| Basic Information | |
|---|---|
| Family ID | F069300 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 42 residues |
| Representative Sequence | GGFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPQK |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.45 % |
| % of genes near scaffold ends (potentially truncated) | 92.74 % |
| % of genes from short scaffolds (< 2000 bps) | 87.10 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.581 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (35.484 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.258 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 0.00% Coil/Unstructured: 95.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF03551 | PadR | 7.26 |
| PF12704 | MacB_PCD | 5.65 |
| PF04185 | Phosphoesterase | 5.65 |
| PF05163 | DinB | 2.42 |
| PF02687 | FtsX | 2.42 |
| PF02129 | Peptidase_S15 | 1.61 |
| PF10282 | Lactonase | 1.61 |
| PF07883 | Cupin_2 | 1.61 |
| PF06283 | ThuA | 1.61 |
| PF00563 | EAL | 0.81 |
| PF13365 | Trypsin_2 | 0.81 |
| PF01381 | HTH_3 | 0.81 |
| PF00239 | Resolvase | 0.81 |
| PF04952 | AstE_AspA | 0.81 |
| PF00990 | GGDEF | 0.81 |
| PF00480 | ROK | 0.81 |
| PF06197 | DUF998 | 0.81 |
| PF13231 | PMT_2 | 0.81 |
| PF13557 | Phenol_MetA_deg | 0.81 |
| PF01663 | Phosphodiest | 0.81 |
| PF03773 | ArsP_1 | 0.81 |
| PF08818 | DUF1801 | 0.81 |
| PF13701 | DDE_Tnp_1_4 | 0.81 |
| PF12623 | Hen1_L | 0.81 |
| PF01738 | DLH | 0.81 |
| PF00174 | Oxidored_molyb | 0.81 |
| PF17170 | DUF5128 | 0.81 |
| PF07805 | Obsolete Pfam Family | 0.81 |
| PF07228 | SpoIIE | 0.81 |
| PF08281 | Sigma70_r4_2 | 0.81 |
| PF13847 | Methyltransf_31 | 0.81 |
| PF11008 | DUF2846 | 0.81 |
| PF04255 | DUF433 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 7.26 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 7.26 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 7.26 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 5.65 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.42 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.61 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 1.61 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.81 |
| COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 0.81 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.81 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.81 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.81 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.81 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.81 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.81 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.81 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.81 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.81 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.58 % |
| Unclassified | root | N/A | 2.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10890761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300001661|JGI12053J15887_10262378 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300002917|JGI25616J43925_10172571 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300005174|Ga0066680_10370258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 912 | Open in IMG/M |
| 3300005332|Ga0066388_101739588 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300005536|Ga0070697_101511065 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005555|Ga0066692_10032619 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
| 3300005559|Ga0066700_10736307 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005560|Ga0066670_10910533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300005568|Ga0066703_10160686 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300005602|Ga0070762_10995364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300005921|Ga0070766_10342514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300006034|Ga0066656_10585862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300006162|Ga0075030_101316486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
