| Basic Information | |
|---|---|
| Family ID | F069253 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AGATSFGTGSGSRGSLADLKIVPGHAVMLAAGAVSAETVN |
| Number of Associated Samples | 100 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 34.68 % |
| % of genes from short scaffolds (< 2000 bps) | 32.26 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.065 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (48.387 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.419 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.581 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 19.12% Coil/Unstructured: 76.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF05345 | He_PIG | 7.26 |
| PF13683 | rve_3 | 3.23 |
| PF00392 | GntR | 2.42 |
| PF01850 | PIN | 2.42 |
| PF01904 | DUF72 | 2.42 |
| PF02653 | BPD_transp_2 | 2.42 |
| PF13561 | adh_short_C2 | 1.61 |
| PF01472 | PUA | 1.61 |
| PF00881 | Nitroreductase | 1.61 |
| PF04952 | AstE_AspA | 0.81 |
| PF00300 | His_Phos_1 | 0.81 |
| PF08402 | TOBE_2 | 0.81 |
| PF03704 | BTAD | 0.81 |
| PF00933 | Glyco_hydro_3 | 0.81 |
| PF02687 | FtsX | 0.81 |
| PF07690 | MFS_1 | 0.81 |
| PF00441 | Acyl-CoA_dh_1 | 0.81 |
| PF00857 | Isochorismatase | 0.81 |
| PF01545 | Cation_efflux | 0.81 |
| PF13490 | zf-HC2 | 0.81 |
| PF04672 | Methyltransf_19 | 0.81 |
| PF01169 | UPF0016 | 0.81 |
| PF00589 | Phage_integrase | 0.81 |
| PF13377 | Peripla_BP_3 | 0.81 |
| PF05050 | Methyltransf_21 | 0.81 |
| PF01609 | DDE_Tnp_1 | 0.81 |
| PF16124 | RecQ_Zn_bind | 0.81 |
| PF07859 | Abhydrolase_3 | 0.81 |
| PF08445 | FR47 | 0.81 |
| PF03551 | PadR | 0.81 |
| PF00293 | NUDIX | 0.81 |
| PF01152 | Bac_globin | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 2.42 |
| COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 0.81 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.81 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.81 |
| COG3947 | Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains | Transcription [K] | 0.81 |
| COG3629 | DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domain | Transcription [K] | 0.81 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.81 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.81 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.81 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.81 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.81 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.81 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.81 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.81 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.06 % |
