Basic Information | |
---|---|
Family ID | F069272 |
Family Type | Metagenome |
Number of Sequences | 124 |
Average Sequence Length | 49 residues |
Representative Sequence | MSDTITLAKVEELFSCEDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
Number of Associated Samples | 112 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 71.54 % |
% of genes near scaffold ends (potentially truncated) | 43.55 % |
% of genes from short scaffolds (< 2000 bps) | 83.87 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (59.677 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.290 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.226 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.742 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.53% β-sheet: 22.45% Coil/Unstructured: 51.02% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF07045 | DUF1330 | 37.90 |
PF04392 | ABC_sub_bind | 12.10 |
PF00383 | dCMP_cyt_deam_1 | 9.68 |
PF11391 | DUF2798 | 3.23 |
PF13531 | SBP_bac_11 | 0.81 |
PF07883 | Cupin_2 | 0.81 |
PF04964 | Flp_Fap | 0.81 |
PF13442 | Cytochrome_CBB3 | 0.81 |
PF03100 | CcmE | 0.81 |
PF02735 | Ku | 0.81 |
PF07394 | DUF1501 | 0.81 |
PF02518 | HATPase_c | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 37.90 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 12.10 |
COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.81 |
COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.81 |
COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 59.68 % |
All Organisms | root | All Organisms | 40.32 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886013|SwBSRL2_contig_5176322 | Not Available | 1216 | Open in IMG/M |
2228664022|INPgaii200_c0801843 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 902 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c1729368 | Not Available | 819 | Open in IMG/M |
3300000156|NODE_c0716655 | All Organisms → cellular organisms → Bacteria | 5338 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105851067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5616 | Open in IMG/M |
3300000580|AF_2010_repII_A01DRAFT_1011044 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10148657 | Not Available | 564 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10000334 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9110 | Open in IMG/M |
3300000816|AF_2010_repII_A10DRAFT_1000880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2840 | Open in IMG/M |
3300000956|JGI10216J12902_117913652 | Not Available | 554 | Open in IMG/M |
3300004479|Ga0062595_100701074 | Not Available | 813 | Open in IMG/M |
3300004633|Ga0066395_10036448 | All Organisms → cellular organisms → Bacteria | 2090 | Open in IMG/M |
3300004633|Ga0066395_10209700 | Not Available | 1024 | Open in IMG/M |
3300005160|Ga0066820_1003320 | Not Available | 837 | Open in IMG/M |
3300005289|Ga0065704_10786999 | Not Available | 529 | Open in IMG/M |
3300005328|Ga0070676_10946709 | Not Available | 644 | Open in IMG/M |
3300005329|Ga0070683_102390032 | Not Available | 507 | Open in IMG/M |
3300005330|Ga0070690_100213032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1350 | Open in IMG/M |
3300005331|Ga0070670_100473646 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1111 | Open in IMG/M |
