| Basic Information | |
|---|---|
| Family ID | F069341 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | EKRTYEKKIDHSNDITFENEIKKPEVKSKVKETKETKSSLTFGE |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 9.76 % |
| % of genes near scaffold ends (potentially truncated) | 89.52 % |
| % of genes from short scaffolds (< 2000 bps) | 95.97 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (31.452 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (29.839 % of family members) |
| Environment Ontology (ENVO) | Unclassified (92.742 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (97.581 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.56% β-sheet: 0.00% Coil/Unstructured: 94.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF12236 | Head-tail_con | 58.06 |
| PF03237 | Terminase_6N | 2.42 |
| PF02777 | Sod_Fe_C | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.16 % |
| Unclassified | root | N/A | 29.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10207649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 651 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10228476 | Not Available | 602 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10140984 | Not Available | 728 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10161299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 655 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10177029 | Not Available | 610 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10098175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1111 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10232307 | Not Available | 572 | Open in IMG/M |
| 3300001450|JGI24006J15134_10187879 | All Organisms → Viruses → environmental samples → uncultured marine virus | 641 | Open in IMG/M |
| 3300001460|JGI24003J15210_10124544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 697 | Open in IMG/M |
| 3300001472|JGI24004J15324_10126057 | Not Available | 621 | Open in IMG/M |
| 3300001718|JGI24523J20078_1008462 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300001720|JGI24513J20088_1005703 | Not Available | 1724 | Open in IMG/M |
| 3300002231|KVRMV2_100566952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P | 1123 | Open in IMG/M |
| 3300005747|Ga0076924_1097123 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300005747|Ga0076924_1301933 | Not Available | 624 | Open in IMG/M |
| 3300005747|Ga0076924_1317508 | All Organisms → Viruses → environmental samples → uncultured marine virus | 604 | Open in IMG/M |
| 3300006164|Ga0075441_10242784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 664 | Open in IMG/M |
| 3300006191|Ga0075447_10081635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1140 | Open in IMG/M |
| 3300006737|Ga0098037_1247519 | Not Available | 572 | Open in IMG/M |
| 3300006802|Ga0070749_10540713 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 632 | Open in IMG/M |
| 3300006802|Ga0070749_10613208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 586 | Open in IMG/M |
| 3300006810|Ga0070754_10406067 | Not Available | 596 | Open in IMG/M |
| 3300006810|Ga0070754_10429845 | Not Available | 575 | Open in IMG/M |
| 3300006916|Ga0070750_10305804 | Not Available | 679 | Open in IMG/M |
