| Basic Information | |
|---|---|
| Family ID | F069264 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MPRITLDLSDAAELAETLTFLAEWLSGSQKQALADSFAAFVGHPAYN |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.58 % |
| % of genes near scaffold ends (potentially truncated) | 98.39 % |
| % of genes from short scaffolds (< 2000 bps) | 87.90 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.419 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.484 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.290 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.903 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.33% β-sheet: 0.00% Coil/Unstructured: 50.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 47.58 |
| PF13495 | Phage_int_SAM_4 | 4.84 |
| PF02899 | Phage_int_SAM_1 | 2.42 |
| PF03401 | TctC | 0.81 |
| PF02771 | Acyl-CoA_dh_N | 0.81 |
| PF00719 | Pyrophosphatase | 0.81 |
| PF12697 | Abhydrolase_6 | 0.81 |
| PF06441 | EHN | 0.81 |
| PF00496 | SBP_bac_5 | 0.81 |
| PF13655 | RVT_N | 0.81 |
| PF00296 | Bac_luciferase | 0.81 |
| PF10099 | RskA | 0.81 |
| PF07366 | SnoaL | 0.81 |
| PF03692 | CxxCxxCC | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 2.42 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 2.42 |
| COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.81 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.81 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.23 % |
| Unclassified | root | N/A | 21.77 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573004|GZGWRS402H5HPO | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
| 3300004479|Ga0062595_100250137 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300005166|Ga0066674_10076431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1538 | Open in IMG/M |
| 3300005332|Ga0066388_104915684 | Not Available | 679 | Open in IMG/M |
| 3300005332|Ga0066388_106155172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 606 | Open in IMG/M |
| 3300005439|Ga0070711_100442531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1062 | Open in IMG/M |
| 3300005445|Ga0070708_100657098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 988 | Open in IMG/M |
| 3300005454|Ga0066687_10184749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
| 3300005456|Ga0070678_102144207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300005468|Ga0070707_101642469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300005471|Ga0070698_101216601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 703 | Open in IMG/M |
| 3300005616|Ga0068852_100782160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 968 | Open in IMG/M |
| 3300005764|Ga0066903_105216183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 687 | Open in IMG/M |
| 3300005764|Ga0066903_106001881 | Not Available | 636 | Open in IMG/M |
| 3300006173|Ga0070716_100277663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1154 | Open in IMG/M |
| 3300006579|Ga0074054_12167703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300006903|Ga0075426_10698067 | Not Available | 761 | Open in IMG/M |
| 3300009012|Ga0066710_101395135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