| All Organisms | root | All Organisms | 16.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004633|Ga0066395_10373295 | Not Available | 798 | Open in IMG/M |
| 3300005444|Ga0070694_101654394 | Not Available | 544 | Open in IMG/M |
| 3300006755|Ga0079222_10213975 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300009012|Ga0066710_102705443 | Not Available | 707 | Open in IMG/M |
| 3300009525|Ga0116220_10393048 | Not Available | 619 | Open in IMG/M |
| 3300009672|Ga0116215_1041734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales | 2096 | Open in IMG/M |
| 3300009792|Ga0126374_10142848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1438 | Open in IMG/M |
| 3300010366|Ga0126379_12749975 | Not Available | 588 | Open in IMG/M |
| 3300010379|Ga0136449_104554647 | Not Available | 509 | Open in IMG/M |
| 3300016270|Ga0182036_10688205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 826 | Open in IMG/M |
| 3300016357|Ga0182032_11874257 | Not Available | 525 | Open in IMG/M |
| 3300016404|Ga0182037_11133613 | Not Available | 685 | Open in IMG/M |
| 3300016422|Ga0182039_11699750 | Not Available | 577 | Open in IMG/M |
| 3300016422|Ga0182039_11700428 | Not Available | 577 | Open in IMG/M |
| 3300017970|Ga0187783_11023488 | Not Available | 595 | Open in IMG/M |
| 3300018058|Ga0187766_10379821 | Not Available | 931 | Open in IMG/M |
| 3300018060|Ga0187765_10288057 | Not Available | 980 | Open in IMG/M |
| 3300020579|Ga0210407_11395542 | Not Available | 520 | Open in IMG/M |
| 3300021402|Ga0210385_10226951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1365 | Open in IMG/M |
| 3300021407|Ga0210383_10616696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 935 | Open in IMG/M |
| 3300021475|Ga0210392_10493890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales | 901 | Open in IMG/M |
| 3300025915|Ga0207693_11321331 | Not Available | 539 | Open in IMG/M |
| 3300026538|Ga0209056_10348788 | Not Available | 974 | Open in IMG/M |
| 3300027874|Ga0209465_10377198 | Not Available | 710 | Open in IMG/M |
| 3300027884|Ga0209275_10640180 | Not Available | 611 | Open in IMG/M |
| 3300027889|Ga0209380_10324279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
| 3300027911|Ga0209698_11151783 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 573 | Open in IMG/M |
| 3300028906|Ga0308309_11278661 | Not Available | 631 | Open in IMG/M |
| 3300031680|Ga0318574_10028019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2820 | Open in IMG/M |
| 3300031682|Ga0318560_10420832 | Not Available | 723 | Open in IMG/M |
| 3300031708|Ga0310686_103343025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6276 | Open in IMG/M |
