| Basic Information | |
|---|---|
| Family ID | F069259 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 38 residues |
| Representative Sequence | DLKTADHWVDQTLSTKKAKAEKQPGAQGITMDQPK |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 98.39 % |
| % of genes from short scaffolds (< 2000 bps) | 88.71 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.258 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.871 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.613 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.419 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.75% β-sheet: 0.00% Coil/Unstructured: 68.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF02786 | CPSase_L_D2 | 9.68 |
| PF00535 | Glycos_transf_2 | 9.68 |
| PF00289 | Biotin_carb_N | 6.45 |
| PF13231 | PMT_2 | 5.65 |
| PF02597 | ThiS | 3.23 |
| PF13649 | Methyltransf_25 | 1.61 |
| PF13462 | Thioredoxin_4 | 1.61 |
| PF00639 | Rotamase | 1.61 |
| PF02265 | S1-P1_nuclease | 1.61 |
| PF01161 | PBP | 0.81 |
| PF00364 | Biotin_lipoyl | 0.81 |
| PF04536 | TPM_phosphatase | 0.81 |
| PF12867 | DinB_2 | 0.81 |
| PF02423 | OCD_Mu_crystall | 0.81 |
| PF13751 | DDE_Tnp_1_6 | 0.81 |
| PF11954 | DUF3471 | 0.81 |
| PF14534 | DUF4440 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 3.23 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 3.23 |
| COG0760 | Peptidyl-prolyl isomerase, parvulin family | Posttranslational modification, protein turnover, chaperones [O] | 1.61 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.81 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 82.26 % |
| Unclassified | root | N/A | 17.74 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2189573001|GZR05M101CVDEN | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 507 | Open in IMG/M |
| 3300001356|JGI12269J14319_10290247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300002568|C688J35102_118464327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300005181|Ga0066678_10194600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1292 | Open in IMG/M |
| 3300005435|Ga0070714_100315743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1460 | Open in IMG/M |
| 3300005541|Ga0070733_10614823 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300005542|Ga0070732_10504890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 732 | Open in IMG/M |
| 3300005554|Ga0066661_10775316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300005587|Ga0066654_10626981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300005602|Ga0070762_10133022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1473 | Open in IMG/M |
| 3300005610|Ga0070763_10014068 | All Organisms → cellular organisms → Bacteria | 3384 | Open in IMG/M |
| 3300005618|Ga0068864_100205984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1809 | Open in IMG/M |
| 3300005712|Ga0070764_10427930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 786 | Open in IMG/M |
| 3300005891|Ga0075283_1052751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 703 | Open in IMG/M |
| 3300005921|Ga0070766_10912598 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300006034|Ga0066656_10007615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 5306 | Open in IMG/M |
| 3300006034|Ga0066656_10907698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300006162|Ga0075030_101658718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300006173|Ga0070716_100433498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