| 3300009038|Ga0099829_10545245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
| 3300009088|Ga0099830_10041483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 3193 | Open in IMG/M |
| 3300009093|Ga0105240_10692461 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300009093|Ga0105240_11489429 | Not Available | 710 | Open in IMG/M |
| 3300009162|Ga0075423_12459025 | Not Available | 568 | Open in IMG/M |
| 3300009174|Ga0105241_11703322 | Not Available | 613 | Open in IMG/M |
| 3300009521|Ga0116222_1273140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 730 | Open in IMG/M |
| 3300009683|Ga0116224_10263543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 821 | Open in IMG/M |
| 3300010043|Ga0126380_10003792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6208 | Open in IMG/M |
| 3300010046|Ga0126384_10043385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3059 | Open in IMG/M |
| 3300010047|Ga0126382_11584641 | Not Available | 606 | Open in IMG/M |
| 3300010361|Ga0126378_13442112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300010398|Ga0126383_10372249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1456 | Open in IMG/M |
| 3300010399|Ga0134127_10423982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1322 | Open in IMG/M |
| 3300012202|Ga0137363_10451229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1076 | Open in IMG/M |
| 3300012210|Ga0137378_10189530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1914 | Open in IMG/M |
| 3300012211|Ga0137377_11625134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300012360|Ga0137375_11358796 | Not Available | 532 | Open in IMG/M |
| 3300012363|Ga0137390_10578593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1092 | Open in IMG/M |
| 3300012957|Ga0164303_11549147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300012984|Ga0164309_11184809 | Not Available | 640 | Open in IMG/M |
| 3300012985|Ga0164308_10871431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300013104|Ga0157370_11974126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
| 3300014157|Ga0134078_10253853 | Not Available | 739 | Open in IMG/M |
| 3300015373|Ga0132257_101214887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300015374|Ga0132255_104267227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 606 | Open in IMG/M |
| 3300016270|Ga0182036_10692916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 824 | Open in IMG/M |
| 3300016294|Ga0182041_10745897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300016341|Ga0182035_10047534 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 2890 | Open in IMG/M |
| 3300017932|Ga0187814_10457942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
| 3300017942|Ga0187808_10223023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 840 | Open in IMG/M |
| 3300017947|Ga0187785_10754665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300017974|Ga0187777_10520038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 833 | Open in IMG/M |
| 3300018012|Ga0187810_10148059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
| 3300018433|Ga0066667_11886444 | Not Available | 544 | Open in IMG/M |