3300005332|Ga0066388_101267168 | Not Available | 1267 | Open in IMG/M |
3300005332|Ga0066388_101707784 | Not Available | 1114 | Open in IMG/M |
3300005332|Ga0066388_102668772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS96.2 | 911 | Open in IMG/M |
3300005332|Ga0066388_102964130 | Not Available | 867 | Open in IMG/M |
3300005335|Ga0070666_10287427 | Not Available | 1169 | Open in IMG/M |
3300005344|Ga0070661_101071094 | Not Available | 671 | Open in IMG/M |
3300005436|Ga0070713_100000305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 32510 | Open in IMG/M |
3300005438|Ga0070701_10442727 | Not Available | 832 | Open in IMG/M |
3300005441|Ga0070700_101090965 | Not Available | 661 | Open in IMG/M |
3300005547|Ga0070693_101216350 | Not Available | 579 | Open in IMG/M |
3300005616|Ga0068852_101325346 | Not Available | 742 | Open in IMG/M |
3300005844|Ga0068862_101102652 | Not Available | 789 | Open in IMG/M |
3300006057|Ga0075026_100875595 | Not Available | 550 | Open in IMG/M |
3300006173|Ga0070716_100094248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1820 | Open in IMG/M |
3300006755|Ga0079222_10105086 | Not Available | 1495 | Open in IMG/M |
3300006854|Ga0075425_100416560 | Not Available | 1547 | Open in IMG/M |
3300006854|Ga0075425_100839991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1051 | Open in IMG/M |
3300006854|Ga0075425_101024544 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
3300006881|Ga0068865_101533851 | Not Available | 598 | Open in IMG/M |
3300006904|Ga0075424_100197082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2139 | Open in IMG/M |
3300006904|Ga0075424_101163171 | Not Available | 821 | Open in IMG/M |
3300009094|Ga0111539_10636465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1242 | Open in IMG/M |
3300009174|Ga0105241_10070109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2719 | Open in IMG/M |
3300009551|Ga0105238_10287913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1625 | Open in IMG/M |
3300009553|Ga0105249_10558246 | Not Available | 1196 | Open in IMG/M |
3300009792|Ga0126374_11174836 | Not Available | 613 | Open in IMG/M |
3300010046|Ga0126384_10466189 | Not Available | 1082 | Open in IMG/M |
3300010046|Ga0126384_10839728 | Not Available | 825 | Open in IMG/M |
3300010046|Ga0126384_11836337 | Not Available | 576 | Open in IMG/M |
3300010048|Ga0126373_10150278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 2213 | Open in IMG/M |
3300010358|Ga0126370_11084722 | Not Available | 737 | Open in IMG/M |
3300010359|Ga0126376_10920387 | Not Available | 866 | Open in IMG/M |
3300010359|Ga0126376_11128700 | Not Available | 794 | Open in IMG/M |
3300010360|Ga0126372_12030039 | Not Available | 622 | Open in IMG/M |
3300010360|Ga0126372_12576250 | Not Available | 560 | Open in IMG/M |
3300010362|Ga0126377_10268717 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
3300010400|Ga0134122_10039958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3579 | Open in IMG/M |
3300010863|Ga0124850_1002246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5613 | Open in IMG/M |
3300010868|Ga0124844_1045950 | Not Available | 1506 | Open in IMG/M |
3300012208|Ga0137376_11648559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 532 | Open in IMG/M |
3300012474|Ga0157356_1009453 | Not Available | 644 | Open in IMG/M |