| 3300006755|Ga0079222_12136073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300006800|Ga0066660_10209837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
| 3300006893|Ga0073928_10303540 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300009089|Ga0099828_11812837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300009176|Ga0105242_11199929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300009522|Ga0116218_1201015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300009552|Ga0116138_1197224 | Not Available | 556 | Open in IMG/M |
| 3300009639|Ga0116122_1165074 | Not Available | 701 | Open in IMG/M |
| 3300009646|Ga0116132_1250577 | Not Available | 539 | Open in IMG/M |
| 3300009665|Ga0116135_1202041 | Not Available | 759 | Open in IMG/M |
| 3300010046|Ga0126384_10485530 | Not Available | 1062 | Open in IMG/M |
| 3300010048|Ga0126373_11755845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300010048|Ga0126373_12647331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300010336|Ga0134071_10106182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1338 | Open in IMG/M |
| 3300010343|Ga0074044_10430996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
| 3300010358|Ga0126370_11335850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300010361|Ga0126378_12976363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300010366|Ga0126379_10826083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300010366|Ga0126379_11537842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300010376|Ga0126381_101862193 | Not Available | 868 | Open in IMG/M |
| 3300010398|Ga0126383_13258839 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300011269|Ga0137392_10552382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300012201|Ga0137365_11200962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiodictyon → Candidatus Thiodictyon syntrophicum | 542 | Open in IMG/M |
| 3300012212|Ga0150985_121583293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012955|Ga0164298_10267804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1040 | Open in IMG/M |
| 3300014165|Ga0181523_10701764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300014657|Ga0181522_10013319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4441 | Open in IMG/M |
| 3300014657|Ga0181522_10371504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 853 | Open in IMG/M |
| 3300014969|Ga0157376_12051305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300015372|Ga0132256_100666423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300017928|Ga0187806_1136923 | Not Available | 801 | Open in IMG/M |
| 3300017936|Ga0187821_10029492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1935 | Open in IMG/M |
| 3300017942|Ga0187808_10352855 | Not Available | 668 | Open in IMG/M |
| 3300017972|Ga0187781_10497785 | Not Available | 875 | Open in IMG/M |
| 3300017975|Ga0187782_10364108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300018009|Ga0187884_10296484 | Not Available | 654 | Open in IMG/M |
| 3300018026|Ga0187857_10535459 | Not Available | 524 | Open in IMG/M |
| 3300018033|Ga0187867_10430725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 729 | Open in IMG/M |
| 3300018038|Ga0187855_10765432 | Not Available | 563 | Open in IMG/M |
| 3300018040|Ga0187862_10066502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2574 | Open in IMG/M |
| 3300018040|Ga0187862_10758472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 564 | Open in IMG/M |
| 3300018042|Ga0187871_10487320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300018046|Ga0187851_10798966 | Not Available | 531 | Open in IMG/M |