| 3300021171|Ga0210405_10484466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 970 | Open in IMG/M |
| 3300021478|Ga0210402_10021189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5570 | Open in IMG/M |
| 3300021478|Ga0210402_11457677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300021479|Ga0210410_10651909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 932 | Open in IMG/M |
| 3300021559|Ga0210409_11655467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 516 | Open in IMG/M |
| 3300024254|Ga0247661_1005487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2017 | Open in IMG/M |
| 3300025913|Ga0207695_11075383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300025929|Ga0207664_10082390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2620 | Open in IMG/M |
| 3300026067|Ga0207678_10539929 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300026078|Ga0207702_11286660 | Not Available | 725 | Open in IMG/M |
| 3300026142|Ga0207698_10340152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1413 | Open in IMG/M |
| 3300026480|Ga0257177_1010169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1237 | Open in IMG/M |
| 3300027783|Ga0209448_10187472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → Sporichthya | 687 | Open in IMG/M |
| 3300027884|Ga0209275_10923902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 503 | Open in IMG/M |
| 3300028713|Ga0307303_10015034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1426 | Open in IMG/M |
| 3300028717|Ga0307298_10214913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300028782|Ga0307306_10128308 | Not Available | 693 | Open in IMG/M |
| 3300028807|Ga0307305_10455451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii | 575 | Open in IMG/M |
| 3300028828|Ga0307312_10251716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1143 | Open in IMG/M |
| 3300031544|Ga0318534_10575834 | Not Available | 640 | Open in IMG/M |
| 3300031573|Ga0310915_10028121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3485 | Open in IMG/M |
| 3300031679|Ga0318561_10461216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300031681|Ga0318572_10697323 | Not Available | 604 | Open in IMG/M |
| 3300031682|Ga0318560_10395888 | Not Available | 747 | Open in IMG/M |
| 3300031713|Ga0318496_10852882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300031715|Ga0307476_10353782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1082 | Open in IMG/M |
| 3300031719|Ga0306917_11309233 | Not Available | 560 | Open in IMG/M |
| 3300031754|Ga0307475_11388909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300031765|Ga0318554_10824185 | Not Available | 518 | Open in IMG/M |
| 3300031770|Ga0318521_10595611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 668 | Open in IMG/M |
| 3300031779|Ga0318566_10251443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 876 | Open in IMG/M |
| 3300031781|Ga0318547_10030057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2783 | Open in IMG/M |
| 3300031793|Ga0318548_10221149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 930 | Open in IMG/M |
| 3300031795|Ga0318557_10137208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1101 | Open in IMG/M |