3300012483|Ga0157337_1005195 | Not Available | 859 | Open in IMG/M |
3300012487|Ga0157321_1020225 | Not Available | 604 | Open in IMG/M |
3300012490|Ga0157322_1047340 | Not Available | 513 | Open in IMG/M |
3300012492|Ga0157335_1006467 | Not Available | 851 | Open in IMG/M |
3300012494|Ga0157341_1011833 | Not Available | 760 | Open in IMG/M |
3300012498|Ga0157345_1020410 | Not Available | 670 | Open in IMG/M |
3300012507|Ga0157342_1078743 | Not Available | 515 | Open in IMG/M |
3300012508|Ga0157315_1032132 | Not Available | 622 | Open in IMG/M |
3300012514|Ga0157330_1006661 | Not Available | 1023 | Open in IMG/M |
3300012955|Ga0164298_10040149 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
3300012957|Ga0164303_10472118 | Not Available | 795 | Open in IMG/M |
3300012971|Ga0126369_11687260 | Not Available | 723 | Open in IMG/M |
3300012985|Ga0164308_10165541 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
3300012986|Ga0164304_10460228 | Not Available | 919 | Open in IMG/M |
3300014325|Ga0163163_12695742 | Not Available | 554 | Open in IMG/M |
3300014326|Ga0157380_10554157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1128 | Open in IMG/M |
3300014968|Ga0157379_11281443 | Not Available | 707 | Open in IMG/M |
3300015373|Ga0132257_100507476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1480 | Open in IMG/M |
3300016404|Ga0182037_10000008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 75019 | Open in IMG/M |
3300017944|Ga0187786_10200731 | Not Available | 758 | Open in IMG/M |
3300018060|Ga0187765_10115514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS96.2 | 1480 | Open in IMG/M |
3300019877|Ga0193722_1132194 | Not Available | 563 | Open in IMG/M |
3300020018|Ga0193721_1137843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 599 | Open in IMG/M |
3300025321|Ga0207656_10316630 | Not Available | 774 | Open in IMG/M |
3300025901|Ga0207688_10071647 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
3300025904|Ga0207647_10346466 | Not Available | 841 | Open in IMG/M |
3300025907|Ga0207645_11182808 | Not Available | 514 | Open in IMG/M |
3300025911|Ga0207654_10157323 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300025914|Ga0207671_10221850 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
3300025918|Ga0207662_10173079 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
3300025920|Ga0207649_10695512 | Not Available | 788 | Open in IMG/M |
3300025927|Ga0207687_11869608 | Not Available | 513 | Open in IMG/M |
3300025938|Ga0207704_10664542 | Not Available | 859 | Open in IMG/M |
3300026078|Ga0207702_10366826 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
3300027288|Ga0208525_1008041 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
3300027310|Ga0207983_1039005 | Not Available | 609 | Open in IMG/M |
3300027874|Ga0209465_10007847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4700 | Open in IMG/M |
3300027907|Ga0207428_10384030 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300028711|Ga0307293_10031512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1605 | Open in IMG/M |
3300028717|Ga0307298_10242588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 534 | Open in IMG/M |
3300028718|Ga0307307_10058590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1137 | Open in IMG/M |