| 3300018047|Ga0187859_10493930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 681 | Open in IMG/M |
| 3300018064|Ga0187773_10992474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300018085|Ga0187772_11284394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300018086|Ga0187769_11016361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300018431|Ga0066655_10895930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300019786|Ga0182025_1271982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 532 | Open in IMG/M |
| 3300019999|Ga0193718_1032546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300020581|Ga0210399_11164904 | Not Available | 614 | Open in IMG/M |
| 3300021088|Ga0210404_10497388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300021181|Ga0210388_10199933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1749 | Open in IMG/M |
| 3300021401|Ga0210393_10085732 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
| 3300021406|Ga0210386_11260416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300021420|Ga0210394_10177027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1857 | Open in IMG/M |
| 3300021476|Ga0187846_10358749 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300021560|Ga0126371_11242659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300022734|Ga0224571_101818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1343 | Open in IMG/M |
| 3300022881|Ga0224545_1008018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1655 | Open in IMG/M |
| 3300024225|Ga0224572_1080417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300025899|Ga0207642_10170363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1177 | Open in IMG/M |
| 3300025906|Ga0207699_10116904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1718 | Open in IMG/M |
| 3300025916|Ga0207663_10990862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300025924|Ga0207694_10195478 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1644 | Open in IMG/M |
| 3300025934|Ga0207686_10666621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300025934|Ga0207686_11125676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300026324|Ga0209470_1095983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1337 | Open in IMG/M |
| 3300026334|Ga0209377_1041394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2118 | Open in IMG/M |
| 3300026499|Ga0257181_1033078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300026552|Ga0209577_10130361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2002 | Open in IMG/M |
| 3300026557|Ga0179587_10956868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300027070|Ga0208365_1024305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300027727|Ga0209328_10178633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300027824|Ga0209040_10268645 | Not Available | 846 | Open in IMG/M |
| 3300027862|Ga0209701_10224561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1109 | Open in IMG/M |
| 3300027898|Ga0209067_10448722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300027905|Ga0209415_10038312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6581 | Open in IMG/M |
| 3300027905|Ga0209415_10679710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300027908|Ga0209006_11066582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300028773|Ga0302234_10531008 | Not Available | 503 | Open in IMG/M |
| 3300028906|Ga0308309_10730552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300029636|Ga0222749_10679379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 563 | Open in IMG/M |