| 3300031798|Ga0318523_10121132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300031798|Ga0318523_10403216 | Not Available | 679 | Open in IMG/M |
| 3300031799|Ga0318565_10476308 | Not Available | 603 | Open in IMG/M |
| 3300031821|Ga0318567_10245287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1005 | Open in IMG/M |
| 3300031831|Ga0318564_10022110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2649 | Open in IMG/M |
| 3300031846|Ga0318512_10566661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
| 3300031859|Ga0318527_10197418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Terrabacter → unclassified Terrabacter → Terrabacter sp. Soil811 | 851 | Open in IMG/M |
| 3300031860|Ga0318495_10316507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 693 | Open in IMG/M |
| 3300031890|Ga0306925_11309785 | Not Available | 719 | Open in IMG/M |
| 3300031893|Ga0318536_10243483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| 3300031894|Ga0318522_10127552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
| 3300031894|Ga0318522_10417406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300031912|Ga0306921_10267709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2001 | Open in IMG/M |
| 3300031942|Ga0310916_11291061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 601 | Open in IMG/M |
| 3300031946|Ga0310910_11082762 | Not Available | 624 | Open in IMG/M |
| 3300031962|Ga0307479_11893009 | Not Available | 547 | Open in IMG/M |
| 3300032001|Ga0306922_11280428 | Not Available | 742 | Open in IMG/M |
| 3300032009|Ga0318563_10011386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4187 | Open in IMG/M |
| 3300032009|Ga0318563_10089301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1619 | Open in IMG/M |
| 3300032009|Ga0318563_10099703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1534 | Open in IMG/M |
| 3300032041|Ga0318549_10195306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 908 | Open in IMG/M |
| 3300032041|Ga0318549_10382373 | Not Available | 634 | Open in IMG/M |
| 3300032042|Ga0318545_10058310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1315 | Open in IMG/M |
| 3300032043|Ga0318556_10028341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2580 | Open in IMG/M |
| 3300032054|Ga0318570_10153620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300032060|Ga0318505_10193690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 950 | Open in IMG/M |
| 3300032066|Ga0318514_10693172 | Not Available | 542 | Open in IMG/M |
| 3300032068|Ga0318553_10750528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300032076|Ga0306924_12542345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 512 | Open in IMG/M |
| 3300032090|Ga0318518_10065361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1761 | Open in IMG/M |
| 3300032180|Ga0307471_100192134 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2030 | Open in IMG/M |
| 3300032770|Ga0335085_11056942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus wratislaviensis | 873 | Open in IMG/M |
| 3300032892|Ga0335081_10035016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8031 | Open in IMG/M |