| 3300006916|Ga0070750_10486078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 507 | Open in IMG/M |
| 3300006925|Ga0098050_1167639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 551 | Open in IMG/M |
| 3300006928|Ga0098041_1214196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 616 | Open in IMG/M |
| 3300006929|Ga0098036_1200927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 606 | Open in IMG/M |
| 3300006947|Ga0075444_10323694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 591 | Open in IMG/M |
| 3300006990|Ga0098046_1040844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1106 | Open in IMG/M |
| 3300008221|Ga0114916_1117513 | Not Available | 625 | Open in IMG/M |
| 3300009418|Ga0114908_1140413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 781 | Open in IMG/M |
| 3300009428|Ga0114915_1198698 | Not Available | 553 | Open in IMG/M |
| 3300009434|Ga0115562_1247445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 622 | Open in IMG/M |
| 3300009498|Ga0115568_10453480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 551 | Open in IMG/M |
| 3300009508|Ga0115567_10564096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 689 | Open in IMG/M |
| 3300009593|Ga0115011_11644009 | Not Available | 573 | Open in IMG/M |
| 3300009593|Ga0115011_11846574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 546 | Open in IMG/M |
| 3300010148|Ga0098043_1184526 | Not Available | 581 | Open in IMG/M |
| 3300010150|Ga0098056_1186275 | Not Available | 695 | Open in IMG/M |
| 3300010153|Ga0098059_1203625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 770 | Open in IMG/M |
| 3300010153|Ga0098059_1208449 | Not Available | 760 | Open in IMG/M |
| 3300010153|Ga0098059_1313512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 598 | Open in IMG/M |
| 3300011129|Ga0151672_115152 | All Organisms → Viruses | 535 | Open in IMG/M |
| 3300011253|Ga0151671_1025963 | All Organisms → Viruses → environmental samples → uncultured marine virus | 573 | Open in IMG/M |
| 3300012920|Ga0160423_10858029 | Not Available | 610 | Open in IMG/M |
| 3300012953|Ga0163179_10501015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1004 | Open in IMG/M |
| 3300017697|Ga0180120_10133413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1061 | Open in IMG/M |
| 3300017710|Ga0181403_1073399 | Not Available | 711 | Open in IMG/M |
| 3300017717|Ga0181404_1183534 | Not Available | 500 | Open in IMG/M |
| 3300017725|Ga0181398_1048459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1030 | Open in IMG/M |
| 3300017725|Ga0181398_1130747 | Not Available | 598 | Open in IMG/M |
| 3300017727|Ga0181401_1075451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 884 | Open in IMG/M |
| 3300017731|Ga0181416_1034724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1185 | Open in IMG/M |
| 3300017731|Ga0181416_1163730 | Not Available | 537 | Open in IMG/M |
| 3300017732|Ga0181415_1095973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 668 | Open in IMG/M |
| 3300017732|Ga0181415_1161176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 500 | Open in IMG/M |
| 3300017738|Ga0181428_1120896 | Not Available | 614 | Open in IMG/M |
| 3300017739|Ga0181433_1028280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1467 | Open in IMG/M |
| 3300017739|Ga0181433_1110941 | Not Available | 661 | Open in IMG/M |
| 3300017745|Ga0181427_1177889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 513 | Open in IMG/M |
| 3300017745|Ga0181427_1185535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 501 | Open in IMG/M |
| 3300017746|Ga0181389_1178968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 554 | Open in IMG/M |
| 3300017746|Ga0181389_1192066 | Not Available | 530 | Open in IMG/M |
| 3300017751|Ga0187219_1210790 | Not Available | 534 | Open in IMG/M |
| 3300017753|Ga0181407_1056964 | Not Available | 1016 | Open in IMG/M |
| 3300017753|Ga0181407_1189048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 501 | Open in IMG/M |
| 3300017756|Ga0181382_1147046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 616 | Open in IMG/M |
| 3300017760|Ga0181408_1098956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 760 | Open in IMG/M |
| 3300017762|Ga0181422_1187108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 627 | Open in IMG/M |
| 3300017767|Ga0181406_1217974 | Not Available | 564 | Open in IMG/M |
| 3300017769|Ga0187221_1189287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 597 | Open in IMG/M |
| 3300017770|Ga0187217_1189132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 682 | Open in IMG/M |
| 3300017771|Ga0181425_1112543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC203P | 870 | Open in IMG/M |
| 3300017773|Ga0181386_1073462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1082 | Open in IMG/M |
| 3300017781|Ga0181423_1169368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 836 | Open in IMG/M |
| 3300017782|Ga0181380_1216870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 639 | Open in IMG/M |
| 3300017786|Ga0181424_10421942 | Not Available | 540 | Open in IMG/M |
| 3300017786|Ga0181424_10455659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 516 | Open in IMG/M |
| 3300020251|Ga0211700_1007922 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1259 | Open in IMG/M |
| 3300020382|Ga0211686_10045994 | All Organisms → Viruses → Predicted Viral | 1762 | Open in IMG/M |
| 3300022064|Ga0224899_100441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 750 | Open in IMG/M |
| 3300022074|Ga0224906_1008775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 4005 | Open in IMG/M |
| 3300022074|Ga0224906_1063556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1151 | Open in IMG/M |
| 3300022074|Ga0224906_1163824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 622 | Open in IMG/M |
| 3300022074|Ga0224906_1195969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 552 | Open in IMG/M |
| 3300022164|Ga0212022_1019421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1010 | Open in IMG/M |
| 3300022164|Ga0212022_1058287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 595 | Open in IMG/M |
| 3300022169|Ga0196903_1002413 | All Organisms → Viruses → Predicted Viral | 2563 | Open in IMG/M |
| 3300022187|Ga0196899_1041269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1559 | Open in IMG/M |
| 3300022187|Ga0196899_1161361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 616 | Open in IMG/M |
| 3300024343|Ga0244777_10663661 | All Organisms → Viruses | 627 | Open in IMG/M |
| 3300025071|Ga0207896_1059892 | All Organisms → Viruses | 609 | Open in IMG/M |
| 3300025085|Ga0208792_1096783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 516 | Open in IMG/M |
| 3300025120|Ga0209535_1146233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 754 | Open in IMG/M |
| 3300025120|Ga0209535_1167692 | All Organisms → Viruses | 666 | Open in IMG/M |
| 3300025120|Ga0209535_1179327 | Not Available | 626 | Open in IMG/M |
| 3300025133|Ga0208299_1227020 | All Organisms → Viruses | 538 | Open in IMG/M |
| 3300025138|Ga0209634_1159835 | All Organisms → Viruses | 908 | Open in IMG/M |
| 3300025138|Ga0209634_1301874 | All Organisms → Viruses | 550 | Open in IMG/M |
| 3300025168|Ga0209337_1073887 | Not Available | 1676 | Open in IMG/M |
| 3300025168|Ga0209337_1311257 | All Organisms → Viruses | 563 | Open in IMG/M |
| 3300025266|Ga0208032_1019933 | All Organisms → Viruses → Predicted Viral | 1949 | Open in IMG/M |
| 3300025276|Ga0208814_1013731 | All Organisms → Viruses → Predicted Viral | 2834 | Open in IMG/M |
| 3300025280|Ga0208449_1120552 | All Organisms → Viruses | 597 | Open in IMG/M |
| 3300025508|Ga0208148_1087128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 693 | Open in IMG/M |
| 3300025652|Ga0208134_1040252 | Not Available | 1562 | Open in IMG/M |
| 3300025652|Ga0208134_1099214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 808 | Open in IMG/M |
| 3300025652|Ga0208134_1121844 | All Organisms → Viruses → environmental samples → uncultured marine virus | 691 | Open in IMG/M |
| 3300025674|Ga0208162_1041665 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300025685|Ga0209095_1068139 | All Organisms → Viruses | 1209 | Open in IMG/M |
| 3300025806|Ga0208545_1095140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 789 | Open in IMG/M |
| 3300025815|Ga0208785_1025490 | All Organisms → Viruses | 1873 | Open in IMG/M |
| 3300025853|Ga0208645_1200587 | Not Available | 707 | Open in IMG/M |
| 3300025881|Ga0209309_10498478 | Not Available | 506 | Open in IMG/M |
| 3300027522|Ga0209384_1024839 | All Organisms → Viruses → Predicted Viral | 1844 | Open in IMG/M |
| 3300027668|Ga0209482_1032641 | All Organisms → Viruses → Predicted Viral | 2073 | Open in IMG/M |
| 3300027906|Ga0209404_10445891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 850 | Open in IMG/M |
| 3300027906|Ga0209404_11110043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 543 | Open in IMG/M |
| 3300028022|Ga0256382_1137677 | Not Available | 586 | Open in IMG/M |
| 3300029787|Ga0183757_1057246 | Not Available | 641 | Open in IMG/M |
| 3300031644|Ga0308001_10373732 | All Organisms → Viruses | 519 | Open in IMG/M |
| 3300034374|Ga0348335_087220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 1029 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 29.84% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 23.39% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 16.13% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.45% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.65% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 