| 3300006172|Ga0075018_10013920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3019 | Open in IMG/M |
| 3300006174|Ga0075014_100971923 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300006796|Ga0066665_10567950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 919 | Open in IMG/M |
| 3300006893|Ga0073928_10049732 | All Organisms → cellular organisms → Bacteria | 3792 | Open in IMG/M |
| 3300007258|Ga0099793_10350848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300007788|Ga0099795_10086401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1209 | Open in IMG/M |
| 3300007788|Ga0099795_10541501 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300009038|Ga0099829_10328184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1258 | Open in IMG/M |
| 3300009088|Ga0099830_10343147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
| 3300009088|Ga0099830_11836465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300009089|Ga0099828_10200805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1779 | Open in IMG/M |
| 3300009090|Ga0099827_10205486 | Not Available | 1640 | Open in IMG/M |
| 3300009143|Ga0099792_10792532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
| 3300009177|Ga0105248_10156549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2571 | Open in IMG/M |
| 3300010047|Ga0126382_10934639 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300010048|Ga0126373_10239705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. WH15 | 1779 | Open in IMG/M |
| 3300010301|Ga0134070_10272934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300010337|Ga0134062_10584610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300010358|Ga0126370_11321495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300010376|Ga0126381_101598655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300011269|Ga0137392_10412485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1121 | Open in IMG/M |
| 3300011269|Ga0137392_11240249 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300011270|Ga0137391_10243762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1559 | Open in IMG/M |
| 3300012096|Ga0137389_10169420 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1801 | Open in IMG/M |
| 3300012189|Ga0137388_11979055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300012198|Ga0137364_10874067 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300012202|Ga0137363_10004507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8549 | Open in IMG/M |
| 3300012202|Ga0137363_10171912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1719 | Open in IMG/M |
| 3300012202|Ga0137363_10625088 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300012208|Ga0137376_10172262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1867 | Open in IMG/M |
| 3300012211|Ga0137377_10075103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3171 | Open in IMG/M |
| 3300012361|Ga0137360_11238607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300012361|Ga0137360_11269624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300012362|Ga0137361_10011156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6450 | Open in IMG/M |
| 3300012582|Ga0137358_10115828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1819 | Open in IMG/M |
| 3300012683|Ga0137398_10135783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1584 | Open in IMG/M |
| 3300012683|Ga0137398_10644288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 734 | Open in IMG/M |