| 3300031720|Ga0307469_10119005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales | 1906 | Open in IMG/M |
| 3300031751|Ga0318494_10359512 | Not Available | 843 | Open in IMG/M |
| 3300031771|Ga0318546_10314789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1085 | Open in IMG/M |
| 3300031897|Ga0318520_10783067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces atratus | 598 | Open in IMG/M |
| 3300031912|Ga0306921_10844582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Actinocrispum → Actinocrispum wychmicini | 1043 | Open in IMG/M |
| 3300031941|Ga0310912_11416809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300031946|Ga0310910_10526091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 939 | Open in IMG/M |
| 3300032041|Ga0318549_10140573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1071 | Open in IMG/M |
| 3300032060|Ga0318505_10463008 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300032094|Ga0318540_10335575 | Not Available | 730 | Open in IMG/M |
| 3300033289|Ga0310914_11626150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 550 | Open in IMG/M |
| 3300034163|Ga0370515_0166003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales | 945 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 48.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.42% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.81% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_01077730 | 2199352025 | Soil | AGATSLGTGTGLRGSLADLQIAPGLAVMLAAGAVSAEAVS |
| Ga0066395_103732951 | 3300004633 | Tropical Forest Soil | SGGNAFTFGAGATGFGTGSGSRGSLGDLKIVPGRAVMLAAGAVSAETVT* |
| Ga0066395_109247642 | 3300004633 | Tropical Forest Soil | GATSFGAGSGSRGSLADLKIVPGLAVMLAAGAVSAETVT* |
| Ga0070709_103647631 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GATSFGTGSGSRGSLADLKIVPGHAVMLAAGAISAEAVS* |
| Ga0070709_114995471 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AGATSFGTGSGSRGSLADLKIVPGHAVMLAAGAISAEAAS* |
| Ga0070713_1019447252 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | SAGATSFGTGSGSRGSLADLKIVPGHAVMLAAGAISAEAAS* |
| Ga0070694_1016543942 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | SGGNAFTFSAGATSFGTGSGSRGSLADLKIVPGHAVMLAAGAISAEAVS* |
| Ga0070735_109044382 | 3300005534 | Surface Soil | SFGTGSGSHGSLGDLKIVPGQAVMLASDAVSTEPVS* |
| Ga0070763_108254781 | 3300005610 | Soil | AGATSFGTGSGSHTSLADLKIVPGQAVLLAADAVSAEPVS* |
| Ga0070766_102791064 | 3300005921 | Soil | TAGATSFGTGSGSHTSLADLKIVPGQAVLLAADAVSAEPVS* |
| Ga0070716_1005227932 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TSFGTGSGSRGSLADLKIVPGHAVMLAAGAISAEAVS* |