| 3300032895|Ga0335074_11607435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300032896|Ga0335075_11139119 | Not Available | 683 | Open in IMG/M |
| 3300032898|Ga0335072_11796643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 506 | Open in IMG/M |
| 3300033805|Ga0314864_0208014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.23% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573004 | Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FG2_00137230 | 2189573004 | Grass Soil | MPGVTLDLSDAAELAETLTFLADWLFGSQKQTLAGQPHRLR |
| Ga0062595_1002501371 | 3300004479 | Soil | LPQITIDMGDAAELAEMLTFLAGWLSGSQKPALGKSLAAYVGHPACTT |
| Ga0066674_100764313 | 3300005166 | Soil | MPQITLDLADATELAETLTFIADWLSGSQQPALAQSLATF |
| Ga0066388_1049156842 | 3300005332 | Tropical Forest Soil | MPQITLDTSDAAELAETLTFLTNWLSGSQKQILADSFAAFVGHPAYNT |
| Ga0066388_1061551721 | 3300005332 | Tropical Forest Soil | MADIRLELSDAIELAELLTFLADWLTSSQHHALAHSLAAF |
| Ga0070711_1004425311 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGITLDPADAAEIAETLTLLTQWLSGSQNHALAESFAAFIGHPAYNTGTLCADLHRF |
| Ga0070708_1006570981 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGITLDPVDAAEIAETLTFLAQWLSGSQKQALAESFTAF |
| Ga0066687_101847491 | 3300005454 | Soil | MPGITLDLSDAAELAELLTFLAGWLSDSQKQALAGSLAAFVGH |
| Ga0070678_1021442072 | 3300005456 | Miscanthus Rhizosphere | MPGITLDPVDAAEIAETLTFLAQWLSGSQKQALAESFTAFV |
| Ga0070707_1016424691 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGITLDLGDAAELAETLTFLAEWLSGRQKQALARSLEAFAGHPAYNA |
| Ga0070698_1012166012 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPQITLDMGDAAELAEMLTFLADWLAGSQQQILHESFAAFIGHPAYDTDALR |
| Ga0068852_1007821601 | 3300005616 | Corn Rhizosphere | MPGITLDPVEAAELAETLAFVVAWLSGSQEQALADGFAAFVGH |
| Ga0066903_1052161832 | 3300005764 | Tropical Forest Soil | MPQIRLDLGDAAELAEMLTFLTNWLSGSQKQALAQSFAAF |
| Ga0066903_1060018811 | 3300005764 | Tropical Forest Soil | MPQITLDTSDAAELAETLTFLTSWLSGSQKQILAGSFAAFIGHPAYNTATLCADLHRFA |
| Ga0070716_1002776631 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGITLDPADAAEIAETPTLLTGWLSGSRKQTLADSFAAFIGHPAYNTGTLCADL |
| Ga0074054_121677031 | 3300006579 | Soil | MPEIGLDHSDAIELAEMLTFLADWLSSAHKQTLADS |
| Ga0075426_106980671 | 3300006903 | Populus Rhizosphere | VPQITLDLTDATELAETLAFITGRPSSSQEQILADS |
| Ga0066710_1013951353 | 3300009012 | Grasslands Soil | MPGITLDPVDAAELAETLAFLADWLSGSQKQAIADSFAAFV |
| Ga0099829_105452453 | 3300009038 | Vadose Zone Soil | MPGITLELGDAAELAEMLTFLAEWLSGSQKQALASSLQAYVGHTAYNA |
| Ga0099830_100414831 | 3300009088 | Vadose Zone Soil | MPGITLDPGDAAELAEMLAFLADWLSGSQKQVLAGS |
| Ga0105240_106924613 | 3300009093 | Corn Rhizosphere | MPGITLDLSDAVELAETLTLLAQWLSGSQKHALAESFAAF |
| Ga0105240_114894291 | 3300009093 | Corn Rhizosphere | MPGITLDPVDAAEIAETLTFLAQWLSGSQKQALAESFTAFVGHPAYNTGTL |
| Ga0075423_124590252 | 3300009162 | Populus Rhizosphere | MPQIRLDTSDAAELAEMLTFLAGWLSGSQKQALAQ |
| Ga0105241_117033221 | 3300009174 | Corn Rhizosphere | MPGITLDLSDAAELAETLTLLTQWLSGSHKHTLADSFAAYVGHPAYNTDT |
| Ga0116222_12731402 | 3300009521 | Peatlands Soil | MPAITLDLADAAELAETLTLLTEWLSGSQEQILADSFAAFIGHPAYNTD |
| Ga0116224_102635431 | 3300009683 | Peatlands Soil | MPAITLDLADAAELAETLTLLTEWLSGSQEQILADSF |
| Ga0126380_100037925 | 3300010043 | Tropical Forest Soil | MPQITLDTSDAAELAETLTFLTSWLSGSQKQILAGSFAAF |
| Ga0126384_100433855 | 3300010046 | Tropical Forest Soil | MPQITLDTSDAAELAEMLTFLASWLSGSQKQILAGSFAAFIGHPA* |
| Ga0126382_115846412 | 3300010047 | Tropical Forest Soil | MPETKLDPGDAAELREMLTFLAEWLSGSQKPILEGSLAAFVGHTAYGIEALLADLH |
| Ga0126378_134421121 | 3300010361 | Tropical Forest Soil | MPQIRLDPGDAAELAELLTFLANWLSGRQKQALGKSFAAYVGNPAYN |
| Ga0126383_103722493 | 3300010398 | Tropical Forest Soil | MPQITLDTSDAAELAEMLTFLASWLTGSQKQILADSFAAFVGHPAY |
| Ga0134127_104239822 | 3300010399 | Terrestrial Soil | MPGITLDPVDAAELAEVLTFLTQWLSGRQKHALAE |
| Ga0137363_104512291 | 3300012202 | Vadose Zone Soil | MPQITLDLADATELAETLTFIADWLSGSQQPALAQSLAT |
| Ga0137378_101895301 | 3300012210 | Vadose Zone Soil | MPEITLDLGDAAELAEMLTFLADWLSGSQKQVLAGSRAA |
| Ga0137377_116251341 | 3300012211 | Vadose Zone Soil | MPGITLDPVDAAELAETLAFLADWLSGSQKQALADSFAAFVGHPAYNTGTLCAD |
| Ga0137375_113587962 | 3300012360 | Vadose Zone Soil | MPEISLDQGDAAELAEMLTFLADWLSGSQKQVLAG |
| Ga0137390_105785933 | 3300012363 | Vadose Zone Soil | MPGITLDPGDAAEPAEMAAFPAGWPSGSQEQVLAGSPAAFAGHPACNAGTLRADLHRFCL |
| Ga0164303_115491472 | 3300012957 | Soil | MPGITLDPADAAEIAETLTLLTQWLSGSQNHALAENFAAFIGHPAY |
| Ga0164309_111848092 | 3300012984 | Soil | MPGITLDPADAAEIAETLTLLTQWLSGSHKHALTESFAAFIGHPAYNTGTLCA |
| Ga0164308_108714311 | 3300012985 | Soil | MPQITLDLSDAAELAEMLTFLAGWLSGSQKPVLGKSLATYVGHP |
| Ga0157370_119741262 | 3300013104 | Corn Rhizosphere | MPGITLDPSDAVELAETLTLLAQWLSGSQKHALAESFAAFIGHPAYNTGTLC |
| Ga0134078_102538531 | 3300014157 | Grasslands Soil | MRLDLGDAAELADMLTFLGSWLSGSQKQILAESLAAFVSHPAYTTETLC |
| Ga0132257_1012148871 | 3300015373 | Arabidopsis Rhizosphere | MPGITLDPVDAAELAEVLTFLAGWLSGSQKQALAQSFAAFVGHPA |
| Ga0132255_1042672272 | 3300015374 | Arabidopsis Rhizosphere | MPQITLDMSDAAELAETLTFLASWLSGSQKQTLADSFADFVGHPAYTIATLCADLHRLPSRRQRR* |
| Ga0182036_106929161 | 3300016270 | Soil | MPQTRLDLSDAAELAETLTFLASWLSGSQKQILADSFAAF |
| Ga0182041_107458971 | 3300016294 | Soil | MPQITLDTSDAAELAEMLSFLADWLSGSQKQALAGSFAAFVGHPAYDT |
| Ga0182035_100475343 | 3300016341 | Soil | MPQIRLDTVDAAELAETLTFLTSWLSGSQKQTLADSFAAFVGHPAYNID |
| Ga0187814_104579422 | 3300017932 | Freshwater Sediment | MPGITLDLSDAVELAETLTFLAGWLSGSQKQILTESPAAFVGHPA |
| Ga0187808_102230232 | 3300017942 | Freshwater Sediment | MPSITLDLSDAIELAETLTFLAGWLSGSQKQILTESLAAF |
| Ga0187785_107546651 | 3300017947 | Tropical Peatland | MPGITLDPVDAAELAEVLTFLTQWLSGSQKHALAESFAAFVGHPAYNTGTLCT |
| Ga0187777_105200382 | 3300017974 | Tropical Peatland | MPAITLDLAGAAEIAETLTLLTEWLSGSQKQTLADSFAAFIGH |
| Ga0187810_101480592 | 3300018012 | Freshwater Sediment | MPGITLDLSDAAELAETLTLLTQWPSGSQEHALAESFAAFIG |
| Ga0066667_118864442 | 3300018433 | Grasslands Soil | MPQITLDLADSTELAETLTFITGWLSGTQEQALAD |
| Ga0210405_104844661 | 3300021171 | Soil | MPGITLDPVDAAEIAETLTFLAQWLSGSQKHALAEGFAAFV |
| Ga0210402_100211897 | 3300021478 | Soil | MPGITLELADAAELAETLALLTQWLSGSHKQTLADSFTAFIGH |
| Ga0210402_114576771 | 3300021478 | Soil | MPEIGLDHSDAIELAEMLTFLADWLSGAHKQTLADSLAGFV |
| Ga0210410_106519092 | 3300021479 | Soil | MPRITLDLSDAIELAETLTFLTGRLSGSQKQTLTSSLAAFVGHPAYNTDTLCAD |