| 3300012685|Ga0137397_11276562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300012917|Ga0137395_10762789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300012918|Ga0137396_10698391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300012923|Ga0137359_10332544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1351 | Open in IMG/M |
| 3300012923|Ga0137359_10598771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300012924|Ga0137413_10654200 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 792 | Open in IMG/M |
| 3300012925|Ga0137419_11282391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300012927|Ga0137416_10943306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300014166|Ga0134079_10003899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4242 | Open in IMG/M |
| 3300015054|Ga0137420_1393876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300015374|Ga0132255_106290271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300016270|Ga0182036_10096826 | Not Available | 1995 | Open in IMG/M |
| 3300016270|Ga0182036_10334677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1162 | Open in IMG/M |
| 3300016357|Ga0182032_10041445 | All Organisms → cellular organisms → Bacteria | 2914 | Open in IMG/M |
| 3300016422|Ga0182039_10285226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1361 | Open in IMG/M |
| 3300017972|Ga0187781_10178601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1495 | Open in IMG/M |
| 3300017973|Ga0187780_10908515 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300018431|Ga0066655_10308337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300020140|Ga0179590_1054247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
| 3300020579|Ga0210407_10596003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 861 | Open in IMG/M |
| 3300020579|Ga0210407_10604887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300020579|Ga0210407_10903173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300020580|Ga0210403_10006182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 10069 | Open in IMG/M |
| 3300020580|Ga0210403_10686264 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300020581|Ga0210399_10065957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2926 | Open in IMG/M |
| 3300020581|Ga0210399_10409230 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300020583|Ga0210401_10914337 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300021171|Ga0210405_10575618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300021420|Ga0210394_11651133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300021432|Ga0210384_11858107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300021478|Ga0210402_10319959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300021479|Ga0210410_10265439 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300021559|Ga0210409_10010869 | All Organisms → cellular organisms → Bacteria | 9146 | Open in IMG/M |
| 3300021560|Ga0126371_11334446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300026297|Ga0209237_1141721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300026313|Ga0209761_1010789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5946 | Open in IMG/M |
| 3300026323|Ga0209472_1174912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300026328|Ga0209802_1084541 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1463 | Open in IMG/M |
| 3300026335|Ga0209804_1188701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300026482|Ga0257172_1074208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300026482|Ga0257172_1111975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300026514|Ga0257168_1081815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300026537|Ga0209157_1079582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1613 | Open in IMG/M |
| 3300026548|Ga0209161_10257845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300026551|Ga0209648_10019637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5906 | Open in IMG/M |
| 3300026551|Ga0209648_10115161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2179 | Open in IMG/M |
| 3300026557|Ga0179587_10504658 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300027512|Ga0209179_1013481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1486 | Open in IMG/M |
| 3300027610|Ga0209528_1079418 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300027671|Ga0209588_1152290 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300027846|Ga0209180_10224165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
| 3300027874|Ga0209465_10267272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300027875|Ga0209283_10342888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 981 | Open in IMG/M |
| 3300027903|Ga0209488_10348808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300027903|Ga0209488_10659558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300028047|Ga0209526_10375959 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300028536|Ga0137415_10475393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
| 3300029636|Ga0222749_10420723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300031446|Ga0170820_17778518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300031680|Ga0318574_10812054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300031754|Ga0307475_10377992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1138 | Open in IMG/M |
| 3300031777|Ga0318543_10465170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300031835|Ga0318517_10455271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300031879|Ga0306919_10741397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300031890|Ga0306925_11406910 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300031912|Ga0306921_10116574 | Not Available | 3108 | Open in IMG/M |
| 3300031912|Ga0306921_11331395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300031946|Ga0310910_10242455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 1408 | Open in IMG/M |
| 3300031962|Ga0307479_11222073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300032059|Ga0318533_11138564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300032180|Ga0307471_101163079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300032180|Ga0307471_103165335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300033289|Ga0310914_11288182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 35.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.23% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.61% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_108907612 | 3300001593 | Forest Soil | GGFAMMPSKAPHWFICTAKEECLMFVTFDRAYDIVWLKPNK* |
| JGI12053J15887_102623781 | 3300001661 | Forest Soil | MMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPAK* |
| JGI25616J43925_101725711 | 3300002917 | Grasslands Soil | MAEATLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAQPPK* |
| Ga0066680_103702583 | 3300005174 | Soil | GPGGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWLKPNK* |
| Ga0066388_1017395882 | 3300005332 | Tropical Forest Soil | ILGPGGFAMMPSKQPHWFTCTAKEECLMFVTFDRAYDIVWLKPNS* |
| Ga0070697_1015110652 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEATLGPGGFAMMPSKAMHWFTCQSKSTCLMFVTFDRTYDIVWAQPGK* |
| Ga0066692_100326192 | 3300005555 | Soil | EATLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRTYDIVWAKPQK* |
| Ga0066700_107363072 | 3300005559 | Soil | ATLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKTPK* |
| Ga0066670_109105331 | 3300005560 | Soil | VLHAGGFAMMPSKAVHWFSCTAKEECVMFVTFDRVYDIVWVKQNK* |
| Ga0066703_101606862 | 3300005568 | Soil | TLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPPK* |
| Ga0070762_109953641 | 3300005602 | Soil | AMMPSKAMHWFTCKSKNTCLMFVTFDRTYDIVWAKQAK* |