4.84% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.03% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.23% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.61% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.81% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.81% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.81% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.81% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.81% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001718 | Marine viral communities from the Pacific Ocean - LP-48 | Environmental | Open in IMG/M |
| 3300001720 | Marine viral communities from the Pacific Ocean - LP-36 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300005747 | Seawater microbial communities from Vineyard Sound, MA, USA - control T14 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006191 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020251 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555940-ERR599040) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300022064 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025881 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102076492 | 3300000101 | Marine | MFDKIKKIFKKKPKVEIEKRTYEKAIDHSNDITFENEVKVKQTKETKSSLTFGE* |
| DelMOSum2010_102284761 | 3300000101 | Marine | KDEKRTYEKKIDHSNDITFENEINKPEVKSETKLETTSSLTFGE* |
| DelMOSum2011_101409843 | 3300000115 | Marine | MFDXIKXXFKKKPKVEKEKRTYEKAIDHGNDITFENEVKVKQTKETKSSLTFGE* |
| DelMOSum2011_101612992 | 3300000115 | Marine | HGTDITFENEVKKPEVKAKPKDTKETKSSLTFGE* |
| DelMOSum2011_101770291 | 3300000115 | Marine | LKDEKRTYEKKIDHSNDITFENEINKPEVKSETKLETTSSLTFGE* |
| DelMOSpr2010_100981753 | 3300000116 | Marine | KAKKVIPEKRTYEKAIDHSNDITFENEVKKPVVTETKETKSELISETKSSLTFGE* |
| DelMOSpr2010_102323071 | 3300000116 | Marine | RTYEKKIDHSNDITFENEINKPEVKSETKSETTSSLTFGE* |
| JGI24006J15134_101878791 | 3300001450 | Marine | DHSNDITFENEIKKEEVKAKVKQTKETKSSLTFGE* |
| JGI24003J15210_101245441 | 3300001460 | Marine | EIEKRTYEKKIDHSNDITFENEIKKPEIKVKVKQTKETKSSLTFGE* |
| JGI24004J15324_101260572 | 3300001472 | Marine | KIDHSNDITFENEIKKEEVKVKVKQTKETKSSLTFGE* |
| JGI24523J20078_10084621 | 3300001718 | Marine | KVEKEKRTYEKKIDHSNDITFENEIKKPESKVKQTKETKSSLTFGE* |
| JGI24513J20088_10057034 | 3300001720 | Marine | NDITFENEVKKPVVTETKKTKSGLISETKSSLTFGE* |
| KVRMV2_1005669523 | 3300002231 | Marine Sediment | MFEXIKXIFKXKXKVEKEKRVYXKAIDHGNXITFEXEVKKPEVKAKPKDTKETKSSLTFGE* |
| Ga0076924_10971231 | 3300005747 | Marine | KPKVEKEKRTYEKAIDHSNDITFENEVKKPEVKSETKETKSETTSSLTFGE* |
| Ga0076924_13019331 | 3300005747 | Marine | KIDHSNDITFENEINKPEVKSETKSETTSSLTFGE* |
| Ga0076924_13175082 | 3300005747 | Marine | KIDHSNDITFENEINKPQVNETITETKSETKSSLTLGE* |
| Ga0075441_102427842 | 3300006164 | Marine | MFEKIKKIFKKKPKVEIEKRTYEKAIDHSNDITFENEVKIKQTKETKSSLTFGE* |
| Ga0075447_100816352 | 3300006191 | Marine | MFDKIKKIFKKKPKVEIEKRTYEKAIDHSNDITFENEVKIKQTKETKSSLTFGE* |
| Ga0098037_12475191 | 3300006737 | Marine | IDHGNDITFENEVKKPEVKSETKETKSETTSSLTFGE* |
| Ga0070749_105407131 | 3300006802 | Aqueous | IDHSNDITFENEVKKPEVKSETKETKSETTSSLTFGE* |
| Ga0070749_106132081 | 3300006802 | Aqueous | IDHSNDITFENEVKKPVVTETKETKSELISETKSSLTFGE* |
| Ga0070754_104060673 | 3300006810 | Aqueous | YEKKIDHSNDITFENEIKKEEVKVKQTKETKSSLTFGE* |
