Soil | HLERTPAVIRRGRTAPVSGTPAAGFDPSDIPAFLRKQAD |
| Ga0316616_1031092351 | 3300033521 | Soil | EQIDYDKLDQPAVVRRRTAAPVAGASAFDVSEIPAFLRKQAD |
| Ga0316617_1028201521 | 3300033557 | Soil | GVEHIDYDVLDQPAVVRRARPTAASAPSIDTSEIPAFLRKQAD |
| Ga0314866_059808_1_138 | 3300033807 | Peatland | AVETIDYDKLDQPAVVRRGRQPAGAGAAPAFDPSEIPAFLRKQAD |
| Ga0364925_0200994_1_117 | 3300034147 | Sediment | YDKLDQPAVVRRRSASPTVPASAIDASDIPAFLRKQAD |
| Ga0364929_0295758_14_151 | 3300034149 | Sediment | MIETIDYDRLEAPAVMRKGRAAPSAGASSTFDAADIPAFLRKQAD |
| Ga0370487_0185659_552_686 | 3300034170 | Untreated Peat Soil | VETIDYDRLEAPAVIRKGRSTPSAGGSSSFDASDIPAFLRKQAD |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |