| Basic Information | |
|---|---|
| Family ID | F069317 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 46 residues |
| Representative Sequence | AGIGADATSPQTAILIVAVLTGASGLLVAATSWRPRPALRPAPVP |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.97 % |
| % of genes from short scaffolds (< 2000 bps) | 93.55 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.742 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.387 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.839 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.51% β-sheet: 0.00% Coil/Unstructured: 68.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13847 | Methyltransf_31 | 54.84 |
| PF02635 | DrsE | 7.26 |
| PF04143 | Sulf_transp | 4.84 |
| PF01135 | PCMT | 3.23 |
| PF13649 | Methyltransf_25 | 3.23 |
| PF12840 | HTH_20 | 1.61 |
| PF02416 | TatA_B_E | 0.81 |
| PF07690 | MFS_1 | 0.81 |
| PF13340 | DUF4096 | 0.81 |
| PF08241 | Methyltransf_11 | 0.81 |
| PF13424 | TPR_12 | 0.81 |
| PF13358 | DDE_3 | 0.81 |
| PF01022 | HTH_5 | 0.81 |
| PF11781 | zf-RRN7 | 0.81 |
| PF05988 | DUF899 | 0.81 |
| PF01957 | NfeD | 0.81 |
| PF00211 | Guanylate_cyc | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF14833 | NAD_binding_11 | 0.81 |
| PF00196 | GerE | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 4.84 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 3.23 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 3.23 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 3.23 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 3.23 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.81 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.81 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.74 % |
| Unclassified | root | N/A | 7.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig25927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101272688 | Not Available | 897 | Open in IMG/M |
| 3300000956|JGI10216J12902_110035724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1697 | Open in IMG/M |
| 3300001538|A10PFW1_12477413 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300003992|Ga0055470_10154519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300003999|Ga0055469_10155080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 696 | Open in IMG/M |
| 3300004114|Ga0062593_102175068 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300004156|Ga0062589_101289638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300004480|Ga0062592_100839433 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300005162|Ga0066814_10010466 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300005181|Ga0066678_10982976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 548 | Open in IMG/M |
| 3300005184|Ga0066671_10431718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300005294|Ga0065705_11028908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300005337|Ga0070682_101284387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300005450|Ga0066682_10856343 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005458|Ga0070681_10286520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1557 | Open in IMG/M |
| 3300005467|Ga0070706_100108015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2589 | Open in IMG/M |
| 3300005467|Ga0070706_102034419 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300005468|Ga0070707_100819440 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300005532|Ga0070739_10336958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300005536|Ga0070697_100301026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1378 | Open in IMG/M |
| 3300005542|Ga0070732_10350737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 888 | Open in IMG/M |
| 3300005542|Ga0070732_10350969 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300005546|Ga0070696_101830462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300005576|Ga0066708_10594521 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005598|Ga0066706_10638333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
| 3300006031|Ga0066651_10113769 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300006031|Ga0066651_10510643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300006046|Ga0066652_100570349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
| 3300006575|Ga0074053_11984759 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300006791|Ga0066653_10720237 | Not Available | 517 | Open in IMG/M |
| 3300006794|Ga0066658_10616100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300006797|Ga0066659_11936670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
| 3300006847|Ga0075431_101317601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300006914|Ga0075436_100982831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300006954|Ga0079219_11300051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300007255|Ga0099791_10214122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 910 | Open in IMG/M |
| 3300009088|Ga0099830_10827650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 764 | Open in IMG/M |
| 3300009137|Ga0066709_102023943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 797 | Open in IMG/M |
| 3300009147|Ga0114129_11853975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
| 3300010040|Ga0126308_10812271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300010117|Ga0127449_1079825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 680 | Open in IMG/M |
| 3300010142|Ga0127483_1208392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300010304|Ga0134088_10298015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300010321|Ga0134067_10277741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300011987|Ga0120164_1044007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300011992|Ga0120146_1060641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300012001|Ga0120167_1042624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1024 | Open in IMG/M |
| 3300012093|Ga0136632_10141159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1109 | Open in IMG/M |
| 3300012198|Ga0137364_10855269 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 688 | Open in IMG/M |
| 3300012200|Ga0137382_10820171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 670 | Open in IMG/M |
| 3300012200|Ga0137382_10825279 | Not Available | 668 | Open in IMG/M |
| 3300012201|Ga0137365_11280410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300012204|Ga0137374_10317450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1271 | Open in IMG/M |
| 3300012206|Ga0137380_10351504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1315 | Open in IMG/M |
| 3300012207|Ga0137381_11489641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300012209|Ga0137379_10450401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1196 | Open in IMG/M |
| 3300012210|Ga0137378_10741574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 894 | Open in IMG/M |
| 3300012349|Ga0137387_10870468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300012350|Ga0137372_10053165 | All Organisms → cellular organisms → Bacteria | 3567 | Open in IMG/M |
| 3300012354|Ga0137366_10844624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta | 649 | Open in IMG/M |
| 3300012354|Ga0137366_11080473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300012355|Ga0137369_10321295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1141 | Open in IMG/M |
| 3300012355|Ga0137369_10534508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
| 3300012356|Ga0137371_10096837 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300012356|Ga0137371_10283330 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300012356|Ga0137371_11134297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300012357|Ga0137384_11096110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300012357|Ga0137384_11372067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300012360|Ga0137375_10027213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6542 | Open in IMG/M |
| 3300012363|Ga0137390_11590132 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300012925|Ga0137419_10477018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 987 | Open in IMG/M |
| 3300012930|Ga0137407_10770647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300012964|Ga0153916_10866072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Baekduiaceae → Baekduia → Baekduia soli | 984 | Open in IMG/M |
| 3300012977|Ga0134087_10343749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300012987|Ga0164307_10901098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 712 | Open in IMG/M |
| 3300013104|Ga0157370_10289646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1512 | Open in IMG/M |
| 3300013758|Ga0120147_1088401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300013764|Ga0120111_1116012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
| 3300013765|Ga0120172_1060011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 965 | Open in IMG/M |
| 3300013766|Ga0120181_1078469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 726 | Open in IMG/M |
| 3300014150|Ga0134081_10294402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300014157|Ga0134078_10637579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 515 | Open in IMG/M |
| 3300014157|Ga0134078_10676730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300014497|Ga0182008_10640626 | Not Available | 601 | Open in IMG/M |
| 3300014497|Ga0182008_10710040 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300014823|Ga0120170_1119045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300015357|Ga0134072_10106659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 869 | Open in IMG/M |
| 3300016319|Ga0182033_11314662 | Not Available | 650 | Open in IMG/M |
| 3300018071|Ga0184618_10071321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1310 | Open in IMG/M |
| 3300018072|Ga0184635_10081777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1268 | Open in IMG/M |
| 3300018072|Ga0184635_10239688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300018422|Ga0190265_12759393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 587 | Open in IMG/M |
| 3300018422|Ga0190265_13108820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300018468|Ga0066662_12047243 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300019887|Ga0193729_1045615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1798 | Open in IMG/M |
| 3300020022|Ga0193733_1156922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300021078|Ga0210381_10044463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1308 | Open in IMG/M |
| 3300022883|Ga0247786_1127028 | Not Available | 564 | Open in IMG/M |
| 3300025922|Ga0207646_11910215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 506 | Open in IMG/M |
| 3300025949|Ga0207667_10865296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
| 3300026308|Ga0209265_1072306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1012 | Open in IMG/M |
| 3300026325|Ga0209152_10366159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
| 3300026332|Ga0209803_1274896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300026536|Ga0209058_1298001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 555 | Open in IMG/M |
| 3300026540|Ga0209376_1400382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300027846|Ga0209180_10498557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 682 | Open in IMG/M |
| 3300027882|Ga0209590_10865937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300028784|Ga0307282_10571001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300028791|Ga0307290_10064600 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300028793|Ga0307299_10242417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 677 | Open in IMG/M |
| 3300028803|Ga0307281_10277623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 621 | Open in IMG/M |
| 3300028807|Ga0307305_10051416 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
| 3300028828|Ga0307312_10420725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 878 | Open in IMG/M |
| 3300028885|Ga0307304_10012745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2702 | Open in IMG/M |
| 3300030006|Ga0299907_10403557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1097 | Open in IMG/M |
| 3300031094|Ga0308199_1111184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300031096|Ga0308193_1025708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300031114|Ga0308187_10084300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300032013|Ga0310906_10519383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 809 | Open in IMG/M |
| 3300032180|Ga0307471_102029985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 722 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.26% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 7.26% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.84% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.42% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.81% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.81% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300003992 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010142 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
| 3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
| 3300012001 | Permafrost microbial communities from Nunavut, Canada - A24_80cm_12M | Environmental | Open in IMG/M |
| 3300012093 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013758 | Permafrost microbial communities from Nunavut, Canada - A24_65cm_12M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014823 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_0M | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_01733320 | 2124908044 | Soil | ALIAGIGADTASPQAAILIVALLTGASGLLVAATSWQPRPALRPASVP |
| INPhiseqgaiiFebDRAFT_1012726882 | 3300000364 | Soil | FGFVLGALIAGIGADAASPRTAIVVVALLTGVSGLVVAATSWQPRPALRPAPAP* |
| JGI10216J12902_1100357241 | 3300000956 | Soil | DFGFVAGALIAGLGADATSLSTVIVVVAALTGASGLAVVATPWTTRAPLQPQPAK* |
| A10PFW1_124774132 | 3300001538 | Permafrost | IGADASSPRTAILLVAVLTGASGLLVAATSWQPRAALRPAHVP* |
| Ga0055470_101545191 | 3300003992 | Natural And Restored Wetlands | LGALVAGIGADATSARTAILIVALLTGASGLFVVATSWQPRGVLRPAPVP* |
| Ga0055468_102771151 | 3300003993 | Natural And Restored Wetlands | GALVAGISADASSPETAIAVVAVLTAVSGLVVAATSWQRPAILEPAPAP* |
| Ga0055469_101550801 | 3300003999 | Natural And Restored Wetlands | GADATSPRTAILIVALLTATSGVVVAATAWQPRPVLLPASIP* |
| Ga0062593_1021750681 | 3300004114 | Soil | GADLTSSQTAILIVAVLTGASGLLVAATHWQPRRALRPASVPYK* |
| Ga0062589_1012896382 | 3300004156 | Soil | ADATSPRTAIVIVAVLTGASGVFVAGTSWQPRHALRPAPVR* |
| Ga0062592_1008394332 | 3300004480 | Soil | IAGIGADLTSSQTAILIVAVLTGASGLLVAATHWQPRRALRPASVPYK* |
| Ga0066814_100104661 | 3300005162 | Soil | DFGFVLGALIAGIGADATSTQTAILIAAVLTGASGLLVAATSWQPRRALRPAPVP* |
| Ga0066678_109829762 | 3300005181 | Soil | LIAGIGADATSPRTAIVIVAVLTGASGLFVAVTSWQPRPSLRPAPVP* |
| Ga0066671_104317183 | 3300005184 | Soil | LGALIAGIGADATSPRTAILVVAVLTGASGLLVAATSWQPRPVLQPAAAP* |
| Ga0065705_110289082 | 3300005294 | Switchgrass Rhizosphere | DFGFVLGALIAGIGADVTSTSTAILIVALLTGASGLFVAATSWQPRGALHPAPVP* |
| Ga0070682_1012843872 | 3300005337 | Corn Rhizosphere | GALIAGVGADATSPRTAIMIVAVLTGASGSLVAATSWQPRAALRPASIP* |
| Ga0066682_108563432 | 3300005450 | Soil | LGALIAGIGADATSPQTAILIVAVLTGASGLLVAATSWQPRHALRPASVP* |
| Ga0070681_102865204 | 3300005458 | Corn Rhizosphere | GALIAGVGADATSPRTAIVIVAVLTGASGALVAATSWEPRAALRPAPVP* |
| Ga0070706_1001080152 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | GALIAGIGADTTSPKTAILIVAALTGASGLLVAATSWQPRTAFRAASVP* |
| Ga0070706_1020344191 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ADATSPRTAILIVAILTGASGLLVAATNWQPRPTLQPAPAP* |
| Ga0070707_1008194401 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GALIAGIGADATSSQTAILIVAVLTGASGLLVAATSWQSRPVLRPASVS* |
| Ga0070739_103369581 | 3300005532 | Surface Soil | FVLGALIAGFGADATSARTAILIVALLTGASGLFVAATSWRRRPRLEPAPAS* |
| Ga0070697_1003010261 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GALIAGIGADAASPRTAILVVAVLTAASGLLVAATSWQRRQRLEPQPVR* |
| Ga0070732_103507371 | 3300005542 | Surface Soil | LIAGFGADATSARTAILIVALLTGASGLFVAATSWRQRPHLEPAPAS* |
| Ga0070732_103509691 | 3300005542 | Surface Soil | LGALIAGIGADATSPRTAILIVAALTGASGLLVAATSWKPRPVLQPNPRLVIGE* |
| Ga0070696_1018304621 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | GFVLGALIAGIGADATSPKTAILIVALLTGASGLLVAATNWQPRPTLQPAPAP* |
| Ga0066708_105945211 | 3300005576 | Soil | IAGVGADATSTQTAILIVALLTGASGLLVAATSWQPRRALRPASVP* |
| Ga0066706_106383333 | 3300005598 | Soil | VLGALIAGLGADASSRRTAIAIVAGLTGASGLIVAATSWQPRPALRAATAPNR* |
| Ga0066651_101137691 | 3300006031 | Soil | DFGFVLGALIAGIGADTTSPQTAILIVAVLTGASGILVAATSWRPRPVLQTAVLRTP* |
| Ga0066651_105106431 | 3300006031 | Soil | VVGALIAGIGADATSTQTAIVIVAVLTGASGLFVALTSWQPRRALRPASVP* |
| Ga0066652_1005703491 | 3300006046 | Soil | QTAILIVALLTGASGLFVAATSWQPRRALRPASIP* |
| Ga0082029_11640891 | 3300006169 | Termite Nest | GVGADATSRGTAIAIVAVLTAASGVLVAVTSWRPQPSLRLAT* |
| Ga0074053_119847594 | 3300006575 | Soil | IGADATSTQTAILIAAVLTGASGLLVAATSWQPRRALRPAPVP* |
| Ga0066653_107202372 | 3300006791 | Soil | DFGFVLGALIAGVGADATRPRTAILIVAALTGASGLLVAATSWQPRRALRPASVP* |
| Ga0066658_106161002 | 3300006794 | Soil | GFVLGALIAGIGADLTSSQTAILIVAVLTGASGLLVAATHWQPRRPLRPASVP* |
| Ga0066659_119366702 | 3300006797 | Soil | STSTPTAILIVAVLTGVSGLLVAATSWQPRPALRPASVP* |
| Ga0075431_1013176011 | 3300006847 | Populus Rhizosphere | VGALIAGIGADATSAQTAILVIALLTGASGLVVAATSWQPRGALHPAPVP* |
| Ga0075436_1009828311 | 3300006914 | Populus Rhizosphere | IGADATSAGTAIVIVAVITAASGLVVGATSWPPRPALQPAPAP* |
| Ga0079219_113000512 | 3300006954 | Agricultural Soil | FVLGALIAGIGADATSPRTAIVIVALLTGASGLLVAATSWQPRPVLRAAAAP* |
| Ga0099791_102141221 | 3300007255 | Vadose Zone Soil | PRTAILIVAVLTGASGLLVAATSWRPQPALRPAPVPYQPVNQ* |
| Ga0099830_108276501 | 3300009088 | Vadose Zone Soil | TAILIVAVLTGASGLLVAATSWQPRPELRPATAPNR* |
| Ga0066709_1020239433 | 3300009137 | Grasslands Soil | AGIGADATSPQTAILIVAVLTGASGLLVAATSWRPRPALRPAPVP* |
| Ga0114129_118539752 | 3300009147 | Populus Rhizosphere | LGALIAGIGADVASPRTAILIVAVLTGASGLLVAATSWQPQPVLRPASVP* |
| Ga0126308_108122711 | 3300010040 | Serpentine Soil | FGFVLGALITGIGADATSTETAILIVALLTGASALLVAATSWQPRAALRPASVR* |
| Ga0127449_10798251 | 3300010117 | Grasslands Soil | GIGADATSAQTAILIVAVITGASGLFVAATSWQPRRALRPAAVP* |
| Ga0127483_12083921 | 3300010142 | Grasslands Soil | GIGADATSTQTAILIVAVLTGASGLLVAVTHWQPRRALRPASVP* |
| Ga0134088_102980152 | 3300010304 | Grasslands Soil | DFGFVLGALIAGIGADATSTKTAILIVTVLTGASGLLVGATSWQPRRALRPASVP* |
| Ga0134067_102777413 | 3300010321 | Grasslands Soil | AGIGADAASPRTAILVVAVLTAASGVLVAGTSWQRRERLEPQPVR* |
| Ga0120164_10440072 | 3300011987 | Permafrost | IGADATSTQTAILIVAVLTGASGLLVAATSWQPRTALRPASIPLI* |
| Ga0120146_10606411 | 3300011992 | Permafrost | LTAGIGADATSARTAILLVALLTAASGLVVTATSWKSRPTLEPLPVVR* |
| Ga0120167_10426241 | 3300012001 | Permafrost | ALIAGIGADASSPRTAILLVAVLTGASGLLVAATSWQPRAALRPAHVP* |
| Ga0136632_101411591 | 3300012093 | Polar Desert Sand | QTAILIVALLTGASGLLVAATPWQPRPALRPASVR* |
| Ga0137364_108552691 | 3300012198 | Vadose Zone Soil | DFGFVLGALIAGIGADTTSPKTAILIVAALTGASGLLVAATSWQPRTTFRAAPAP* |
| Ga0137382_108201711 | 3300012200 | Vadose Zone Soil | LIGGIGADLTSSHTAILIVAVLTGASGLLVAATSWQPRAALRPAPVP* |
| Ga0137382_108252792 | 3300012200 | Vadose Zone Soil | LIAGIGADATSPRTAIVIVALLTGASGLFVVATAWQTRPSFRPAPVP* |
| Ga0137365_112804101 | 3300012201 | Vadose Zone Soil | TSTQTAILIVAVLTGVSGLLVAATHWQPRRALRPASVP* |
| Ga0137374_103174503 | 3300012204 | Vadose Zone Soil | WRDFGFVLGALIAGIGADATSARTAILIVALLTGASGLFVAATSWQPRGALHPAPVP* |
| Ga0137380_103515041 | 3300012206 | Vadose Zone Soil | VLGALIAGLGADATSAKTAIVVVGVLTGASGLVVAATSWQPRLRPATVH* |
| Ga0137381_114896413 | 3300012207 | Vadose Zone Soil | LGALIAGVGADATTQRTAILIVAALTGASGLFVAATSWQPRRALRPASVP* |
| Ga0137379_104504013 | 3300012209 | Vadose Zone Soil | GALIAGIGADATSPRAAIAIVALLTGASGLLVAGTSWQPRPTLRPAVP* |
| Ga0137378_107415742 | 3300012210 | Vadose Zone Soil | NRRSPTATRADATSPQTAILIVALLTGASGLLVAATSWRPRTALRAAPAP* |
| Ga0137387_108704682 | 3300012349 | Vadose Zone Soil | GADATSPQTAILIVALLTGASGLLVAATSWQPRPALRPAPFP* |
| Ga0137372_100531655 | 3300012350 | Vadose Zone Soil | FGFVIGALVAGMGADATSPRTAILIVAVLTGASGAWVAATSWRPRPALRPAPVP* |
| Ga0137367_111336642 | 3300012353 | Vadose Zone Soil | ADATSPRTAILLVAVLTAASGLIVTGTSWRPQRTLDPLPIR* |
| Ga0137366_108446241 | 3300012354 | Vadose Zone Soil | PRTAIVIVAALTGGSGLLVASTTWQPGRTLRPASVP* |
| Ga0137366_110804731 | 3300012354 | Vadose Zone Soil | PRTAILIVAVLTGASGAWVAATSWRPRPALRPVTQEE* |
| Ga0137369_103212951 | 3300012355 | Vadose Zone Soil | LGALIAGIGADATSPSTAILIVALLTCASGLLVTATSWQPRPVLRPAAAPNR* |
| Ga0137369_105345081 | 3300012355 | Vadose Zone Soil | GMGADATSPRTAILIVAVLTGASGAWVAATSWRPRPALRPAPVP* |
| Ga0137371_100968371 | 3300012356 | Vadose Zone Soil | ARTAIVVVAAFTSASGLLVAATSWHPRPQHRPEPVPVP* |
| Ga0137371_102833301 | 3300012356 | Vadose Zone Soil | TSTPTAILVVAVLTGVSGLLVAATSWQPRRALRPAAVP* |
| Ga0137371_111342971 | 3300012356 | Vadose Zone Soil | DATSTQTAIVIVALLTGASGLLVAATSWQPRRALRPASVH* |
| Ga0137384_110961102 | 3300012357 | Vadose Zone Soil | FVFGALIVGIGADATSPRTAIVIVAVLTGASGVLVAATSWQPRVALRPAPVP* |
| Ga0137384_113720672 | 3300012357 | Vadose Zone Soil | QTAILIVAVLTGASSLLVAATSWQPRPALRPASVP* |
| Ga0137375_100272131 | 3300012360 | Vadose Zone Soil | LGALVAGIGADATSPRTAILLVAVLTAASGLIVTGTSWRPQRTLDPLPIR* |
| Ga0137390_115901322 | 3300012363 | Vadose Zone Soil | GIGADATSAQTAILIVAVLTGASGLVVAATSWQPRPALRPASVA* |
| Ga0137419_104770181 | 3300012925 | Vadose Zone Soil | GALIAGIGADATSARAAILIVAALTGASGLLVAGTSWQLRPALRPAPAP* |
| Ga0137407_107706472 | 3300012930 | Vadose Zone Soil | TAILIVAALTGASGLLVAATSWQPRTALRPAPVP* |
| Ga0153916_108660722 | 3300012964 | Freshwater Wetlands | LGALIAGIGADLTSDQAAILIVATLTAASGLVIAATAWEPRSGLRAVALGEGD* |
| Ga0134087_103437492 | 3300012977 | Grasslands Soil | LGALIVGVGADATTPRTAIVIVAALTGASGLLVAATSWQPRPTLRPASVP* |
| Ga0164307_109010982 | 3300012987 | Soil | AGIGADATSPRTAIVIVAVLTGASGVLVAATSWQPRAALRAAPVP* |
| Ga0157370_102896461 | 3300013104 | Corn Rhizosphere | ATSTRTAILIVALLTGASGLVVAATSWQRRPILEPAPLTWR* |
| Ga0120147_10884011 | 3300013758 | Permafrost | GIGADATSPQTAILIVALLTGASGLLVAATSWQPRTALRPASIPLR* |
| Ga0120111_11160122 | 3300013764 | Permafrost | DFGLVLGALIAGIGADLTSSQTAILIVAVLTGASGLLVAATSWQPRRALRPASIPYR* |
| Ga0120172_10600114 | 3300013765 | Permafrost | LGALIAGVGADATSPRMAILIVAALTGASGLLVAGTSWEPRTAFRPAAVP* |
| Ga0120181_10784692 | 3300013766 | Permafrost | EFGFVLGALIAGIGADATSPQAAILIVSALTGGSGLLVAATSWKPRPTLQPNPPLAIRE* |
| Ga0134081_102944021 | 3300014150 | Grasslands Soil | TSTQTAILIVALLTGASGLFVAATSWQPRRALRPASIP* |