| Ga0070766_103425144 | 3300005921 | Soil | PGGFAMMPSKAMHWFTCKSKNTCLMFVTFDRTYDIVWAKQPK* |
| Ga0066656_105858621 | 3300006034 | Soil | MASKQVHWFSCTAKEECLMFVTFDRAYDIVWVKQSK* |
| Ga0075030_1013164861 | 3300006162 | Watersheds | GGFAMMPSKAMHWFTCKSKNTCLMFVTFDGTYDIVWAKQAK* |
| Ga0075018_100139203 | 3300006172 | Watersheds | MMPGKAMHWFTCQSKDACLMFVTFDRTYDIVWAKPQK* |
| Ga0075014_1009719232 | 3300006174 | Watersheds | GPGGFAMMPSKAMHWFTCKSRDTCLMFVTFDRKYDIVWAKPQK* |
| Ga0066665_105679503 | 3300006796 | Soil | FAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWIKPGK* |
| Ga0073928_100497321 | 3300006893 | Iron-Sulfur Acid Spring | FAMMPSKQPHWFTCTAQEECLMFVTFDRAYDIVWLKPSK* |
| Ga0099793_103508481 | 3300007258 | Vadose Zone Soil | TLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRMYDIVWAKPQK* |
| Ga0099795_100864011 | 3300007788 | Vadose Zone Soil | GGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWIKPDK* |
| Ga0099795_105415011 | 3300007788 | Vadose Zone Soil | PGGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWIKPDK* |
| Ga0099829_103281842 | 3300009038 | Vadose Zone Soil | MPDTVLGPGGFAMMPSKQPHWFTCTAKEECLMFVSFDRPYDIVWLTPNK* |
| Ga0099830_103431471 | 3300009088 | Vadose Zone Soil | SKAPHWFTCTAKEECLMFVTFDRAYDIVWIKPDK* |
| Ga0099830_118364652 | 3300009088 | Vadose Zone Soil | GGFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPQK* |
| Ga0099828_102008051 | 3300009089 | Vadose Zone Soil | MMPSKEKHWFSCKSKDGCLMFVTFDRVYDIFWVK* |
| Ga0099827_102054864 | 3300009090 | Vadose Zone Soil | MMPGKAMHWFSCKSKEPCLMFVTFDRAYDIVWAKPQK* |
| Ga0099792_107925321 | 3300009143 | Vadose Zone Soil | VLGPGGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWIKPDK* |
| Ga0105248_101565494 | 3300009177 | Switchgrass Rhizosphere | LEPGGFAMMPGKQTHWFTCMSKEGCLMFVTFDRTYDIVWVKDEK* |
| Ga0126382_109346392 | 3300010047 | Tropical Forest Soil | DTVLGPGGFAMMPSKQPHWFACTAKEECLMFVTFDRPYDIVWLKPNK* |
| Ga0126373_102397053 | 3300010048 | Tropical Forest Soil | DTVLGPGGFAMMPSKQPHWFTCTPQEECLMFVTFDRPYDIVWLKPNK* |
| Ga0134070_102729342 | 3300010301 | Grasslands Soil | PSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPPK* |
| Ga0134062_105846102 | 3300010337 | Grasslands Soil | AMMPGKETHWFTCMSKEGCLMFVTFDRAYDIVWVKQSK* |
| Ga0126370_113214951 | 3300010358 | Tropical Forest Soil | MSEMVLGAGGFAMMPSKQVHWFTCTSKDSCLMFVTFDRKYDITWVKDKK* |
| Ga0126381_1015986551 | 3300010376 | Tropical Forest Soil | MMPSKRPHWFTCMATEECLMFVTFDRAYDIVWLKPNK* |
| Ga0137392_104124851 | 3300011269 | Vadose Zone Soil | LQAGGFAMMPGKEKHWFSCKSKDSCLMFVTFDRAYDIFWVK* |
| Ga0137392_112402491 | 3300011269 | Vadose Zone Soil | PGGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWLKPTK* |
| Ga0137391_102437621 | 3300011270 | Vadose Zone Soil | PGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPQK* |
| Ga0137389_101694202 | 3300012096 | Vadose Zone Soil | PGGFAMMPSKAMHWFTCKSKDSCLMFVTFDRTYDIVWAKPQK* |
| Ga0137388_119790552 | 3300012189 | Vadose Zone Soil | PSKAMHWFTCKSKVTCLMFVTFDRKYDIVWAQPAK* |
| Ga0137364_108740671 | 3300012198 | Vadose Zone Soil | MAEATLGPGGFALMPSKAMHCFTCKLKNTCLMFVTFDRTYDIVWAKQAK* |
| Ga0137363_100045071 | 3300012202 | Vadose Zone Soil | GFAMMPSKTMHWFSCKSKDACLMFVTFDRTYDIVWAKPQK* |
| Ga0137363_101719121 | 3300012202 | Vadose Zone Soil | MMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWLKPSK* |
| Ga0137363_106250882 | 3300012202 | Vadose Zone Soil | MAETTLGPGGFAMMPGKAMHWFSCKSKDACLMFVTFDRKYDIVWAQPAK* |
| Ga0137376_101722622 | 3300012208 | Vadose Zone Soil | LGPGGFAMMPSKAMHWFTCKSKNTCLMFVTFDRTYDIVWAKQAK* |
| Ga0137377_100751032 | 3300012211 | Vadose Zone Soil | SKAMHWFSCKSKDTCLMFVTFDRTYDIVWAKPQK* |
| Ga0137360_112386072 | 3300012361 | Vadose Zone Soil | LGPGGFAMMPSKAMHWFTCKSKEPCLMFVTFDRTYDIVWAKPQK* |
| Ga0137360_112696241 | 3300012361 | Vadose Zone Soil | GGFAMMPSKQPHWFTCTAKEECLMFVTFDRAYDIVWLKPNK* |