| Ga0210409_116554671 | 3300021559 | Soil | MPGITLDPVDAAELAEVLTFLTRWLSGSQKHALAEGFAAFVGHPA |
| Ga0247661_10054871 | 3300024254 | Soil | MPGITLDLADAAEIAETLTLLTGWLSGSRKHVLADSFAA |
| Ga0207695_110753831 | 3300025913 | Corn Rhizosphere | MPGITLDPSDAVELAETLTLLAQWLSGSQKHALAESFA |
| Ga0207664_100823903 | 3300025929 | Agricultural Soil | MPGITLDPADAAEIAETPTLLTGWLSGSRKQTLADSFAAFIGHPAYNTGTLCADLHRFA |
| Ga0207678_105399294 | 3300026067 | Corn Rhizosphere | MPEIGLDHSDAIELAEMLTFLADWLSGAHKQTLADSLAGFVGQ |
| Ga0207702_112866601 | 3300026078 | Corn Rhizosphere | MPEIGLDHSDALELAEMLTFLADWLSGAHKQTLADSL |
| Ga0207698_103401521 | 3300026142 | Corn Rhizosphere | MPGITLDPSDAVELAETLTLLAQWLSGSQKHALAESFAAFIGHPAYNTGTLCADLHRFV |
| Ga0257177_10101691 | 3300026480 | Soil | MPGITLDLGDAAELAEMLAFLAEWLSGRQKQALTSSLEAFVGHTAYNAG |
| Ga0209448_101874722 | 3300027783 | Bog Forest Soil | MPSITLDPVDAAEIAETLTFLAQWLSGSQKHALAESF |
| Ga0209275_109239022 | 3300027884 | Soil | MPRITLDLSDAIELAETLTFLTGWLSGSQKQTLTSSLAAFVGHP |
| Ga0307303_100150341 | 3300028713 | Soil | MPGITLDPVDAAELAEVLTFLTQWLSGSQEHALAEGFAAFVGHPAYN |
| Ga0307298_102149132 | 3300028717 | Soil | MPGITLDPVDAAELAEVLTFLTQWLSGSQEHALAEGFAAFVGHPAYNTGT |
| Ga0307306_101283081 | 3300028782 | Soil | MPGITLDPADAAEIAETLTLLTGWLSGSHKHALTESFTAFIGHPA |
| Ga0307305_104554512 | 3300028807 | Soil | MPGITLDPADAAEIAETLTLLTGWLSGSHKHALTDSFTAFIGHPA |
| Ga0307312_102517162 | 3300028828 | Soil | MPEIGLDHSDAIELAEMLTFLADWLSSAHKQTLADSLTGFVGQTTYRI |
| Ga0318534_105758342 | 3300031544 | Soil | MPAITLDLADAAELAETLTLLTQWLSGNQEQTLAESFAAF |
| Ga0310915_100281211 | 3300031573 | Soil | MPQITLDAVDAAELGEMLTFLTGWLSGSQKQALHESFAAFVGHPAYNTDT |
| Ga0318561_104612162 | 3300031679 | Soil | MPGITLDLADAAELAETLALITEWLSGSQKQTLAGSFAAFIGHPAYNTDTLCADLH |
| Ga0318572_106973231 | 3300031681 | Soil | MPQIALDLSDATELAETLAFITGWLSGSQEQIPAESLAAFV |
| Ga0318560_103958881 | 3300031682 | Soil | MPQITLDTSDAAELAEMLTFLASWLTGSQQQILADSFAALVGHPAYN |
| Ga0318496_108528821 | 3300031713 | Soil | MPQITLDAADAAELAQTLTFLTSWLSGNQKQLLADSFAAFI |
| Ga0307476_103537822 | 3300031715 | Hardwood Forest Soil | MPGITLDPADAAEIAETLTLLTGWLSGSHKHALADSFAGFISH |
| Ga0306917_113092332 | 3300031719 | Soil | MPQITLDMSDAAELAETLAFLTSWLSGSQKQILADSFAAFVGH |
| Ga0307475_113889092 | 3300031754 | Hardwood Forest Soil | MPGITLDLSDAAELAETLTLLTQRLSGSQKHALAES |
| Ga0318554_108241851 | 3300031765 | Soil | MPQITLDMSDAAELAETLTFLASWLSGSQKQILADSF |
| Ga0318521_105956113 | 3300031770 | Soil | MPEISLDLGDAAELAVTLTFLADWLSGSQKQALGE |
| Ga0318566_102514432 | 3300031779 | Soil | MPGITLDPVDAAELAEVLTFLTQWLSGRQEHALADSFA |
| Ga0318547_100300574 | 3300031781 | Soil | MPGITLDLADAAELAETLAFLAEWLSGSQKQTLASSFAAF |
| Ga0318548_102211491 | 3300031793 | Soil | MSDAAELAETLAFLTSWLSGSQKQILADSFAAFVG |
| Ga0318557_101372082 | 3300031795 | Soil | MPAITLDLADAAELAETLTLLTQWLSGNQEQTLAESFTAFIGHPAYN |
| Ga0318523_101211321 | 3300031798 | Soil | MPQITLDTSDAAELAEMLTFLASWLTGSQQLILADSFAALVGHPAYNTAIL |
| Ga0318523_104032162 | 3300031798 | Soil | MPGITLDPVDAAELAEVLTFLTQWLSGRQRQALAESFAAFVG |
| Ga0318565_104763082 | 3300031799 | Soil | MPGITLDPVDAAELAEMLDFVARWLSGSQKQALADSFAAFVGHPAYNTDTL |