| Ga0134078_106375792 | 3300014157 | Grasslands Soil | AGIGADATSPRTAILVVAVLTGASGLLVAATSWQPRPVLQPAAAP* |
| Ga0134078_106767301 | 3300014157 | Grasslands Soil | TAIAIVAGLTGASGLIVAATSWQPRPALRAATAPNR* |
| Ga0182008_106406261 | 3300014497 | Rhizosphere | PRTAILIVAVLTAVSGLLVAATSWQRRQRLEPQPVR* |
| Ga0182008_107100402 | 3300014497 | Rhizosphere | AQTAILIVALLTGASGLFVAATSWRRRPRLEPAPA* |
| Ga0120170_11190452 | 3300014823 | Permafrost | LIAGIGADATSTQTAILIVAVLTGASGLLVAATSWRPRRVLRPASVP* |
| Ga0134072_101066592 | 3300015357 | Grasslands Soil | GFVVGALIAGVGADATSTQTAILIVALLTGASGLFVAATSWQPRRALRPASIP* |
| Ga0182033_113146621 | 3300016319 | Soil | GIAADASSARTAIVIVALLTAASGLVVAATAWQPRRTLRTATAP |
| Ga0184618_100713212 | 3300018071 | Groundwater Sediment | DFGFVLGALIAGFGADATSSRTAILIVAVLTGASGMFVAGTSWQPRRALRPASVP |
| Ga0184635_100817771 | 3300018072 | Groundwater Sediment | VLGALIAGIGADATSPQTAIAIVALLTGASGLLVAGTSWQPRGALRPAPVP |
| Ga0184635_102396881 | 3300018072 | Groundwater Sediment | AGIGADATSARTAILIVALLTGASGLFVAATSWQPRGALHPAPVP |
| Ga0190265_127593931 | 3300018422 | Soil | IAGIGADATSARTAILIVALLTGASGLFVAATSWRPRGALRPAPVR |
| Ga0190265_131088201 | 3300018422 | Soil | IGAAATSQQAAILVVALLPGVSGLLVAATSWQPRPALRPAPAP |
| Ga0066662_120472431 | 3300018468 | Grasslands Soil | ADATSAQTAILIVAVLTGASGLLVAATSWQPRPALRPAPVP |
| Ga0193729_10456151 | 3300019887 | Soil | GIGADATSTQTAILIVAVLTGASGLLVAATHWQPRHALRPASVP |
| Ga0193733_11569221 | 3300020022 | Soil | ATSTQTAILIVALLTGASGLFVAATSWQPRRALRPASIP |
| Ga0210381_100444634 | 3300021078 | Groundwater Sediment | TSTQTAILIVAVLTGASGLLVAATHWQPRHALRPASVP |
| Ga0247786_11270281 | 3300022883 | Soil | AQTAILVVAALTAASGVLVAATSWRPRRALRPASVP |
| Ga0207646_119102151 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IGADATSPKTAILIVAVLTGASGLLVAVTSWQPRAALRPAPVP |
| Ga0207667_108652962 | 3300025949 | Corn Rhizosphere | DFGFVLGALIAGVGADATSPRTAIVIVAVLTGASGALVAATSWEPRAALRPAPVP |
| Ga0209265_10723061 | 3300026308 | Soil | GIGADATSAQAAILLVALLTGASGLLVAATSWQPRPALRPAAP |
| Ga0209152_103661592 | 3300026325 | Soil | GALIAGIGADAASPRTAILVVAVLTAASGLLVAATSWQRRQRLEPQPVR |
| Ga0209803_12748962 | 3300026332 | Soil | FGFVLGALIAGIGADSTSTQTAILIVAVLTGVSGLLVAATSWQPRPALRPASVP |
| Ga0209058_12980011 | 3300026536 | Soil | GISADAASPQSAIAIVALLTGASGLLVAATSWQARGALRPAPAP |
| Ga0209376_14003822 | 3300026540 | Soil | DATSTQTAILIVALLTGASGLFVAATSWQPRRALRPASIP |
| Ga0209180_104985571 | 3300027846 | Vadose Zone Soil | PRTAIVIVAVLTGASGVLVAATSWQPRAALRPAPVP |
| Ga0209590_108659372 | 3300027882 | Vadose Zone Soil | GFVLGALVAGFGADATSSRTAIVIVAVLTGASGVLVAATSWRPRAALRPAPVP |
| Ga0307282_105710012 | 3300028784 | Soil | IAGIGADATSTQTAILIVAVLTGASGLLVGATSWQPRSALRPASIS |
| Ga0307290_100646001 | 3300028791 | Soil | ILIVAALTGASGLLVAATSWQPRHFLQPSSGRGSA |
| Ga0307299_102424171 | 3300028793 | Soil | GALIAGVGADATTPRTAILIVAALTGASGLLVAATSWQPRPALRPAAVP |
| Ga0307281_102776232 | 3300028803 | Soil | TSPQTAILIVALLTGASGLLVATTSWRPRSALRPASVP |
| Ga0307305_100514161 | 3300028807 | Soil | LIAGIGADATSPQTAILIVALLTGASGLLVAATSWQPRTALRAAPVP |
| Ga0307312_104207253 | 3300028828 | Soil | ATSPRTAIVIVAVLTGASGVLVAATSWQPRAALRPAPVP |
| Ga0307304_100127456 | 3300028885 | Soil | QTAILIVAVLTGASGLLVAATHWQPRHALRPASVP |
| Ga0299907_104035571 | 3300030006 | Soil | FWRDFGFVLGALIAGIGADATSARTAILIVALLTGVSGLFVASTSWQPRGALRPASVP |
| Ga0308199_11111842 | 3300031094 | Soil | VLGALIAGIGADLTSSQTAILIVAVLTGASGLLVAATHWQPRHALRPASVP |
| Ga0308193_10257081 | 3300031096 | Soil | LIAGIGADATSTQTAILIGAVLTGASGLLVAATHWQPRHALRPASVP |
| Ga0308187_100843001 | 3300031114 | Soil | GIGADATSTQTAILIVAVLTGASGLLVAATSWQPRHALRHASVP |
| Ga0310906_105193832 | 3300032013 | Soil | VTSAQTAIAIVAILTGASGLLVAATSWQPRGSLQPAPVP |
| Ga0307471_1020299851 | 3300032180 | Hardwood Forest Soil | IAGIGADASSARTAILIVALLTGASGLIVAATSWQPRPALRPAAVP |
| ⦗Top⦘ |