| Ga0137361_100111568 | 3300012362 | Vadose Zone Soil | FAMMPSKAMHWFTCKSKVTCLMFVTFDRKYDIVWAQPAK* |
| Ga0137358_101158281 | 3300012582 | Vadose Zone Soil | GPGGFAMMPSKAMHWFTCKSKDTCLMFVMFDRKYDIVWAKPQK* |
| Ga0137398_101357831 | 3300012683 | Vadose Zone Soil | MKDAVLGPGGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWIKPDK* |
| Ga0137398_106442882 | 3300012683 | Vadose Zone Soil | GGFAMMPSKAMHWFTCKSKDTCLMFVTFDRTYDIVWANPQR* |
| Ga0137397_112765621 | 3300012685 | Vadose Zone Soil | ETTMGPGGFAMMPSKAMHWFTCKSKDTCLMFVAFDRKYDIVWAKPGK* |
| Ga0137395_107627891 | 3300012917 | Vadose Zone Soil | MQDTVLGPGGFAMMPSKQPHWFTCTAKEECLMFVSLDRPYDIVWLTPNK* |
| Ga0137396_106983911 | 3300012918 | Vadose Zone Soil | FAMMPSKTMHWFTCKSKDSCQMFVTFDRTYDIVWAKPQK* |
| Ga0137359_103325441 | 3300012923 | Vadose Zone Soil | GFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPQK* |
| Ga0137359_105987711 | 3300012923 | Vadose Zone Soil | ATLGPGGFAMMPSKAMHWFTCKSKDSCQMFVTFDRAYDIVWAKPQK* |
| Ga0137413_106542002 | 3300012924 | Vadose Zone Soil | AMMPSKAMHWFTCKSKDTCLMFVTFDRTYDIVWANPKK* |
| Ga0137419_112823912 | 3300012925 | Vadose Zone Soil | GFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWIKPDK* |
| Ga0137416_109433062 | 3300012927 | Vadose Zone Soil | PGGFAMMPSKAMHWFTCQSKDASLMFVTFDRTYDIVWAKTQK* |
| Ga0134079_100038991 | 3300014166 | Grasslands Soil | GGFAMMPSKQPHWFTCTVKEECLMFVTFDRAYDIVWLKSNK* |
| Ga0137420_13938762 | 3300015054 | Vadose Zone Soil | TLGPGGFAMMPSKAMHWFSCQSKSPCLMFVTFDRKYDIVWAKPQK* |
| Ga0132255_1062902711 | 3300015374 | Arabidopsis Rhizosphere | MMPGKMTHWFTCTNGSKDGCLMFVTFDQKYDIVWVKDEKK* |
| Ga0182036_100968263 | 3300016270 | Soil | LGPGGFAMMPSKQPHWFTCTAQEECLMFVTFDRPYDIVWLKPNK |
| Ga0182036_103346773 | 3300016270 | Soil | LGPGGFAMMPSKQPHWFTCTAEEECLMFVTFDRPYDIVWLKSNK |
| Ga0182032_100414451 | 3300016357 | Soil | FAMMPSKRPHWFACMATEECLMFVTFDRAYDIVWLKPNK |
| Ga0182039_102852261 | 3300016422 | Soil | VLGPGGFAMMPSKQPHWFTCTAQEECLMFVTFDRPYDIVWLEPNK |
| Ga0187781_101786013 | 3300017972 | Tropical Peatland | EDGGFAMMPSKVKHQLSCRSKDGCLLFVTFDRSYDIFWVNQQK |
| Ga0187780_109085151 | 3300017973 | Tropical Peatland | GMAARSLGPGGFAVMPSKAKHQFACDSKSECILFVTFDRKYDIVWVKTDAK |
| Ga0066655_103083372 | 3300018431 | Grasslands Soil | MMASKQVHWFSCTAKEECLMFVTFDRAYDIVWVKQSK |
| Ga0179590_10542472 | 3300020140 | Vadose Zone Soil | AMMPSKAMHWFTCKSKDSCQMFVTFDRTYDIVWAKPQK |
| Ga0210407_105960032 | 3300020579 | Soil | GFAMMPSKEKHWFSCKSKDGCLMFVTFDRAYDIFWVK |
| Ga0210407_106048871 | 3300020579 | Soil | FAMMPSKAMHWFTCKSKNTCLMFVTFDRTYDIVWAKQAK |
| Ga0210407_109031732 | 3300020579 | Soil | PSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPPK |
| Ga0210403_100061821 | 3300020580 | Soil | TLGPGGFAMMPSKAMHWFTCKSKNTCLMFVTFDRTYDIVWAKQAK |
| Ga0210403_106862642 | 3300020580 | Soil | GGFAMMPGKAMHWFTCQSKGACLMFVTFDSKYDIVWAKPRK |
| Ga0210399_100659571 | 3300020581 | Soil | GFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPQK |
| Ga0210399_104092301 | 3300020581 | Soil | QTLGPGGFAMMPGKAMHWFTCQSKSPCLMFVTFDRTYDITWAKPQK |
| Ga0210401_109143373 | 3300020583 | Soil | TLGPGGFAMMPGKAMHWFTCQSKSPCLMFVTFDRSYDITWAKPQK |
| Ga0210405_105756181 | 3300021171 | Soil | DTVLGPGGFAMMPSKAPHWFTCTAREECLMFVTFDRAYDIVWLKPGK |
| Ga0210394_116511332 | 3300021420 | Soil | GFAMMASKQPHWFTCTAKEECLMFVTFDRAYDIVWLKPNK |
| Ga0210384_118581071 | 3300021432 | Soil | TLGPGGFAMMPGKAMHWFSCQSKGACLMFVTFNAKYDIVWAKPQK |
| Ga0210402_103199593 | 3300021478 | Soil | MMPSKVKHRFSCESKNECIMFVTFDRKYDIVWLKPTPQSDVK |
| Ga0210410_102654394 | 3300021479 | Soil | GGFAMMPSKAMHWFTCKSKNTCLMFVTFDRTYDIVWAKQAK |
| Ga0210409_100108691 | 3300021559 | Soil | PSKAMHWFTCKSKNTCLMFVTFDRTYDIVWAKQAK |
| Ga0126371_113344461 | 3300021560 | Tropical Forest Soil | MMASKQVHWFSCTAKEECLMFVTFDRAYDIVWVKDKK |
| Ga0209237_11417212 | 3300026297 | Grasslands Soil | ATLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRTYDIVWAKPQK |
| Ga0209761_10107896 | 3300026313 | Grasslands Soil | PSKAMHWFTCKSKDTCLMFVTFDRTYDIVWAKPQK |
| Ga0209472_11749121 | 3300026323 | Soil | LGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPQK |
| Ga0209802_10845412 | 3300026328 | Soil | MMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKTPK |
| Ga0209804_11887011 | 3300026335 | Soil | FAMMPSKAMHWFTCKSKDTCLMFVTFDRTYDIVWAKPQK |
| Ga0257172_10742081 | 3300026482 | Soil | SPRILQAGGFAMMSGKEKHWFSCKSKDSCLMFVTFDRAYDIFWVK |
| Ga0257172_11119751 | 3300026482 | Soil | TLGPGGFAMMPSKAMHWFSCKSKDTCLMFVTFDRKYDIVWAKPQK |
| Ga0257168_10818152 | 3300026514 | Soil | GGFAMMPSKQPHWFTCSAKEECLMFVSFDRPYDIVWLKPDK |
| Ga0209157_10795822 | 3300026537 | Soil | ATLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRTYDIVWAKPPK |
| Ga0209161_102578451 | 3300026548 | Soil | AEATLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRKYDIVWAKPPK |
| Ga0209648_100196372 | 3300026551 | Grasslands Soil | MMPGKAMHWFSCKSKEPCLMFVTFDRAYDIVWAKPQK |
| Ga0209648_101151612 | 3300026551 | Grasslands Soil | AEATLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRAYDIVWVKPQK |
| Ga0179587_105046582 | 3300026557 | Vadose Zone Soil | PGGFAMMPGKAMHWFSCKSKDACLMFVTFDRKYDIVWAQPAK |
| Ga0209179_10134812 | 3300027512 | Vadose Zone Soil | GGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWIKPDK |
| Ga0209528_10794181 | 3300027610 | Forest Soil | GFAMMPSKQPHWFTCTAQEECLMFVTFDRAYDIVWLKPRK |
| Ga0209588_11522901 | 3300027671 | Vadose Zone Soil | VLGPGGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWLKPAK |
| Ga0209180_102241653 | 3300027846 | Vadose Zone Soil | MPDTVLGPGGFAMMPSKQPHWFTCTAKEECLMFVSFDRPYDIVWLTPNK |
| Ga0209465_102672722 | 3300027874 | Tropical Forest Soil | RACRMPFSAGGFAMMPSKQPHWFTCTAKEECLMFVTFDRPYDIVWAKLNK |
| Ga0209283_103428883 | 3300027875 | Vadose Zone Soil | KDTVLGPGGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWLKPTK |
| Ga0209488_103488082 | 3300027903 | Vadose Zone Soil | DAVLGPGGFAMMPSKAPHWFTCTAKEECLMFVTFDRAYDIVWIKPDK |
| Ga0209488_106595582 | 3300027903 | Vadose Zone Soil | TVLGPGGFAMMPGKAPHWFTCTAKEECLMFVTFDRAYDIVWLKPGK |
| Ga0209526_103759592 | 3300028047 | Forest Soil | GGFAMMPGKATHWFTCQSKGACLMFVTFDRTYDIVWGRPQK |
| Ga0137415_104753932 | 3300028536 | Vadose Zone Soil | GMAEATLGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRTYDIVWAKPQK |
| Ga0222749_104207232 | 3300029636 | Soil | LGPGGFAMMPSKAMHWFTCKSKDTCLMFVTFDRTYDIVWAKPQK |
| Ga0170820_177785181 | 3300031446 | Forest Soil | LMLSKAMHWFTCKSKSPCLMFVTFDRKYDIVWAKPAK |
| Ga0318574_108120542 | 3300031680 | Soil | MPNTNLGPGGFAMMPSKQPHWFTCSAKQDCLMFVTFDRAYDIVWVKKN |
| Ga0307475_103779921 | 3300031754 | Hardwood Forest Soil | MPSKAPHWFTCTAREECLMFVTFDRAYDIVWLKPGK |
| Ga0318543_104651701 | 3300031777 | Soil | RDTVLGPGGFAMMPSKQPHWFTCTAQEECLMFVTFDRPYDIVWLKPNK |
| Ga0318517_104552711 | 3300031835 | Soil | TVLGPGGFAMMPSKQPHWFTCTAQEECLMFVTFDRPYDIVWLKPNK |
| Ga0306919_107413971 | 3300031879 | Soil | MMPSKQPHWFTCTAQEECLMFVTFDRPYDIVWLKPNK |
| Ga0306925_114069101 | 3300031890 | Soil | MMPSKQPHWFTCTAKEECLMFVTFDRPYDIVWLKPNK |
| Ga0306921_101165741 | 3300031912 | Soil | DTVLGPGGFAMMPSKRPHWFACMATEECLMFVTFDRAYDIVWLKPNK |
| Ga0306921_113313952 | 3300031912 | Soil | TNLGPGGFAMMPSKQPHWFTCWAKGDCLMFVTFDRAYDIVWVKKN |
| Ga0310910_102424551 | 3300031946 | Soil | FAMMPSKQPHWFTCSAKQDCLMFVTFDRAYDIVWVKKN |
| Ga0307479_112220732 | 3300031962 | Hardwood Forest Soil | MMPSKAMHWFTCKSKDTCLMFVTFDRTYDIVWAKPPK |
| Ga0318533_111385641 | 3300032059 | Soil | GDTVLGAGGFAMMPSKQVHWFGCTAKEECVMFVTFDRAYDIVWVKDKK |
| Ga0307471_1011630791 | 3300032180 | Hardwood Forest Soil | MPSKAMHWFTCKSKNTCLMFVTFDRTYDIVWAKQAK |
| Ga0307471_1031653352 | 3300032180 | Hardwood Forest Soil | GFAMMPSKAMHWFTCKSKNTCLMFVTFDRTYDIVWAKQAK |
| Ga0310914_112881821 | 3300033289 | Soil | MMASKQVHWFACTAKQECLMFVTFDRPYDIVWVKDKK |
| ⦗Top⦘ |