| Ga0079222_102139751 | 3300006755 | Agricultural Soil | GGNAFTFAAGATSFGIGSGSRGSLADLKIVPGHAVLLAAGAVSAEAVS* |
| Ga0066710_1027054431 | 3300009012 | Grasslands Soil | NAFTFAAGATSFGTGSGSRGGLGDLKVAPGLAVMLAAGAVSTKPVT |
| Ga0116220_103930482 | 3300009525 | Peatlands Soil | ADSGGNAFTFAAGATSFGTGSGSRGSLGDLKIVPGRAVMLAANAVSPRP* |
| Ga0116215_10417341 | 3300009672 | Peatlands Soil | GNAFTFAAGATSFGTGSGSRGSLGDLKIVPGRAVLLAANAVSTETVN* |
| Ga0126374_101428483 | 3300009792 | Tropical Forest Soil | GDAFTFGAGATGFGADSGSRGSLADLKIVPGHAVMLAAGAVSAEAVS* |
| Ga0126376_110835442 | 3300010359 | Tropical Forest Soil | VNKTGAMAAGATSFGTGSGSRGSLADLKIVPGHAVMLASGAVSAETVN* |
| Ga0126379_118284851 | 3300010366 | Tropical Forest Soil | AGATSFGTGSGSHTSLADVKIVPGRAVMLAADAISAESVS* |
| Ga0126379_127499752 | 3300010366 | Tropical Forest Soil | GGNAFTFGAGATSFGTGSGSRGSLADLKIVPGHAVMLAAVAVSAETVN* |
| Ga0126381_1009087882 | 3300010376 | Tropical Forest Soil | VNKTGAMAAGATSFGAGSGSRGSLADLKIVPGHAVMLASGAVSAETVN* |
| Ga0126381_1030243122 | 3300010376 | Tropical Forest Soil | ATAFGPGSGSRGSLDDLKIVPGRAVMLAAGAVSAEAVS* |
| Ga0136449_1045546471 | 3300010379 | Peatlands Soil | GNAFTFAAGATSFGTGSGSRGSLGDLKIVPGRAVMLAANAVSTETVN* |
| Ga0137776_11447001 | 3300010937 | Sediment | FTFPAGASSFGTGSGSRGSLADLKIVPGRAVMLAAGAVSAEAVK* |
| Ga0182030_104652461 | 3300014838 | Bog | TAGATSFGTGSGSHTSLGDLKIVPGQAVMLASDAVSAEPVS* |
| Ga0182036_106882052 | 3300016270 | Soil | DSGADAFTFGAGAASFGPGSGSRGSLADLKIVPGLAVMLATGAVSAETVS |
| Ga0182033_120038391 | 3300016319 | Soil | DATSFGTGSGSRGSLADLKIVPGHAVMLAAGAVSAEAVS |
| Ga0182035_115088721 | 3300016341 | Soil | AFTFAAGATSFGAGSGSRGSLGDLKIVPGRAVMLAAGAVSTEAVS |
| Ga0182032_108177431 | 3300016357 | Soil | AFTFAAGATSFGTGSGSRGSLADLKIVPGHAVMLAAGAVSAETVN |
| Ga0182032_111931092 | 3300016357 | Soil | ASFGPGSGSRGSLADLKIAPGIAVMLATGAVSAETVN |
| Ga0182032_118742571 | 3300016357 | Soil | NAFTFAAGAASFGAGSGSRGSLGDLKIVPGRAVMLAASAVSTQTVT |
| Ga0182034_104878301 | 3300016371 | Soil | TFSAGAASFGPGSGSRGSLADLKIVPGLAVMLAAGAVSAEAVS |
| Ga0182037_111336131 | 3300016404 | Soil | ATAFGTGSGSRGSLDDLKIVPGHAAMLAGGAVSAEPVS |
| Ga0182039_116997502 | 3300016422 | Soil | ADATGNAFTFTAAATSFGTGSGPHTSLADLKIVPGHAVLLAADAVSAEPVR |
| Ga0182039_117004281 | 3300016422 | Soil | DSSGNAFTFAAGAASFGTGSGSRGSVGDLKIVPGRAVMLAAGAVSTETVN |
| Ga0187778_105843342 | 3300017961 | Tropical Peatland | FGTGSGSHTSLADLKIVPGRAVMLAADAVSAESVS |
| Ga0187783_110234881 | 3300017970 | Tropical Peatland | FTFTAGATSFGTGSGSLGSLAGLTIAPGHAVMLTANGVSTEPVS |
| Ga0187780_104227941 | 3300017973 | Tropical Peatland | GAASFGTGSGSRGSLADLKIVPGRAVMLVADAVSAETVN |
| Ga0187777_111428121 | 3300017974 | Tropical Peatland | ATSFGTGSGSHTSLADLKIVPGHAVMLAADAVSAESVN |