| 3300029955|Ga0311342_10274251 | Not Available | 1554 | Open in IMG/M |
| 3300029984|Ga0311332_10045454 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3061 | Open in IMG/M |
| 3300030617|Ga0311356_11800050 | Not Available | 546 | Open in IMG/M |
| 3300030618|Ga0311354_11334681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300030737|Ga0302310_10313276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300030743|Ga0265461_13103124 | Not Available | 559 | Open in IMG/M |
| 3300031128|Ga0170823_10517198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300031715|Ga0307476_10022829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4085 | Open in IMG/M |
| 3300031754|Ga0307475_10631757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300031754|Ga0307475_11150484 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300031769|Ga0318526_10066296 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300031954|Ga0306926_12567473 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300032035|Ga0310911_10026661 | All Organisms → cellular organisms → Bacteria | 2846 | Open in IMG/M |
| 3300032174|Ga0307470_10037823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2362 | Open in IMG/M |
| 3300032180|Ga0307471_100001151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 14314 | Open in IMG/M |
| 3300032180|Ga0307471_102871248 | Not Available | 612 | Open in IMG/M |
| 3300032180|Ga0307471_103215848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300032205|Ga0307472_101808897 | Not Available | 607 | Open in IMG/M |
| 3300032783|Ga0335079_11730897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300032805|Ga0335078_11402455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300034124|Ga0370483_0032585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1590 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.06% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.26% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.23% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.23% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.23% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.61% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.81% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.81% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3 | Host-Associated | Open in IMG/M |
| 3300022881 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FD2_06506160 | 2189573001 | Grass Soil | RRIYKTADEWVDKTMANQKAKAEKQPGAGGIVMDQNK |
| JGI12269J14319_102902472 | 3300001356 | Peatlands Soil | EDLKTADHWSDEVMRVRKAKAEKAAQSQGGGITIDQPK* |
| C688J35102_1184643272 | 3300002568 | Soil | RTEDLKTADHWVDETLRVKKAKAEKAAQSQGGGITMDQSK* |
| Ga0066678_101946002 | 3300005181 | Soil | PAARAADLKTADEWVDKTLDVKKHKAEKQPGAQGITMDQNK* |
| Ga0070714_1003157431 | 3300005435 | Agricultural Soil | TEDLKTADHWVDETLRVKKAKAEKAAQSQGGGITMDQSK* |
| Ga0070733_106148232 | 3300005541 | Surface Soil | DDLNARQQDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK* |
| Ga0070732_105048903 | 3300005542 | Surface Soil | AADLKTADEWVDKTLAVKKAKAEKQPGAGGITMGNEGK* |
| Ga0066661_107753161 | 3300005554 | Soil | ECDDLSARAEDLKTADHWVDETLRVKKEKADKAAQNPGGITVDQPK* |
| Ga0066654_106269811 | 3300005587 | Soil | ADQRAADLKTADEWVDKAMAAKRAKAEKAANSPQGITVDQSK* |
| Ga0070762_101330221 | 3300005602 | Soil | AARQEDLKTADHWVDQTLITKKIKSEKQPGTQGITMDQPK* |
| Ga0070763_100140685 | 3300005610 | Soil | RQEDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK* |