| Ga0070754_104298451 | 3300006810 | Aqueous | IDHSNDITFENEINKPEVKSETKSETTSSLTLGE* |
| Ga0070750_103058041 | 3300006916 | Aqueous | EKRTYEKKIDHSNDITFENEVKVKQTKETKSSLTFGE* |
| Ga0070750_104860781 | 3300006916 | Aqueous | KKPKVEKEKRTYEKKIDHSNDITFENEVKVKQTKETKSSLTFGE* |
| Ga0098050_11676391 | 3300006925 | Marine | KEKRVYEKAIDHGNDITFENEVKKPEVKAKPKDTKETKSSLTFGE* |
| Ga0098041_12141961 | 3300006928 | Marine | PKVEKEKRTYEKAIDHGNDITFENEIKKEEVKSEVKETKETKSSLTFGE* |
| Ga0098036_12009271 | 3300006929 | Marine | DHGNDITFENEVKKPEVKAKPKDTKETKSSLTFGE* |
| Ga0075444_103236942 | 3300006947 | Marine | MFDKIKKIFKKKPKVEIEKRTYDKAIDHSNDITFENEVKVKQTKETKSSLTFGE* |
| Ga0098046_10408441 | 3300006990 | Marine | PKVEKEKRTYEKAIDHGNDITFENEIKKPEVKSETKETKSETTSSLTFGE* |
| Ga0114916_11175131 | 3300008221 | Deep Ocean | KVEIEKRTYEKAIDHSNDITFENEVKKPEVKSETRETKSETTSSLTFGE* |
| Ga0114908_11404133 | 3300009418 | Deep Ocean | EKEKRTYDKAIDHGNDITFENEVKKPEVKAKVKETKETKSSLTFGE* |
| Ga0114915_11986981 | 3300009428 | Deep Ocean | IEKRTYEKAIDHSNDITFENEVKVKQTKETKSSLTFGE* |
| Ga0115562_12474451 | 3300009434 | Pelagic Marine | KDEKRTYEKKIDHSNDITFENEIAKPQVNETVTETKSETKSSLTFGE* |
| Ga0115568_104534801 | 3300009498 | Pelagic Marine | KEKRTYEKEIDHSNDITFENEVKKPEVKSETKETKSETTSSLTFGD* |
| Ga0115567_105640961 | 3300009508 | Pelagic Marine | EKRTYEKAIDHGNDITFENEIKKPEVKSETKETKSETTSSLTFGE* |
| Ga0115011_116440091 | 3300009593 | Marine | EKEKRTYEKAIDHGNDITFENEVKKPEVKAKVKETKETKSSLTFGE* |
| Ga0115011_118465741 | 3300009593 | Marine | IDHSNDITFENEVKKPEVVEVKETVSETKAETKSSLTFGE* |
| Ga0098043_11845261 | 3300010148 | Marine | KPLVLKDEKRTYEKKIDHSNDITFENEIAKPEVKSETRETKSETTSSLTFGE* |
| Ga0098056_11862751 | 3300010150 | Marine | EKEKRVYEKAIDHGNDITFENEVKKPEVKAKPKDTKETKSSLTFGE* |
| Ga0098059_12036253 | 3300010153 | Marine | SNDITFENEIAKPEVKSETKETKSETTSSLTFGE* |
| Ga0098059_12084491 | 3300010153 | Marine | DKPLVLKDEKRTYEKKIDHSNDITYENEVKKPEVKSKLKDTKETKSSLTFGE* |
| Ga0098059_13135121 | 3300010153 | Marine | EKRTYEKKIDHSNDITFENEIKKPEVKSKVKETKETKSSLTFGE* |
| Ga0151672_1151523 | 3300011129 | Marine | YEKKIDHGNDITFENEVKKPEAKVKQTKETKSSLTFGE* |
| Ga0151671_10259632 | 3300011253 | Marine | KKKIDHSNDITFENEIAKPQVNETVTETKSETKSSLTFGE* |
| Ga0160423_108580291 | 3300012920 | Surface Seawater | YEKAIDHSNDITFENEVKKPEVKAKVKETKETKSSLTFGE* |
| Ga0163179_105010151 | 3300012953 | Seawater | EKRTYEKKIDHSNDITFENEVKKPEVKAKLKNTKETKSSLTFGE* |
| Ga0180120_101334131 | 3300017697 | Freshwater To Marine Saline Gradient | TYEKKIDHSNDITFENEINKPEVKSETKSETTSSLTFGE |
| Ga0181403_10733991 | 3300017710 | Seawater | KKIDHSNDITFENEINKPEVKSETRETKSETTSSLTFGE |
| Ga0181404_11835341 | 3300017717 | Seawater | KVEKEKRTDKKEIYHSNDITFENEVKKPEVKSETKETKSETTSSLTFGE |
| Ga0181398_10484594 | 3300017725 | Seawater | EKKIDHSNDITFENEVKKPEAKVKQTKETKSSLTFGE |
| Ga0181398_11307471 | 3300017725 | Seawater | KIDHSNDITFENEINKPEVKSETRETKSETTSSLTFGE |
| Ga0181401_10754511 | 3300017727 | Seawater | YKKEIDHSNDITFENEVKKPEVKSETKETKSETTSSLTFGD |
| Ga0181416_10347241 | 3300017731 | Seawater | EKRTYEKAIDHGNDITFENEVKKPEVKSETKETKSETTSSLTFGK |
| Ga0181416_11637301 | 3300017731 | Seawater | KIEKEKRTYEKVIDHSNDITFEKEVKKPEVKSETKETKSETTSSLTFGE |
| Ga0181415_10959731 | 3300017732 | Seawater | PKVEKNKRTYEKAIDHSNDITFENEIKKPEVKSETKETKSETTSSLTFGE |
