Basic Information | |
---|---|
Family ID | F069250 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 124 |
Average Sequence Length | 43 residues |
Representative Sequence | MDIKRPPKSKIKKKIRNAVMIVVGLAAIGGITYGLTKLKPAL |
Number of Associated Samples | 103 |
Number of Associated Scaffolds | 124 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 31.45 % |
% of genes near scaffold ends (potentially truncated) | 98.39 % |
% of genes from short scaffolds (< 2000 bps) | 92.74 % |
Associated GOLD sequencing projects | 98 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (60.484 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.484 % of family members) |
Environment Ontology (ENVO) | Unclassified (48.387 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (58.065 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 124 Family Scaffolds |
---|---|---|
PF13620 | CarboxypepD_reg | 2.42 |
PF12686 | DUF3800 | 2.42 |
PF02446 | Glyco_hydro_77 | 2.42 |
PF05593 | RHS_repeat | 1.61 |
PF11075 | DUF2780 | 1.61 |
PF00248 | Aldo_ket_red | 1.61 |
PF03061 | 4HBT | 0.81 |
PF15902 | Sortilin-Vps10 | 0.81 |
PF04977 | DivIC | 0.81 |
PF13437 | HlyD_3 | 0.81 |
PF02687 | FtsX | 0.81 |
PF04679 | DNA_ligase_A_C | 0.81 |
PF13520 | AA_permease_2 | 0.81 |
PF00797 | Acetyltransf_2 | 0.81 |
PF12700 | HlyD_2 | 0.81 |
PF13692 | Glyco_trans_1_4 | 0.81 |
PF01740 | STAS | 0.81 |
PF09335 | SNARE_assoc | 0.81 |
PF03601 | Cons_hypoth698 | 0.81 |
PF13637 | Ank_4 | 0.81 |
PF00149 | Metallophos | 0.81 |
PF02502 | LacAB_rpiB | 0.81 |
PF00072 | Response_reg | 0.81 |
COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
---|---|---|---|
COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 2.42 |
COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 1.61 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.81 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
COG0698 | Ribose 5-phosphate isomerase RpiB | Carbohydrate transport and metabolism [G] | 0.81 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.81 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.81 |
COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.81 |
COG2919 | Cell division protein FtsB | Cell cycle control, cell division, chromosome partitioning [D] | 0.81 |
COG4839 | Cell division protein FtsL | Cell cycle control, cell division, chromosome partitioning [D] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 60.48 % |
All Organisms | root | All Organisms | 39.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918013|NODE_2093_length_1841_cov_6.021184 | All Organisms → cellular organisms → Bacteria | 1873 | Open in IMG/M |
3300000881|JGI10215J12807_1058026 | Not Available | 546 | Open in IMG/M |
3300003203|JGI25406J46586_10005224 | All Organisms → cellular organisms → Bacteria | 6020 | Open in IMG/M |
3300003319|soilL2_10019874 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
3300004156|Ga0062589_100439592 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
3300004156|Ga0062589_101474184 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300004782|Ga0062382_10300582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300005174|Ga0066680_10289520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
3300005290|Ga0065712_10829376 | Not Available | 503 | Open in IMG/M |
3300005295|Ga0065707_10378118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300005336|Ga0070680_101212407 | Not Available | 653 | Open in IMG/M |
3300005343|Ga0070687_100494267 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 822 | Open in IMG/M |
3300005343|Ga0070687_100552270 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
3300005353|Ga0070669_100396319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1128 | Open in IMG/M |
3300005438|Ga0070701_10566893 | Not Available | 747 | Open in IMG/M |
3300005440|Ga0070705_101420921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 579 | Open in IMG/M |
3300005445|Ga0070708_102160833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 514 | Open in IMG/M |
3300005468|Ga0070707_101592445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 620 | Open in IMG/M |