| Ga0068864_1002059843 | 3300005618 | Switchgrass Rhizosphere | DLKTADEWVDKTMAAKKAKAEKQTGANGITMDQSK* |
| Ga0070764_104279301 | 3300005712 | Soil | ADLKSADEWVDKTMATKKAKAEKQPGQQGITMDQPK* |
| Ga0075283_10527512 | 3300005891 | Rice Paddy Soil | LKTADEWVDKTMATKKANAEKQGQGGIVLDQKQQ* |
| Ga0070766_109125981 | 3300005921 | Soil | ARQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITMDQPK* |
| Ga0066656_100076151 | 3300006034 | Soil | LKTADEWVDKTLDVKKHKAEKQPGAQGITMDQNK* |
| Ga0066656_109076982 | 3300006034 | Soil | DLKTADHWVDETLRVKKAKAEKAAQSQGGGITVDQPK* |
| Ga0075030_1016587181 | 3300006162 | Watersheds | DLKTADEWVDKTLAVKKAKAEKQPGAQGITMEQK* |
| Ga0070716_1004334982 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TEDLKTADHWVDETLRIKKAKAEKAAQSQGGGITMDQTK* |
| Ga0079222_121360733 | 3300006755 | Agricultural Soil | ADQRAADLKTADEWVDKAMAAKKAKAEKAANSPQGITVDQSK* |
| Ga0066660_102098373 | 3300006800 | Soil | LKEADTWVDKTMATKKAKAEKQPGAQGVTMDQPSK* |
| Ga0073928_103035401 | 3300006893 | Iron-Sulfur Acid Spring | EDLKTADHWVDQTLITKKAKAEKQPGQQQGITLDQPK* |
| Ga0099828_118128371 | 3300009089 | Vadose Zone Soil | ADLKTADEWVDKTMAVKKAKAEKQPSNTGITMDQNK* |
| Ga0105242_111999292 | 3300009176 | Miscanthus Rhizosphere | DTKKADDYVDQAMAVKKARAEKQPGAQGIVMDQPK* |
| Ga0116218_12010152 | 3300009522 | Peatlands Soil | KNADEWVDKTMATKKAKAERQPSNNGITMDQNSQ* |
| Ga0116138_11972242 | 3300009552 | Peatland | LNVRREDLKTANDWVDQALLTRNVKAEKQPWQQGMTMDQSK* |
| Ga0116122_11650742 | 3300009639 | Peatland | GDLKTADDWVDQTLLTKKAKAEKQPGQQRMTMDQSK* |
| Ga0116132_12505771 | 3300009646 | Peatland | DLKTADDWVDQTLLTKKAKAEKQPGQQRMTMDQSK* |
| Ga0116135_12020411 | 3300009665 | Peatland | LKTADHWVDQTLITKKVKAEKQPGANGITMDQPK* |
| Ga0126384_104855302 | 3300010046 | Tropical Forest Soil | ADLKTADQWVDKTLEVKKAKAAKQPGAGGITMDQQK* |
| Ga0126373_117558452 | 3300010048 | Tropical Forest Soil | ESARAEDLKTADHWVDETMRVKKAKAEKAAQAQGGGITMDSSK* |
| Ga0126373_126473312 | 3300010048 | Tropical Forest Soil | EDLKTADGWVDKTLATKKLKAEKAAQSQGGQITMDQSK* |
| Ga0134071_101061821 | 3300010336 | Grasslands Soil | LKTADEWVDKTMAAKKAKAEKQPGAQGITMQPSQ* |
| Ga0074044_104309961 | 3300010343 | Bog Forest Soil | DLAARQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITMDQPK* |
| Ga0126370_113358502 | 3300010358 | Tropical Forest Soil | AEDLKAADHWVDETLRVKKAKAEKAAQSQGGGITMEPK* |
| Ga0126378_129763631 | 3300010361 | Tropical Forest Soil | DLKKADEWVDKTMATKKAKAEKQPGTQGIVMDQQK* |
| Ga0126379_108260832 | 3300010366 | Tropical Forest Soil | EAARAEDLKSADHWVDETMRVKKAKAEKAAQAQGGGITMDSSK* |
| Ga0126379_115378422 | 3300010366 | Tropical Forest Soil | KTADHWVDETLRVKKAKAEKAAQSQGGGITMDQPTK* |
| Ga0126381_1018621931 | 3300010376 | Tropical Forest Soil | QAAADLKTADAWQDKTLDARKRKAEKQAAPQGVSMDDSGK* |
| Ga0126383_132588391 | 3300010398 | Tropical Forest Soil | KTADHWVDETLRVKKAKAEKAAQSQGGGITMDQSSK* |
| Ga0137392_105523821 | 3300011269 | Vadose Zone Soil | RAEDLKTAERWVDQTLLTKKAKAEKQPGQQGITADQPK* |
| Ga0137365_112009621 | 3300012201 | Vadose Zone Soil | DDLAARAEDLKTADHWVDETLRVKKAKAEKAAQGQGGGITVDQPK* |
| Ga0150985_1215832931 | 3300012212 | Avena Fatua Rhizosphere | KTADHWVDETLRVKKAKAEKAAQSQGGGITMDQSK* |
| Ga0164298_102678041 | 3300012955 | Soil | ADLKTADEWVDKTMATKKAKAEKQPGNQGITMPSK* |
| Ga0181523_107017642 | 3300014165 | Bog | ADQKAADNWVDKTLATKKAKADKAAAAAGGGITVDQK* |
| Ga0181522_100133191 | 3300014657 | Bog | DLKTADHWVDETLITKKAKAEKQPGTQGITMDQPK* |
| Ga0181522_103715042 | 3300014657 | Bog | LKTADHWVDETLRVKKAKAEKAAQSQGGGITVDTPK* |
| Ga0157376_120513051 | 3300014969 | Miscanthus Rhizosphere | TADHWVDETLRVKKAKAEKAAQSQGGGITMDQPK* |