| Ga0187766_101169471 | 3300018058 | Tropical Peatland | SFGTGSGSHTSLADLKIVPGRAVMLAADAVSAESVS |
| Ga0187766_103798212 | 3300018058 | Tropical Peatland | NAFTFTAGATSFGTGSGSHTSLGDLKIVPGQAVLLAADAVSAEPVS |
| Ga0187766_104427191 | 3300018058 | Tropical Peatland | TAGAASFGAGSGSHTSLADLKIVPGHAVMLAADAVSAETVN |
| Ga0187765_100640023 | 3300018060 | Tropical Peatland | TSFGTGSGSHTSLADLKIVPGHAVMLAANAISAEPVS |
| Ga0187765_102880571 | 3300018060 | Tropical Peatland | TTGNAFTFTAGATSFGTGSGSHTSLADLKIVPGHAVMLAADAVSAESVS |
| Ga0187774_108817851 | 3300018089 | Tropical Peatland | FTFTAGATSFGAGSGSRGSLADLKIVPGRAVMLAAGAISAEAVS |
| Ga0210407_113955421 | 3300020579 | Soil | DSGGNAFTFAVGATSFGTGSGSRGSLADLKIVPGHAVMLAAGAISAEAVS |
| Ga0210393_113317361 | 3300021401 | Soil | TFGAGAVGFGSGSGSRGSLDDLKIVPGRAVMLAAGAVSAEAVS |
| Ga0210385_102269511 | 3300021402 | Soil | SGDAFTFSAGATSFGTGSGSLGSLGGLKIVPGHAVMLASDAISTEPVS |
| Ga0210383_106166962 | 3300021407 | Soil | ATSFGTGSGSLGSLGGLKIVPGKAVLLAGDAVYTEPVS |
| Ga0210392_104938901 | 3300021475 | Soil | SGGNAFTFAAGATSFGTGSGSRGSLADLKIVPGRAAMLAANAVSTETAN |
| Ga0210402_103702371 | 3300021478 | Soil | FGTGSGSRGSLADLKIVPGRAVMLAAGAVSAETVN |
| Ga0210409_109515682 | 3300021559 | Soil | TSFGAGSGSRGSLADLKIVPGHAVMLAAGAVSAQTVS |
| Ga0126371_138256861 | 3300021560 | Tropical Forest Soil | FGAGAASFGPAGGSRGSPADLKIVPGLALMLATGAVSAETAS |
| Ga0207699_103189942 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AFTFTAGATSFGTGSGSHTSLGDLKIVPGRAVLLAADAVSAEPVS |
| Ga0207693_113213312 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DSGGNAFTFAAGATSFGTGSGSRGSLADLKIVPGHAVMLAAGAVSAEAVS |
| Ga0207700_118992351 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GATSFGAGSGSRGSLADLKIVPGHAVMLAAGAVSAEAVS |
| Ga0257156_10971402 | 3300026498 | Soil | AFTFAAGATSFGTGSGSRGSLADLKIVPGRAAMLAAGAVSAEAVS |
| Ga0209056_103487881 | 3300026538 | Soil | DSGGNAFTFAAGVTSFGTGSGSRGSLDDLKIVPGHAVMLAAGTVSAETVN |
| Ga0209465_103771981 | 3300027874 | Tropical Forest Soil | SGGNAFTFGAGATGFGTGSGSRGSLGDLKIVPGRAVMLAAGAVSAETVT |
| Ga0209275_106401801 | 3300027884 | Soil | AFTFSAGATSFGTGSGSLGSLADLKIVPGQAVMLAGDAVSAEPVS |
| Ga0209380_103242791 | 3300027889 | Soil | TTGNAFTFTAGATSFGTGSGSHTSLADLKIVPGQAVLLAADAVSAEPVS |
| Ga0209698_111517831 | 3300027911 | Watersheds | DSTGNAFTFTAGATSFGTGSGSHTSLADLKIVPGQAVMLAADAISAEPVS |
| Ga0308309_112786612 | 3300028906 | Soil | NAFTFTAGAASFGTGSGSHTSLGDLKIVPGQAVLLAADAVSAEPVS |
| Ga0311353_103861541 | 3300030399 | Palsa | TFTAGATSFGTGSGSHTSLADLKIVPGQAVLLAADAVSAEPVS |
| Ga0318516_103698761 | 3300031543 | Soil | TSFGTGSGSRGSLADLKIVPGHAVMLAAGAVSAETVN |
| Ga0318534_105025972 | 3300031544 | Soil | LEDWAASTAFTFGAGAASFGPGSGPRGSLADLKIVPGLAVMLAAGAVSAQAVT |