3300028720|Ga0307317_10088796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1018 | Open in IMG/M |
3300028793|Ga0307299_10042058 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1675 | Open in IMG/M |
3300031170|Ga0307498_10000061 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11313 | Open in IMG/M |
3300031469|Ga0170819_13764536 | Not Available | 787 | Open in IMG/M |
3300031545|Ga0318541_10017178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3396 | Open in IMG/M |
3300031546|Ga0318538_10383076 | Not Available | 760 | Open in IMG/M |
3300031562|Ga0310886_10412042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
3300031562|Ga0310886_10611863 | Not Available | 670 | Open in IMG/M |
3300031679|Ga0318561_10306469 | Not Available | 869 | Open in IMG/M |
3300031720|Ga0307469_11711576 | Not Available | 606 | Open in IMG/M |
3300031747|Ga0318502_10143279 | Not Available | 1359 | Open in IMG/M |
3300031764|Ga0318535_10217060 | Not Available | 856 | Open in IMG/M |
3300031769|Ga0318526_10223078 | Not Available | 771 | Open in IMG/M |
3300031794|Ga0318503_10244694 | Not Available | 582 | Open in IMG/M |
3300031847|Ga0310907_10030980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1923 | Open in IMG/M |
3300031892|Ga0310893_10121111 | Not Available | 985 | Open in IMG/M |
3300032059|Ga0318533_10000637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 15159 | Open in IMG/M |
3300032064|Ga0318510_10269347 | Not Available | 704 | Open in IMG/M |
3300032094|Ga0318540_10000594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10671 | Open in IMG/M |
3300032174|Ga0307470_10043907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2236 | Open in IMG/M |
3300032180|Ga0307471_101967016 | Not Available | 732 | Open in IMG/M |
3300032205|Ga0307472_100652646 | Not Available | 938 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.29% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.06% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.26% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 6.45% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.65% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.23% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.23% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.61% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.81% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.81% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwBSRL2_0635.00007780 | 2162886013 | Switchgrass Rhizosphere | MSDTITLAKVEELFSCEDSDEALESAAGKEIAAGYTLLYCTSQDCSMVS |
INPgaii200_08018433 | 2228664022 | Soil | MSDTITLAKVEKLFGCQDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
ICChiseqgaiiDRAFT_17293682 | 3300000033 | Soil | MSDTITLAKMEEFFSCEDSDEALERAGSKEIAAGYTLLYCTSQDCSMVHS* |
NODE_071665511 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MSDIIALAKVEELFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVS* |
INPhiseqgaiiFebDRAFT_1058510674 | 3300000364 | Soil | MSDTITLAKVEKLFGCQDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS* |
AF_2010_repII_A01DRAFT_10110442 | 3300000580 | Forest Soil | MSDTITLAKVEEFFSCEDSDEALERAAGKEIAASYTLLYCTSQDCSMVS* |
AF_2010_repII_A1DRAFT_101486571 | 3300000597 | Forest Soil | MSDIITLTKAEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSM |
AF_2010_repII_A001DRAFT_100003341 | 3300000793 | Forest Soil | MSDIITLTKAEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMV |
AF_2010_repII_A10DRAFT_10008804 | 3300000816 | Forest Soil | MSDTITLAKVEELFSCDDSDEALERAGGKEIAAGYTLLYCTSQDCSMVS* |
JGI10216J12902_1179136521 | 3300000956 | Soil | VEGYSVMSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCTAQDCSMVS* |
Ga0062595_1007010741 | 3300004479 | Soil | TITLAKVEELFSCEDSDEALESAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0066395_100364483 | 3300004633 | Tropical Forest Soil | MSDTITLAKIEEFFSCEDSDEALERAAGKEIAASYTLLYCTSQDCSMVS* |
Ga0066395_102097002 | 3300004633 | Tropical Forest Soil | MSDIITLTKAEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0066820_10033201 | 3300005160 | Soil | MSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCTAQDCSMVS* |
Ga0065704_107869992 | 3300005289 | Switchgrass Rhizosphere | MSDTITLAKVEELFSCEDSDEALESAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0070676_109467091 | 3300005328 | Miscanthus Rhizosphere | MSDIITLAKVEEFFSCEDSDEALERAAGKKIAAGYTLLYCTAQDCSMVS* |
Ga0070683_1023900321 | 3300005329 | Corn Rhizosphere | MSDIITLAKVEEFFSCEDSDESLERAASKEIAAGYTLLYCTSQDCSMVHS* |
Ga0070690_1002130323 | 3300005330 | Switchgrass Rhizosphere | YSVMSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCTAQDCSMVS* |
Ga0070670_1004736461 | 3300005331 | Switchgrass Rhizosphere | MSDTITLAKVEDCFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS* |
Ga0066388_1012671683 | 3300005332 | Tropical Forest Soil | MSDTITLAKVEELFSCEDSDEALERAGGKEIAAGYTLLYCTSQDCSMVS* |
Ga0066388_1017077842 | 3300005332 | Tropical Forest Soil | MSDTITLAKVEELFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVS* |
Ga0066388_1026687721 | 3300005332 | Tropical Forest Soil | MSDTITLAKVEEFFGCEDSDEALERAAAKEIAAGYTLLYCTSQDCSMVHS* |
Ga0066388_1029641302 | 3300005332 | Tropical Forest Soil | MSDTITLAKVEELFSCEDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0070666_102874273 | 3300005335 | Switchgrass Rhizosphere | EGYSVMSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCTAQDCSMVS* |
Ga0070661_1010710941 | 3300005344 | Corn Rhizosphere | VEGYSVMSDIITLAKVEEFFSCEDSDEALERAAGKKIAAGYTLLYCTAQDCSMVS* |
Ga0070713_10000030535 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LARAKKVEGYSVMSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCTAQDCSMVS* |
Ga0070701_104427272 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDIITLAKVEEFFSCEDSDEALERAAGKKIAAGYTLLYCTSQDCSMVHS* |
Ga0070700_1010909652 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCT |
Ga0070693_1012163502 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VEGYSVMSDTITLAKVEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS* |
Ga0068852_1013253461 | 3300005616 | Corn Rhizosphere | AKKVEGYSVMSDTITLAKVEDCFSCEDSDEALERAASKEIAAGYTLLYCTAQDCSMVS* |
Ga0068862_1011026521 | 3300005844 | Switchgrass Rhizosphere | KKVEGYSVMSDTITLAKVEEFFRCEDSDEALERAASKEPAGYTLLYCTSQDCSMVHS* |
Ga0075026_1008755951 | 3300006057 | Watersheds | MSSTIRFDETDELFGCEDSDEALERAAGAGKVIAVAAYTLLYCTSQDCSMVS* |
Ga0070716_1000942483 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDTITLAKVEEFFSCDDSDEALERAAGKKIAAGYTLLYCTAQDCSMVS* |
Ga0079222_101050862 | 3300006755 | Agricultural Soil | LARAKKVEGYSVMSDIITLAKVEEFFSCEDSDESLERAASKEIAAGYTLLYCTAQDCSMVS* |