| Ga0132256_1006664232 | 3300015372 | Arabidopsis Rhizosphere | LKTADEWVDKTMATKKAKAEKQPGTTGIVNEQSK* |
| Ga0187806_11369231 | 3300017928 | Freshwater Sediment | DLKTADEWVDKTMAAKRAKVEKQAAAPGGISLDQPK |
| Ga0187821_100294922 | 3300017936 | Freshwater Sediment | ADLKTADEWVDKTMAVKKAKAEKQPGNQGITMPSQ |
| Ga0187808_103528553 | 3300017942 | Freshwater Sediment | AADLKTADEWVDKTMAAKRAKAEKQAAAPGGISLDQPK |
| Ga0187781_104977851 | 3300017972 | Tropical Peatland | QKDLKEADHWVDQTLITKKIKAEKQPGAQGITLDQPK |
| Ga0187782_103641081 | 3300017975 | Tropical Peatland | AARTEDLKAADHWVDETMRVKKANAEKAAAAQGGGITVDQPTK |
| Ga0187884_102964841 | 3300018009 | Peatland | RREDLKTADDWVDQALLTRNVKAEKQPWQQGMTMDQSK |
| Ga0187857_105354592 | 3300018026 | Peatland | RQEDLKTADQWVDKTLSTKKAKAEKQPGAQGITMDQPK |
| Ga0187867_104307251 | 3300018033 | Peatland | REDLKTADYWVDQTLLTKKAKAEKQPGQQGITMHQPK |
| Ga0187855_107654322 | 3300018038 | Peatland | QEDLKTADHWVDQTLITKKAKAEKQPGPQGITMDQPK |
| Ga0187862_100665023 | 3300018040 | Peatland | LNQRQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITLDQPK |
| Ga0187862_107584721 | 3300018040 | Peatland | DLKTADQWVDKTLSTKKAKAEKQPGTNGITMDQPK |
| Ga0187871_104873201 | 3300018042 | Peatland | AARQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITMDQQK |
| Ga0187851_107989661 | 3300018046 | Peatland | TRQEDLKTADQWVDKTLSTKKAKAEKQPGAQGITMDQPK |
| Ga0187859_104939303 | 3300018047 | Peatland | ARREDLKTADYWVDQTLLTKKAKAEKQPGQQGITMHQPK |
| Ga0187773_109924741 | 3300018064 | Tropical Peatland | ADEWVDKTMATKKAKAAKQAGPGGIVLEQPQTPQQ |
| Ga0187772_112843942 | 3300018085 | Tropical Peatland | KTADHWVDETLRVKKAKADKAAQSSGGGITVDQPK |
| Ga0187769_110163611 | 3300018086 | Tropical Peatland | DLAARQEDLKTADHWVDQTLITKKAKAEKQPGQQGGITMDQPK |
| Ga0066655_108959302 | 3300018431 | Grasslands Soil | SARAGDLKTADHWVDEALRVKKEKADKGAQNPCGITVDQPK |
| Ga0182025_12719821 | 3300019786 | Permafrost | QEDLKTADQWVDKTLSTKKAKAEKQPGTNGITMDQPK |
| Ga0193718_10325462 | 3300019999 | Soil | TADLKTADEWVDKTLAVKKAKAEKQPGNQGLTTESPK |
| Ga0210399_111649042 | 3300020581 | Soil | ADLKTADEWLDKTMAAKRAKAEKQAAAPGGISLDQPK |
| Ga0210404_104973882 | 3300021088 | Soil | AADLKAADEWVDKTLAVKKAKAEKQPGATGITMENK |
| Ga0210388_101999332 | 3300021181 | Soil | AADLKTADEWVDKTMAIKKAKAEKQPGGGGIVLDKQ |
| Ga0210393_100857324 | 3300021401 | Soil | RQADLKTADHWVDQTLLTKKAKAEKQPGTQGITMDQPK |
| Ga0210386_112604161 | 3300021406 | Soil | RAEDLKTADHWVDETLRVKKAKAEKAAQSQTGGITLDAPKQ |
| Ga0210394_101770272 | 3300021420 | Soil | DLKTADHWVDQTLSTKKAKAEKQPGAQGITMDQPK |
| Ga0187846_103587491 | 3300021476 | Biofilm | PSARSADLKAADEWVDKTLAVKKAKAEKQPGAAGITMDQGK |
| Ga0126371_112426591 | 3300021560 | Tropical Forest Soil | KSADHWVDETMRVKKAKAEKAAQAQGGGITMDSSK |
| Ga0224571_1018182 | 3300022734 | Rhizosphere | NQRQEDLKTADHWVDQTLLTKKAKAEKQPGTQGITLDQPK |
| Ga0224545_10080181 | 3300022881 | Soil | PASRQEDLKTADQWVDKTLSTKKAKAEKQPGAQGITMDQPK |
| Ga0224572_10804172 | 3300024225 | Rhizosphere | DDLAARAEDLKTADHWVDETLRVKKAKAEKAAQSQGGGIVMDK |
| Ga0207642_101703631 | 3300025899 | Miscanthus Rhizosphere | DLKTADEWVDKTMAAKKAKAEKQTGANGITMDQSK |
| Ga0207699_101169041 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ADLKTADEWVDKTLATKKEKAAKQPGAQGVTLDQPSK |
| Ga0207663_109908621 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TADDWVDKTMATKKAKAEKQPGAQGITLGGDSSSK |
| Ga0207694_101954782 | 3300025924 | Corn Rhizosphere | QRVADSKTADEWVDKTLAAKKAKAEKSAGPNGITMSK |
| Ga0207686_106666211 | 3300025934 | Miscanthus Rhizosphere | DTKKADDYVDQAMAVKKARAEKQPGAQGIVMDQPK |
| Ga0207686_111256762 | 3300025934 | Miscanthus Rhizosphere | ADLKTADEWVDKTMATKKAKAEKQPGNQGITMPSK |
| Ga0209470_10959831 | 3300026324 | Soil | ADLKTADEWVDKTMAAKKAKAEKQPGAQGITMQPSQ |
| Ga0209377_10413943 | 3300026334 | Soil | AADLKTADEWVDKTMAAKKAKAEKQPGAQGITMQPSQSPSQ |
| Ga0257181_10330782 | 3300026499 | Soil | DLAARAEDLKTADHWVDQTLLTKKAKAEKQPGQQGITADQPK |
| Ga0209805_11048001 | 3300026542 | Soil | KTADEWVEKTMATKRAKAEKQNKAAGIVVEQGQSQSK |
| Ga0209577_101303614 | 3300026552 | Soil | LKEADTWVDKTMATKKAKAEKQPGAQGVTMDQPSK |
| Ga0179587_109568681 | 3300026557 | Vadose Zone Soil | NARQEDLKTADHWVDQTLSTKKAKAEKQPGQQGITMDQPK |
| Ga0208365_10243052 | 3300027070 | Forest Soil | ARQEDLKTADHWVDQTLITKKAKAEKQPGQQQGITLDQPK |
| Ga0209328_101786332 | 3300027727 | Forest Soil | ARAEDLKTADHWVDETLRVKKAKAEKAAQNSQGGITVDKQ |
| Ga0209040_102686452 | 3300027824 | Bog Forest Soil | ARQEDLKTADHWVDQTLLTKKAKAEKQPGNQGITMDQPK |
| Ga0209701_102245611 | 3300027862 | Vadose Zone Soil | RAADLKTADEWVDKTMTTKKIKAEKQPGNQGITMPSK |
| Ga0209067_104487222 | 3300027898 | Watersheds | LSARAEDLKTADHWVDETLRVKKAKAEKAAQSAQGGITVDQK |
| Ga0209415_100383121 | 3300027905 | Peatlands Soil | LKTADHWVDETLRVKKAKAEKAAEKAAGGITMDQSK |
| Ga0209415_106797102 | 3300027905 | Peatlands Soil | HPGAEDLKTADHWVDETLRVKKARADKAAQSTGGGITMDTPK |
| Ga0209006_110665822 | 3300027908 | Forest Soil | SDLKTADDWVDKTMAAKKAKAEKQPGVQGITLDQNASGNK |
| Ga0302234_105310081 | 3300028773 | Palsa | ARQEDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK |
| Ga0308309_107305522 | 3300028906 | Soil | DDLNARQEDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK |
| Ga0222749_106793792 | 3300029636 | Soil | QEDLKTADHWVDRTLSTKKAKAEKQPGTQGITMDQPK |
| Ga0311342_102742512 | 3300029955 | Bog | RQEDLKTADTWVDKTLSTKKAKAEKQPGTQGITLDQPK |
| Ga0311332_100454541 | 3300029984 | Fen | DLKTADEWVDKTMAVKKMKAEKQPVGGGIVMDQKQ |
| Ga0311356_118000502 | 3300030617 | Palsa | DLAARQEDLKTADHWVDQTLITKKAKAEKQPGTQGITMDQPK |
| Ga0311354_113346811 | 3300030618 | Palsa | ARQEDLKTADHWVDQTLLTKKIKSEKQPGATGITMDQPK |
| Ga0302310_103132761 | 3300030737 | Palsa | EDLKTADHWVDQTLLTKKVKAEKQPGQQGITMDQPK |
| Ga0265461_131031241 | 3300030743 | Soil | QEDLKTADHWVDQTLLTKKAKAEKQPGNQGITMDQSK |
| Ga0170823_105171981 | 3300031128 | Forest Soil | FARQEDLKAADGWVDKTLATKKAKAEKQPGTNGITLDQPK |
| Ga0307476_100228291 | 3300031715 | Hardwood Forest Soil | RTEDLKTADHWVDETLRVKKAKAEKAAQSQGGGITMDQPK |
| Ga0307475_106317571 | 3300031754 | Hardwood Forest Soil | LKTADEWVDKTMATKKAKAEKQPGAQGITMDQQSK |
| Ga0307475_111504841 | 3300031754 | Hardwood Forest Soil | ADLKTADEWVDKTLAVKKAKAEKQPGAGGITMGNEGK |
| Ga0318526_100662963 | 3300031769 | Soil | DLKTADEWVDRTLAVKKAKAEKQPGAAGITMDQGK |
| Ga0306926_125674732 | 3300031954 | Soil | DLKTADEWVDKTMAAKKAKAEKQSGAQGITLDQSK |
| Ga0310911_100266615 | 3300032035 | Soil | RAADLKTADEWVDRTLAVKKAKAEKQPGAAGITMDQGK |
| Ga0307470_100378233 | 3300032174 | Hardwood Forest Soil | RAEDLKTADHWVDETLRVKKAKAEKAAQSAGGGITVDQPK |
| Ga0307471_10000115116 | 3300032180 | Hardwood Forest Soil | AADMKTADEWVDKTMATKKAKAEKQPGAQGITMPSQ |
| Ga0307471_1028712482 | 3300032180 | Hardwood Forest Soil | AARQEDLKTADHWVDQTLLTKKAKAEKQPGQQGITMDQPK |
| Ga0307471_1032158481 | 3300032180 | Hardwood Forest Soil | AADLKTADEWVDKTMATKKIKAEKQPGAQGITLDQPK |
| Ga0307472_1018088972 | 3300032205 | Hardwood Forest Soil | RAADLKTADEWVDKTMAAKKAKAQKQTGNQGITLDQPK |
| Ga0335079_117308972 | 3300032783 | Soil | ADLKTADEWVDKTMATKKAKAEKQPGAQGITMDQPAGK |
| Ga0335078_114024552 | 3300032805 | Soil | RADDLKTADHWVDETLRVKKAKADKAAQAAQGGITVDQSK |
| Ga0370483_0032585_1475_1588 | 3300034124 | Untreated Peat Soil | QEDLKTADHWVDQTLITKKAKAEKQPGTQGITMDQPK |
| ⦗Top⦘ |