| Ga0318534_108302402 | 3300031544 | Soil | FAAGATSFGTGSGSRGSLGDLKIVPGRAVMLAAGAVSTEAVS |
| Ga0318528_107924722 | 3300031561 | Soil | AAGATSFGTGSGSRGSLGDLKIVPGRAVMLAAGAVSTQTVT |
| Ga0318515_104697412 | 3300031572 | Soil | ATSFGAGSGSRGSLGDLKIVPGRAVMLAAGAVSTEAVS |
| Ga0318555_104825352 | 3300031640 | Soil | FGTGSGPRGTLADLKIVPGLAVMLAAGGVSAEAVT |
| Ga0318542_101905591 | 3300031668 | Soil | VHGLGRDGPGSGSRGSLADLKIVPGRAVMLAAGAVSTETVN |
| Ga0318574_100280191 | 3300031680 | Soil | ATAFGTGSGSRGSLDDLKIVPGHAVMLAGGAVSAEPVS |
| Ga0318574_108790301 | 3300031680 | Soil | AGATSFGTGSGSRGSLADLKIVPGHAVMLAADAVSAETVN |
| Ga0318560_103042572 | 3300031682 | Soil | FGAGSGSRGSLADLKIVPGHAVMLAAGAVSAETVN |
| Ga0318560_104208322 | 3300031682 | Soil | AFTFGAGATAFGTGSGSRGSLDDLKIVPGHAVMLAGGAVSAEPVS |
| Ga0310686_1033430251 | 3300031708 | Soil | TGNAFTFTAGATSFGTGSGSHTSLGGLKIVPGQAVLLASDAVSAEPVS |
| Ga0310686_1109072144 | 3300031708 | Soil | FTFTAGATSFGTGSGSHTSLADLKIVPGQAVMLAANAVSAEPVS |
| Ga0310686_1123345051 | 3300031708 | Soil | TFTAGATSFGTGSGSHGGLADLKIVPGQAVLLAADAVSAEPVS |
| Ga0318496_103299372 | 3300031713 | Soil | AAGVTSFGAGSGSRGSLGDLKIVPGRVVMLAANAVSTETVT |
| Ga0318496_108065312 | 3300031713 | Soil | GNAFTFAADATSFGTGSGSRGSLADLKIVPGHAVMLAAGAVSAEAVS |
| Ga0306917_112822231 | 3300031719 | Soil | FAAGATSFGAGSGSRGSLADLKIVPGLAVMLAAGAVSAETVT |
| Ga0307469_101190054 | 3300031720 | Hardwood Forest Soil | AGATGFGTGSGSRGSLADLKIVPGHAAMLAAGAISAEAVS |
| Ga0318493_107906411 | 3300031723 | Soil | GATSFGAGSGSRGSLADLKIVPGLAVMLAAGAVSAETVN |
| Ga0318500_101995741 | 3300031724 | Soil | TSFGAGSGSRGSLDDLKIVPGQAVMLAAGAMSAESVT |
| Ga0318501_101858471 | 3300031736 | Soil | NAFTFAAGAASFGTGSGSRGSLDDLKIAPGRAAMLAAGAVSAETVN |
| Ga0318494_103595122 | 3300031751 | Soil | GGNAFTFAAGATSFGTGSGSRGSLADLKIVPGHAVMLAAGAVSAETVN |
| Ga0318521_101480333 | 3300031770 | Soil | FGAGSGSRGSLADLKIVPGLAVMLAAGAVSAETVN |
| Ga0318546_103147892 | 3300031771 | Soil | ADSGGTAFTFGAGAASFGPGSGPRGSLADLKIVPGLAVMLAAGAVSAQAVT |
| Ga0318546_108503501 | 3300031771 | Soil | ASFGAGSGSRGSLDDLKIVPGRAVLLAAGAVSTETVT |
| Ga0318543_101580142 | 3300031777 | Soil | TAFGTGSGSRGSLDDLKIVPGHAVMLAGGAVSAEPVS |
| Ga0318529_102368151 | 3300031792 | Soil | TFAAGVTSFGAGSGSRGSLGDLKIVPGRVVMLAANAVSTETVT |
| Ga0318548_102862441 | 3300031793 | Soil | ASFGPGSGSRGSLADLKIVPGQAVMLAAGAVSAEAVS |
| Ga0318550_104535172 | 3300031797 | Soil | AGATSFGAGSGSRGSLGDLKIVPGRAVMLAAGAVSTEAVS |
| Ga0318497_102324602 | 3300031805 | Soil | FTFAAGAASFGAGSGSRGSLGDLKIVPGQAVMLAADAVSAETVT |
| Ga0318497_104138452 | 3300031805 | Soil | FGAGSGSRGSLADLKIVPGLAVMLAAGAVSAETVT |
| Ga0318512_105536872 | 3300031846 | Soil | SFGAGSGSRGSLGDLKIVPGRAVLLAAGAVSTETVT |