Ga0075425_1004165603 | 3300006854 | Populus Rhizosphere | MSDTITLAKVEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS* |
Ga0075425_1008399911 | 3300006854 | Populus Rhizosphere | VEGYSVMSDIITLAKVEEFFSCEDSDESLERAASKEIAAGYTLLYCTSQDCSMVS* |
Ga0075425_1010245441 | 3300006854 | Populus Rhizosphere | MSDTITLAKVEELFSCEDSDEALERAAGKEIAAGYTLLYCTSQDCSMV |
Ga0068865_1015338512 | 3300006881 | Miscanthus Rhizosphere | EEFFSCDDSDEALERAAGKEIAAGYTLLYCTAQDCSMVS* |
Ga0075424_1001970821 | 3300006904 | Populus Rhizosphere | DCQLVHGLLGLERKSGGLSVMSDTITLAKVEELFSCEDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0075424_1011631712 | 3300006904 | Populus Rhizosphere | LARAKKVEGYSVMSDIITLAKVEEFFSCEDSDESLERAASKEIAAGYTLLYCTSQDCSMVS* |
Ga0111539_106364653 | 3300009094 | Populus Rhizosphere | AKKVEGYSVMSDTITLAKMEEFFSCEDSDESLERAASKEIAAGYTLLYCTSQDCSMVS* |
Ga0105241_100701093 | 3300009174 | Corn Rhizosphere | MSDIITLAKVEEFFSCEDSDESLERAASKEIAAGYTLLYCTAQDCSMVS* |
Ga0105238_102879131 | 3300009551 | Corn Rhizosphere | MSDIITLAKVEEFFSCEDSDEALERAAGKEIAAGYTLLYCTAQDCSMVS* |
Ga0105249_105582462 | 3300009553 | Switchgrass Rhizosphere | MSDTITLAKMEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS* |
Ga0126374_111748362 | 3300009792 | Tropical Forest Soil | AKVEELFSCEDSDEALERAGGKEIAAGYTLLYCTSQDCSMVS* |
Ga0126384_104661892 | 3300010046 | Tropical Forest Soil | MGDTITLAKVEEFFSCEDSDEALERAAGKEIAASYTLLYCTSQDCSMVS* |
Ga0126384_108397281 | 3300010046 | Tropical Forest Soil | MSDTITLAKVEEVFSCEDSDEALERAAGKKIAAGYTLLYCTSQDCSMVS* |
Ga0126384_118363371 | 3300010046 | Tropical Forest Soil | SVMSDIIALAKVEELFSCEDSDEALERATSKEIAAGYTLLYCTSQDCSMVS* |
Ga0126373_101502782 | 3300010048 | Tropical Forest Soil | MSDIITLTKAEQLFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVY* |
Ga0126370_110847222 | 3300010358 | Tropical Forest Soil | MSDIIALAKVEELFSCEDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0126376_109203872 | 3300010359 | Tropical Forest Soil | MSDIIALAKVEELFSCEDSDEALERATSKEIAAGYTLLYCTSQDCSMVS* |
Ga0126376_111287001 | 3300010359 | Tropical Forest Soil | MSDTITLATLDELFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVS* |
Ga0126372_120300392 | 3300010360 | Tropical Forest Soil | MSDIIALAKVEELFGCEDSDEALERAAGKKIAAGYTLLYCTSQDCSMVS* |
Ga0126372_125762501 | 3300010360 | Tropical Forest Soil | MSDVITLAKVEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDC |
Ga0126377_102687174 | 3300010362 | Tropical Forest Soil | MSDTITLAKVEELFSCEDSDEVLERAAGKDIAAGYTLLYCTSQDCSMVS* |
Ga0134122_100399581 | 3300010400 | Terrestrial Soil | MTDTIGFAKVEELFSCEDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0124850_10022467 | 3300010863 | Tropical Forest Soil | MSDTITLAKVEEIFSCEDSDEALERAAGKEIAASYTLLYCTSQDCSMVS* |
Ga0124844_10459503 | 3300010868 | Tropical Forest Soil | LAKVEEFFSCEDSDEALERAAGKEIAASYTLLYCTSQDCSMVS* |
Ga0137376_116485592 | 3300012208 | Vadose Zone Soil | GCEDSDEALERAAGKEIGAGYTLLYCTSQDCSMMS* |
Ga0157356_10094531 | 3300012474 | Unplanted Soil | SVMSDTITLAKVEELFSGEDSDEALESAAGKEIAAGYTLLYCTSQDCSMVHS* |
Ga0157337_10051951 | 3300012483 | Arabidopsis Rhizosphere | MSDTITLAKVEEFFSCDDSDEALERAAGREIAAGYTLLYCTAQDCSMVS* |
Ga0157331_10377382 | 3300012486 | Soil | LARAKKVEGYSVMSDTITLAKVEEFFRCEDSDEALERAASKEPAGYTLLYCTSQDCSMVHS* |