| Ga0181415_11611761 | 3300017732 | Seawater | IDHSNDITFENEVKKPEVKSETKETKSETTSSLTFGK |
| Ga0181428_11208962 | 3300017738 | Seawater | RTYEKKIDHSTDISFENEIKKPKVKETKETKSSLTFGE |
| Ga0181433_10282803 | 3300017739 | Seawater | YEKKIDHSTDISFENEIKKPKVKETKETKSSLTFGE |
| Ga0181433_11109411 | 3300017739 | Seawater | KRTYEKAIDHSNDITFENEIKKEEVKSKVKETKETKSSLTFGE |
| Ga0181427_11778893 | 3300017745 | Seawater | VEKEKRTYEKAIDHGNDITFENEIKKPEVKAKVKETKETKSSLTFGE |
| Ga0181427_11855351 | 3300017745 | Seawater | RTYEKKIDHSNDITFENEIKKEEVKVKQTKETKSSLTFGE |
| Ga0181389_11789681 | 3300017746 | Seawater | KRTYDKAIDHSNDITFENEIKKPEVIEVKETVSETKAETKSSLTFGE |
| Ga0181389_11920661 | 3300017746 | Seawater | PKVEKEKRTYEKAIDHGNDITFENEIKKQEVKVKVKQTKETKSSLTFGE |
| Ga0187219_12107901 | 3300017751 | Seawater | KVEKKKRTYEKKIDNSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0181407_10569641 | 3300017753 | Seawater | RTYEKAIDHGNDITFENEIKKEEIKNKKKETKETKSSLTFGV |
| Ga0181407_11890481 | 3300017753 | Seawater | KKPKVEKEKRTYEKAIDHGNDITFENEIKKPEVKEIKETVSETKAETKSSLTFGE |
| Ga0181382_11470462 | 3300017756 | Seawater | MKKELTKKKIDHSNDITFENEINKPKVKSETRETKSETTSSLTFGE |
| Ga0181408_10989561 | 3300017760 | Seawater | EKAIDHSNDITFENEIKKPEVKSETKETKSETTSSLTFGE |
| Ga0181422_11871081 | 3300017762 | Seawater | TYEKAIDHGNDITFENEVKKPEVKVKPKDTKETKSSLTFGE |
| Ga0181406_12179741 | 3300017767 | Seawater | RTYEKAIDHSNDITFENEIKKPEVKSETKETKSETTSSLTFGE |
| Ga0187221_11892871 | 3300017769 | Seawater | PKIEKEKRTYEKKIDHSNDITFENEIKKPEVKSETKETKSSLTFGE |
| Ga0187217_11891323 | 3300017770 | Seawater | VEKEKRTYEKAIDHGNDITFENEIKKQEVKVKVKQTKETKSSLTFGE |
| Ga0181425_11125431 | 3300017771 | Seawater | LKDKKRTYEKKIDHSNDITYENEIKKPQVNETVAETKSETKSSLTFGE |
| Ga0181386_10734621 | 3300017773 | Seawater | KEKRTYEKAIDHGNDITFENEVKKPEVKSETKETKSETTSSLTFGK |
| Ga0181423_11693681 | 3300017781 | Seawater | EKKIDHSNDITFENEINKPEVKSETKSETTSSLTFGE |
| Ga0181380_12168701 | 3300017782 | Seawater | HSNDITFENEIKKPELKEIKSTVSETKLETKSSLTFGK |
| Ga0181424_104219421 | 3300017786 | Seawater | KKIDHSNDITFENEIKKPEVKSKVKETKETKSSLTFGE |
| Ga0181424_104556593 | 3300017786 | Seawater | DHSNDITFENEVKKPEVKSETKETKSETTSSLTFGK |
| Ga0211700_10079223 | 3300020251 | Marine | RTYKKEIDHSNDITFENEVKKPEVKEIKETVSETKSETKSSLTFGE |
| Ga0211686_100459943 | 3300020382 | Marine | MFEKIKKIFKKKPKVEIEKRTYEKAIDYSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0224899_1004411 | 3300022064 | Seawater | EIDYSNDITFENEVKKPEVIEVKETVSETKAETKSSLTFGE |
| Ga0224906_10087757 | 3300022074 | Seawater | KRTYEKKIDHSTDISFENEIKKPKVKETKETKSSLTFGE |
| Ga0224906_10635564 | 3300022074 | Seawater | EKEKRTYEKAIDHGNDITFENEIKKPEVKAKVKETKETKSSLTFGE |
| Ga0224906_11052121 | 3300022074 | Seawater | QKEKPLVLKNEIRTYEKKIDHSTDISFENEIKKPKIKETKETKSSLTFGE |
| Ga0224906_11638243 | 3300022074 | Seawater | AIDHGNDITFENEVKKEEVKAKVKQTKETKSSLTFGE |
| Ga0224906_11959693 | 3300022074 | Seawater | KEKRTYEKAIDHSNDITFENEVKKPEVKSETKETKSETTSSLTFGK |
| Ga0212022_10194211 | 3300022164 | Aqueous | IKKKPKVEKEKRTYEKAIDHGNDITFENEVKVKQTKETKSSLTFGE |
| Ga0212022_10582873 | 3300022164 | Aqueous | KEKRTYEKKIDHSNDITFENEIKKEEVKVKQTKETKSSLTFGE |
| Ga0196903_10024135 | 3300022169 | Aqueous | DHSNDITFENEVKKPEVKSETRETKSETTSSLTFGE |
| Ga0196899_10412693 | 3300022187 | Aqueous | TYEKKIDHSNDITFENEIKKEEVKSKVKQTKETKSSLTFGE |