| Ga0318527_101629562 | 3300031859 | Soil | TFSAGAASFGAGSGPRGSLGDLKIVPGRAVMLAAGAVSTETVT |
| Ga0318527_101981262 | 3300031859 | Soil | FTFGAGATAFGTGSGSRGSLDDLKIVPGHAVMLAGGAVSAEPVS |
| Ga0306919_102319821 | 3300031879 | Soil | SFGAGSGSRGSLDDLKIVPGQAVMLAAGAMSAESVT |
| Ga0318536_106560142 | 3300031893 | Soil | FGTGSGSRGSLADLKIVPGHAVMLAADAVSAETVN |
| Ga0318520_100024581 | 3300031897 | Soil | AASFGTGSGSRGSLDDLKIAPGRAVMLAAGAVSAETVN |
| Ga0318520_100566304 | 3300031897 | Soil | SFGAGSGSRGSLADLKIVPGLAVMLAAGAVSAETVN |
| Ga0318520_107830673 | 3300031897 | Soil | AFTFGAGAASFGPGSGPRGSLADLKIVPGLAVMLAAGAVSAQAVT |
| Ga0318520_109646791 | 3300031897 | Soil | GGYGAASFGTGSGSRGSLADLKIIPGRAVMLAVGAVSTETVT |
| Ga0306921_108445823 | 3300031912 | Soil | FTFAAGASSFGVGSGSRGSLADLKIVPGLAVMLAAGAVSAETVT |
| Ga0310912_114168092 | 3300031941 | Soil | SGGNAFTFAAGATSFGVGSGSRGSLADLKIVPGLAVMLAAGAVSAEAVS |
| Ga0310913_108224432 | 3300031945 | Soil | AGAASFGTGSGSRGSLADLKIVPGLAVMLAAGAVSAETVT |
| Ga0310910_105260911 | 3300031946 | Soil | SGADAFTFGAGAASFGPGSGSRGSLADLKIAPGIAVMLATGAVSAETVN |
| Ga0310909_109893841 | 3300031947 | Soil | FTFGAGAASFGPGSESRGSLADLKIVPGLAVMLAAGAVSAEAVS |
| Ga0318563_106055481 | 3300032009 | Soil | FGAGSGSRGSLGDLKIVPGQAVMLAADAVSAETVN |
| Ga0318569_101067242 | 3300032010 | Soil | AAGATSFGVGSGSRGSLADLKIVPGLAVMLAAGAVSAEAVS |
| Ga0318559_102420772 | 3300032039 | Soil | FGAGAASFGIGSGPRGSLADLKIVPGLAVMLAAGAVSAQAVT |
| Ga0318549_101405733 | 3300032041 | Soil | GNAFTFAAGATSFGAGSGSRGSLADLKIVPGLAVMLAAGAVSAETVN |
| Ga0318549_103479871 | 3300032041 | Soil | TFGAGATSFGTGSGPRGTLADLKIVPGLAVMLAAGGVSAEAVT |
| Ga0318506_101810932 | 3300032052 | Soil | AGATSFGTGSGSRGSLADLKIVPGHAVMLAAGAVSAETVN |
| Ga0318505_104630081 | 3300032060 | Soil | AFTFGAGATAFGPGSGSRGSLDDLKIVPGRAVMLAGGAVSTEPVS |
| Ga0318524_104580561 | 3300032067 | Soil | DVFTFGAGAASFGPGSGSRGSLADLKIVPGLAVMLATGAVSAETVS |
| Ga0318553_101125701 | 3300032068 | Soil | AVATELEDWAASTAFTFGAGAASFGPGSGPRGSLADLKIVPGLAVMLAAGAVSAQAVT |
| Ga0318518_102380852 | 3300032090 | Soil | ATSFGAGSGSRGSLADLKIVPGHAVMLAGDAVSAQTVN |
| Ga0318577_102536781 | 3300032091 | Soil | AGATSFGAGSGSRGSLADLKIVPGHAVMLAADAVSAQTVN |
| Ga0318577_106443081 | 3300032091 | Soil | SFGTGSGSRGSLADLKIVPGHAVMLAADAVSAETVN |
| Ga0318540_103355752 | 3300032094 | Soil | AGATAFGTGSGSRGSLDDLKIVPGHAVMLAGGAVSAEPVS |
| Ga0307471_1017573482 | 3300032180 | Hardwood Forest Soil | FGTGSGSRGSLADLKIVPGHAAMLAAGAISAEAVS |
| Ga0310914_116261502 | 3300033289 | Soil | GADAFTFGAGAVSFGPGSGSRGSLADLKIAPGIAVMLATGTVSAEPVN |
| Ga0370515_0166003_1_156 | 3300034163 | Untreated Peat Soil | ADTTGNAFTFTAGATSFGTGSGSHTSLGDLKIVPGQAVLLAADAVSAEPVS |
| ⦗Top⦘ |