Ga0157321_10202251 | 3300012487 | Arabidopsis Rhizosphere | MSDTITLAKMEEFFSCEDSDEALERAGSKEIAAGYTLLYCTSQDCSMVH |
Ga0157322_10473402 | 3300012490 | Arabidopsis Rhizosphere | MSDIITLAKVEEFFSCEDSDESLERAASKEIAAGY |
Ga0157335_10064672 | 3300012492 | Arabidopsis Rhizosphere | MSDIITLAKVEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS* |
Ga0157341_10118333 | 3300012494 | Arabidopsis Rhizosphere | MSDTITLAKMEEFFSCEDSDEALERAGSKEIAAGYTLLYCTSQDCS |
Ga0157345_10204101 | 3300012498 | Arabidopsis Rhizosphere | MSDTITLAKMEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVS* |
Ga0157342_10787431 | 3300012507 | Arabidopsis Rhizosphere | EDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS* |
Ga0157315_10321321 | 3300012508 | Arabidopsis Rhizosphere | MSDIITLAKVEEFFSCEDSDESLERAASKEIAAGYTLLYCTSQDCSMVS* |
Ga0157330_10066612 | 3300012514 | Soil | MSDTITLAKVEEFFRCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS* |
Ga0164298_100401491 | 3300012955 | Soil | MSDTITLAKVEEFFSCDDSDEALERASGKEIAAGYTLLYCTAQDCSMMS* |
Ga0164303_104721182 | 3300012957 | Soil | FSCEDSDEALESAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0126369_116872602 | 3300012971 | Tropical Forest Soil | MNDIITLAKVEELFRCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0164308_101655413 | 3300012985 | Soil | MSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCTAQDCSMMS* |
Ga0164304_104602281 | 3300012986 | Soil | MSDTITLAKVEEFFSCEDSDEALERAGSKEIAAGYTLLYCTSQDCSMVHS* |
Ga0163163_126957421 | 3300014325 | Switchgrass Rhizosphere | YSVMSDTITLAKVEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS* |
Ga0157380_105541571 | 3300014326 | Switchgrass Rhizosphere | MSDIITLAKVEEFFSCEDSDESLERAASKEIAAGYTLLY |
Ga0157379_112814432 | 3300014968 | Switchgrass Rhizosphere | SVMSDTITLAKVEELFSCEDSDEALESAAGKEIAAGYTLLYCTSQDCSMVS* |
Ga0132257_1005074761 | 3300015373 | Arabidopsis Rhizosphere | MSDTITLAKVEEFFRCEDSDEALERAASKEPAGYTLLYCTSQDCSMVHS* |
Ga0182037_1000000851 | 3300016404 | Soil | MSDIITLAKIEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
Ga0187786_102007312 | 3300017944 | Tropical Peatland | MEGYSVMSNIITLANVEEFFSCEDSDEALERAAAKEIAAGYTLLYCTSQDCSMVHS |
Ga0187765_101155143 | 3300018060 | Tropical Peatland | MSDITLAKVEEFFSCEDSDEALERAAAKEIAAGYTLLYCTSQDCSMVQS |
Ga0193722_11321941 | 3300019877 | Soil | MSNTIRFDQTDELFGCEDSDEALERAAGTGKEIAVAAYTLLYCTSQDCSMVS |
Ga0193721_11378432 | 3300020018 | Soil | GRKMGYGVMSDSIRLEKMEELFGCEDSDEALERAAGKEIGAGYTLLYCTSQDCSMMS |
Ga0207656_103166301 | 3300025321 | Corn Rhizosphere | MSDIITLAKVEEFFSCEDSDEALERAAGKKIAAGYT |
Ga0207688_100716471 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCTSQDCSMVHS |
Ga0207647_103464662 | 3300025904 | Corn Rhizosphere | MSDTITLAKMEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS |
Ga0207645_111828081 | 3300025907 | Miscanthus Rhizosphere | MSDTITLAKVEELFSCEDSDEALESAAGKEIAAGYTLLYCTSQD |
Ga0207654_101573231 | 3300025911 | Corn Rhizosphere | MSDIITLAKVEEFFSCEDSDEALERAAGKKIAAGYTL |
Ga0207671_102218501 | 3300025914 | Corn Rhizosphere | MSDIITLAKVEEFFSCEDSDEALERAAGKKIAAGYTLLYCTAQDCSM |
Ga0207662_101730794 | 3300025918 | Switchgrass Rhizosphere | MSDTITLAKMEEFFSCEDSDEALERAGSKEIAAGYTLLYCTSQDCSMVHS |
Ga0207649_106955122 | 3300025920 | Corn Rhizosphere | MSDTITLAKVEDCFSCEDSDEALERAASKEIAAGYTLLYCTAQDCSMVS |
Ga0207687_118696082 | 3300025927 | Miscanthus Rhizosphere | VEGYSVMSGIITLAKVEEFFSCEDSDESLERAASKEIAAGYTLLYCTSQDCSMVHS |