| Ga0196899_11613613 | 3300022187 | Aqueous | IDHSNDITFENEIKKEEVKSKVKQTKETKSSLTFGE |
| Ga0244777_106636611 | 3300024343 | Estuarine | SKVKKEKRTYKKEIDHSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0207896_10598921 | 3300025071 | Marine | IIMFDKIKKIFKKKPKVEIEKRTYEKAIDHSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0208792_10967833 | 3300025085 | Marine | IDHGNDITFENEVKKPEVKAKVKETKETKSSLTFGE |
| Ga0209535_11462331 | 3300025120 | Marine | IFKKKPKVEIEKRTYEKKIDHSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0209535_11676923 | 3300025120 | Marine | MFDKIKNIFKKKPKVEIEKRTYEKKIDHSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0209535_11793272 | 3300025120 | Marine | EKRTYEKKIDHSNDITFENEVKKEKIKAKETKETKSSLTFGE |
| Ga0208299_12270201 | 3300025133 | Marine | EKRVYEKAIDHGNDITFENEVKKPEVKAKPKDTKETKSSLTFGE |
| Ga0209634_11598351 | 3300025138 | Marine | RTYEKKIDHSNDITFENEVKKPEAKVKQTKETKSSLTFGE |
| Ga0209634_13018741 | 3300025138 | Marine | KRTYEKKIDHSNDITFENEVKKPEAKVKQTKETKSSLTFGE |
| Ga0209337_10738873 | 3300025168 | Marine | AIDHSNDITFENEVKKPEVKSETKETKSETTSSLTFGE |
| Ga0209337_13112571 | 3300025168 | Marine | PKVEKEKRTYKKEIDHSNDITFENEVKKPEVKSETRETKSETTSSLTFGE |
| Ga0208032_10199334 | 3300025266 | Deep Ocean | MFEKIKKIFKKKPKVEIEKRTYEKAIDHSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0208814_10137313 | 3300025276 | Deep Ocean | MFDKIKKIFKKKPKVEIEKRTYEKAIDHSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0208449_11205521 | 3300025280 | Deep Ocean | KKRTYDKAIDHGNDITFENEVKKPEVKAKVKETKETKSSLTFGE |
| Ga0208148_10871284 | 3300025508 | Aqueous | HSNDITFENEIKKPEVKSETKETKSETTSSLTFGE |
| Ga0208134_10402521 | 3300025652 | Aqueous | KAIDHSNDITFENEVKKPVVTETKETKSELISETKSSLTFGE |
| Ga0208134_10992143 | 3300025652 | Aqueous | IDHGNDITFENEVKKPQLNNSSQVDETVSETKSETKFG |
| Ga0208134_11218441 | 3300025652 | Aqueous | TYEKKIDHSNDITFENEINKPQVNETITETKSETKSSLTLGE |
| Ga0208162_10416653 | 3300025674 | Aqueous | DHSNDITFENEVKKPEVKSETKETKSETTSSLTFGE |
| Ga0209095_10681391 | 3300025685 | Pelagic Marine | KAIDHGNDITFENEIKKPEIKAKVKETKETKSSLTFGE |
| Ga0208545_10951401 | 3300025806 | Aqueous | KKIDHSNDITFENEIKKEEVKVKQTKETKSSLTFGE |
| Ga0208785_10254903 | 3300025815 | Aqueous | EKKIDHSNDITFENEIKKEEVKSKVKQTKETKSSLTFGE |
| Ga0208645_12005872 | 3300025853 | Aqueous | YEKKIDHSNDITFENEINKPEVKSETKSETTSSLTFGE |
| Ga0209309_104984782 | 3300025881 | Pelagic Marine | PKVEKEKRTYEKKIDHSNDITFENEIKKPEAKVKQTKETKSSLTFGE |
| Ga0209384_10248393 | 3300027522 | Marine | MFEKIKKIFKKKPKVEIEKRTYEKAIDHSNDITFENEVKIKQTKETKSSLTFGE |
| Ga0209482_10326414 | 3300027668 | Marine | MFEKIKKIFKKKPKVEIEKRTYNKAIDHSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0209404_104458913 | 3300027906 | Marine | KAHKEKRVYEKAIDHGNDITFENEVKKPEVKAKPKDTKETKSSLTFGE |
| Ga0209404_111100433 | 3300027906 | Marine | NDITFENEVKKPEVVEVKETVSETKAETKSSLTFGE |
| Ga0256382_11376771 | 3300028022 | Seawater | KVEKEKRTYEKAIDHGNDITFENEVKKPEVKSETKETKSETTSSLTFGK |
| Ga0183757_10572462 | 3300029787 | Marine | IDHGNDITFENEVKKPEVKAKLKDTKETKSSLTFGE |
| Ga0308001_103737323 | 3300031644 | Marine | KKPKVEIEKRTYEKAIDHSNDITFENEVKVKQTKETKSSLTFGE |
| Ga0348335_087220_1_147 | 3300034374 | Aqueous | VEKEKRTYKKEIDHSNDITFENEVKKPEVKSETRETKSETTSSLTFGE |
| ⦗Top⦘ |