| Ga0318567_102452872 | 3300031821 | Soil | MPAITLDLADAAELAETLTLLTQWLSGNQEHALAESFAAFIGHPAYNTGTLCADLHRFVF |
| Ga0318564_100221101 | 3300031831 | Soil | MPQITLDTSDAAELAEMLTSLASWLTGSQQQILADSFAALVGHPAYNT |
| Ga0318512_105666611 | 3300031846 | Soil | MPQITLDMADAAELAETLTFLTGWLSGSQKQILAGSFAAFIGHPAYNTGTLC |
| Ga0318527_101974181 | 3300031859 | Soil | MPTINLDLSDAAELAETLTFLAEWLSGSQKQTLADSFAAFVGHP |
| Ga0318495_103165073 | 3300031860 | Soil | MPQITLDMADAAELAEMLTFLTGWLSGSQKQILAG |
| Ga0306925_113097851 | 3300031890 | Soil | MPGITLDPVDAAELAEMLDFVARWLSGSQKQALADSFAAFVGHPAYNTDTLR |
| Ga0318536_102434832 | 3300031893 | Soil | VPQITLDIGDAIELAETLTFITGWLSGSQQQTLAGSL |
| Ga0318522_101275521 | 3300031894 | Soil | MPQITLDTSDAAELAEMLTSLASWLTGSQQQILADSFAALVGHPAYNTAI |
| Ga0318522_104174061 | 3300031894 | Soil | MPQTRLDLSDAAELAETLTFLASWLSGSQKQILADSFAAFVGHPAYN |
| Ga0306921_102677091 | 3300031912 | Soil | MPAITLDLADAAELAETLTLLTQWLSGNQEQTLAESFA |
| Ga0310916_112910613 | 3300031942 | Soil | MPQIALDLSDAAELAEMLTFLANWLSGSQKQTLTDSFAAFVGHPA |
| Ga0310910_110827621 | 3300031946 | Soil | MPGITLDPVDAAELAEVLTFLTQWLSGRQKHALADSFAAFV |
| Ga0307479_118930091 | 3300031962 | Hardwood Forest Soil | MPQITLDTGDAAELAEILTFLADWLSGSQKQILDKS |
| Ga0306922_112804282 | 3300032001 | Soil | MPAITLDLADAAELAETLTLLTQWLSGSQEHALAESFTAFIGHPA |
| Ga0318563_100113861 | 3300032009 | Soil | MPGITLDPVDAAELAEVLTFLTQWLSGRQRQALAESFAAFVGHPAYNTGTLCAD |
| Ga0318563_100893011 | 3300032009 | Soil | MPTINLDLSDAAELAETLTFLAEWLSGSQKQTLADSFAAFV |
| Ga0318563_100997031 | 3300032009 | Soil | MPGITLDPVDAAELAEVLTFLTQWLSGRQKRALAKSFAAFVGHPAY |
| Ga0318549_101953061 | 3300032041 | Soil | MPGITLDPVDAAELAEVLTFLTQWLSGRQKRALAKSFAAFVGHPAYNTGTLCAD |
| Ga0318549_103823731 | 3300032041 | Soil | MPGITLDPVDAAELAEMLDFVARWLSGSQKQALADSFAAFVGHPAYNTD |
| Ga0318545_100583102 | 3300032042 | Soil | MPQITLDAVDAAELGEMLTFLTGWLSGSQKQALHESFAAFVGHPAYN |
| Ga0318556_100283411 | 3300032043 | Soil | MPQIRLDLGDAAELAEMLTFLTGWLSGSHKQALHDSFAAFVGHPAYN |
| Ga0318570_101536201 | 3300032054 | Soil | MPAITLDLADAAELAETLTLLTQWLSGNQEQTLAESFTAFIGHPAYNT |
| Ga0318505_101936901 | 3300032060 | Soil | MPAITLDLADAAELAETLTLLTQWLSGNQEQTLAESFTAFIGHP |
| Ga0318514_106931721 | 3300032066 | Soil | MPQIRLDLGDAAELAEMLTFLTGWLSGSHKQALHDSFAAFV |
| Ga0318553_107505281 | 3300032068 | Soil | VPQITLDIGDAIELAETLTFITGWLSGSQQQTLAGS |
| Ga0306924_125423451 | 3300032076 | Soil | MPRITLDLSDAAELAETLTFLAGWLSGSQKQALAGSFAAFVGHPAYGIEAL |
| Ga0318518_100653611 | 3300032090 | Soil | MPRITLDLSDAAELAETLTFLAEWLSGSQKQALADSFAAFVGHPAYN |
| Ga0307471_1001921343 | 3300032180 | Hardwood Forest Soil | MPQITLDTSDAAELAETLTFLASWLSGSQKQTLADSFAAFVGHPAYNTN |
| Ga0335085_110569421 | 3300032770 | Soil | MPGITLDPVDAAELAEVLTFLTQWLSGRQKHALAESFAAFVGHPAYNT |
| Ga0335081_100350161 | 3300032892 | Soil | MPGITLDLSDATEIAETLTLLTQWLSGSQQHILAQSFGAFIGHPAYSTGILCTDLRRVSIHGVSA |
| Ga0335074_116074351 | 3300032895 | Soil | MPQITLATSDAAEIAETLTFLADWLSGSQKQILAGSFAAFVGHPAYN |
| Ga0335075_111391191 | 3300032896 | Soil | MPGITLDPADAAEIAETLTLLTQWLSGGHKQTLAD |
| Ga0335072_117966432 | 3300032898 | Soil | MPQITLDMADAAELAEMLTFLASWLTGSQKQTLADSFA |
| Ga0314864_0208014_394_513 | 3300033805 | Peatland | MPQITLDLSDAAELAQMLTFLAGWLSGSQKPVLGKSLATY |
| ⦗Top⦘ |