Ga0207704_106645421 | 3300025938 | Miscanthus Rhizosphere | KVEEFFSCEDSDEALERAAGKKIAAGYTLLYCTAQDCSMVS |
Ga0207702_103668261 | 3300026078 | Corn Rhizosphere | MSDIITLAKVEEFFSCEDSDEALERAAGKKIAAGYTLLYCTAQDCSMV |
Ga0208525_10080413 | 3300027288 | Soil | MSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTL |
Ga0207983_10390051 | 3300027310 | Soil | AKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCTAQDCSMVS |
Ga0209465_100078477 | 3300027874 | Tropical Forest Soil | KSGELSVMSDTITLAKVEEFFSCEDSDEALERAAGKEIAASYTLLYCTSQDCSMVS |
Ga0207428_103840303 | 3300027907 | Populus Rhizosphere | MSGIITLAKVEEFFSCEDSDESLERAASKEIAAGYTLLYCTSQDCSMVS |
Ga0307293_100315121 | 3300028711 | Soil | EGKWGYGVMSDSIRLEKMEELFGCEDSDEALERAAGKEIGAGYTLLYCTSQDCSMMS |
Ga0307298_102425881 | 3300028717 | Soil | SDSIRLEKMEELFGCEDSDEALERAAGKEIGAGYTLLYCTSQDCSMMS |
Ga0307307_100585902 | 3300028718 | Soil | MGYGVMSDSIRLEKMEELFGCEDSDEALERAAGKEIGAGYTLLYCTSQDCSMMS |
Ga0307317_100887963 | 3300028720 | Soil | MSDSIRLEKMEELFGCEDSDEALERAAGKEIGAGYT |
Ga0307299_100420584 | 3300028793 | Soil | MSDSIRLEKMEELFGCEDSDEALERAAGKEIGAGYTLLYCTSQDCSMMS |
Ga0307498_100000614 | 3300031170 | Soil | MSSTIRFDQTDELFGCEDSDEALERAAGAGKVIAVAAYTLLYCTSQDCSMVS |
Ga0170819_137645362 | 3300031469 | Forest Soil | MSSTIRFDQTDELFGCEDSDEALERAAGAGKVIAVAAYTLLYCTSQDCSMMS |
Ga0318541_100171784 | 3300031545 | Soil | MSDIITLAKVEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
Ga0318538_103830762 | 3300031546 | Soil | MSDIITLAKVEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQD |
Ga0310886_104120423 | 3300031562 | Soil | MSDTITLAKVEEFFSCEDSDEALERAASKEIAAGYTLLY |
Ga0310886_106118632 | 3300031562 | Soil | EGDSVMSDTITLAKVEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS |
Ga0318561_103064692 | 3300031679 | Soil | LPHALLGYERRGGGLSVMSDIITLAKVEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
Ga0307469_117115761 | 3300031720 | Hardwood Forest Soil | MSDTITLAKVEELFSCEDSDEALESAAGKEIAAGYTLL |
Ga0318502_101432793 | 3300031747 | Soil | ERRGGGLSVMSDIITLAKIEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
Ga0318535_102170601 | 3300031764 | Soil | ITLAKVEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
Ga0318526_102230781 | 3300031769 | Soil | MSDIITLAKVEELFSCGDSDEALERAAGKEIAAGYTLLYCTS |
Ga0318503_102446941 | 3300031794 | Soil | SDIITLAKVEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
Ga0310907_100309801 | 3300031847 | Soil | VEGYSVMSDTITLAKVEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS |
Ga0310893_101211113 | 3300031892 | Soil | MSDTITLAKVEEFFSCEDSDEALERAASKEIAAGYTLLYCTSQDCSMVHS |
Ga0318533_100006376 | 3300032059 | Soil | MSDIITLAKVEELFSCGDPDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
Ga0318510_102693472 | 3300032064 | Soil | MSDIITLAKVEELFSCGDPDEALERAAGKEIAAGYTLLY |
Ga0318540_1000059415 | 3300032094 | Soil | LAIVEELFSCGDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
Ga0307470_100439075 | 3300032174 | Hardwood Forest Soil | MSDTITLAKVEEFFSCDDSDEALERAAGKEIAAGYTLLYCTAQDCSMMS |
Ga0307471_1019670161 | 3300032180 | Hardwood Forest Soil | IDGLLGLERKSGGLSVMSDTITLAKVEELFSCEDSDEALESAAGKEIAAGYTLLYCTSQDCSMVS |
Ga0307472_1006526463 | 3300032205 | Hardwood Forest Soil | MSDTITLAKVEELFSCEDSDEALERAAGKEIAAGYTLLYCTSQDCSMVS |
⦗Top⦘ |