3300005518|Ga0070699_100005772 | All Organisms → cellular organisms → Bacteria | 10831 | Open in IMG/M |
3300005518|Ga0070699_101559405 | Not Available | 605 | Open in IMG/M |
3300005546|Ga0070696_101923009 | Not Available | 513 | Open in IMG/M |
3300005617|Ga0068859_100264015 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
3300005618|Ga0068864_101284423 | Not Available | 732 | Open in IMG/M |
3300005840|Ga0068870_10300728 | Not Available | 1013 | Open in IMG/M |
3300005843|Ga0068860_100119637 | All Organisms → cellular organisms → Bacteria | 2521 | Open in IMG/M |
3300005844|Ga0068862_101091632 | Not Available | 793 | Open in IMG/M |
3300006173|Ga0070716_100560906 | Not Available | 853 | Open in IMG/M |
3300006755|Ga0079222_10174930 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300006797|Ga0066659_11478541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter → Gloeobacter kilaueensis | 568 | Open in IMG/M |
3300009089|Ga0099828_11714120 | Not Available | 552 | Open in IMG/M |
3300009098|Ga0105245_11605332 | Not Available | 702 | Open in IMG/M |
3300009137|Ga0066709_103416722 | Not Available | 577 | Open in IMG/M |
3300009143|Ga0099792_10537621 | Not Available | 737 | Open in IMG/M |
3300009148|Ga0105243_12479396 | Not Available | 558 | Open in IMG/M |
3300009174|Ga0105241_10669986 | Not Available | 944 | Open in IMG/M |
3300009174|Ga0105241_12170809 | Not Available | 550 | Open in IMG/M |
3300009176|Ga0105242_12277670 | Not Available | 588 | Open in IMG/M |
3300009177|Ga0105248_11027385 | Not Available | 931 | Open in IMG/M |
3300009177|Ga0105248_11889517 | Not Available | 677 | Open in IMG/M |
3300009177|Ga0105248_12750994 | Not Available | 561 | Open in IMG/M |
3300010036|Ga0126305_11252025 | Not Available | 512 | Open in IMG/M |
3300010041|Ga0126312_11048250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300010044|Ga0126310_10030473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2825 | Open in IMG/M |
3300010045|Ga0126311_10002373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 9427 | Open in IMG/M |
3300010045|Ga0126311_10259156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1294 | Open in IMG/M |
3300010047|Ga0126382_10104076 | All Organisms → cellular organisms → Bacteria | 1842 | Open in IMG/M |
3300010047|Ga0126382_11968349 | Not Available | 555 | Open in IMG/M |
3300010303|Ga0134082_10282310 | Not Available | 693 | Open in IMG/M |
3300010366|Ga0126379_11347565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
3300010366|Ga0126379_12607805 | Not Available | 603 | Open in IMG/M |
3300010373|Ga0134128_12575783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
3300010397|Ga0134124_11441414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300010398|Ga0126383_10943699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
3300010399|Ga0134127_10298989 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
3300010399|Ga0134127_10702193 | Not Available | 1052 | Open in IMG/M |
3300010399|Ga0134127_12795329 | Not Available | 568 | Open in IMG/M |
3300010399|Ga0134127_12917437 | Not Available | 557 | Open in IMG/M |
3300010401|Ga0134121_10755558 | Not Available | 929 | Open in IMG/M |
3300010403|Ga0134123_12636464 | Not Available | 570 | Open in IMG/M |
3300011003|Ga0138514_100127496 | Not Available | 561 | Open in IMG/M |
3300012010|Ga0120118_1162636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Gloeobacteria → Gloeobacterales → Gloeobacteraceae → Gloeobacter | 531 | Open in IMG/M |
3300012200|Ga0137382_11130161 | Not Available | 559 | Open in IMG/M |
3300012203|Ga0137399_11038305 | Not Available | 690 | Open in IMG/M |
3300012203|Ga0137399_11256040 | Not Available | 623 | Open in IMG/M |
3300012207|Ga0137381_11252804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 635 | Open in IMG/M |
3300012208|Ga0137376_10928193 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomicrobium → Planctomicrobium piriforme | 747 | Open in IMG/M |
3300012351|Ga0137386_10072398 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
3300012361|Ga0137360_11107555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 684 | Open in IMG/M |
3300012922|Ga0137394_11195240 | Not Available | 624 | Open in IMG/M |
3300012929|Ga0137404_11842659 | Not Available | 563 | Open in IMG/M |
3300012929|Ga0137404_12262409 | Not Available | 508 | Open in IMG/M |
3300012944|Ga0137410_11969627 | Not Available | 519 | Open in IMG/M |
3300012948|Ga0126375_10672949 | Not Available | 802 | Open in IMG/M |
3300012948|Ga0126375_11047370 | Not Available | 668 | Open in IMG/M |
3300012976|Ga0134076_10238331 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
3300013100|Ga0157373_10678259 | Not Available | 754 | Open in IMG/M |
3300013100|Ga0157373_10970210 | Not Available | 633 | Open in IMG/M |
3300013297|Ga0157378_11134462 | Not Available | 820 | Open in IMG/M |
3300013308|Ga0157375_12543881 | Not Available | 611 | Open in IMG/M |
3300013308|Ga0157375_12900168 | Not Available | 573 | Open in IMG/M |
3300013308|Ga0157375_13215396 | Not Available | 545 | Open in IMG/M |
3300014166|Ga0134079_10410370 | Not Available | 632 | Open in IMG/M |
3300014326|Ga0157380_13452716 | Not Available | 506 | Open in IMG/M |
3300014875|Ga0180083_1120283 | Not Available | 579 | Open in IMG/M |
3300015374|Ga0132255_106326977 | Not Available | 501 | Open in IMG/M |
3300017789|Ga0136617_10223206 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
3300018476|Ga0190274_12071835 | Not Available | 665 | Open in IMG/M |
3300018481|Ga0190271_12591766 | Not Available | 608 | Open in IMG/M |
3300018920|Ga0190273_10830947 | Not Available | 738 | Open in IMG/M |
3300019377|Ga0190264_11854874 | Not Available | 545 | Open in IMG/M |
3300019458|Ga0187892_10007390 | All Organisms → cellular organisms → Bacteria | 15686 | Open in IMG/M |
3300019886|Ga0193727_1197439 | Not Available | 505 | Open in IMG/M |
3300020060|Ga0193717_1030099 | All Organisms → cellular organisms → Bacteria | 2135 | Open in IMG/M |
3300021418|Ga0193695_1106993 | Not Available | 595 | Open in IMG/M |
3300025903|Ga0207680_10884119 | Not Available | 640 | Open in IMG/M |
3300025904|Ga0207647_10737048 | Not Available | 534 | Open in IMG/M |
3300025918|Ga0207662_10248765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1166 | Open in IMG/M |
3300025925|Ga0207650_10404206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
3300025933|Ga0207706_11507742 | Not Available | 548 | Open in IMG/M |
3300025934|Ga0207686_10440646 | Not Available | 1000 | Open in IMG/M |
3300025934|Ga0207686_11727707 | Not Available | 517 | Open in IMG/M |
3300025936|Ga0207670_11150081 | Not Available | 656 | Open in IMG/M |
3300025942|Ga0207689_10722824 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
3300025945|Ga0207679_11599024 | Not Available | 597 | Open in IMG/M |
3300025960|Ga0207651_10378425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
3300025960|Ga0207651_11314181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300026035|Ga0207703_10314131 | Not Available | 1433 | Open in IMG/M |
3300026035|Ga0207703_11755009 | Not Available | 597 | Open in IMG/M |
3300026041|Ga0207639_11595505 | Not Available | 612 | Open in IMG/M |
3300026078|Ga0207702_11737568 | Not Available | 616 | Open in IMG/M |
3300026095|Ga0207676_12305687 | Not Available | 536 | Open in IMG/M |
3300026118|Ga0207675_100982724 | Not Available | 862 | Open in IMG/M |
3300027603|Ga0209331_1115590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300027840|Ga0209683_10273776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
3300028381|Ga0268264_10006905 | All Organisms → cellular organisms → Bacteria | 9529 | Open in IMG/M |
3300028802|Ga0307503_10308479 | Not Available | 797 | Open in IMG/M |
3300030510|Ga0268243_1040991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
3300030991|Ga0073994_11245504 | Not Available | 565 | Open in IMG/M |
3300031469|Ga0170819_10945217 | Not Available | 575 | Open in IMG/M |
3300031720|Ga0307469_11196137 | Not Available | 718 | Open in IMG/M |
3300031901|Ga0307406_10594121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300031911|Ga0307412_11940318 | Not Available | 544 | Open in IMG/M |
3300031962|Ga0307479_10402351 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300032180|Ga0307471_102562898 | Not Available | 646 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.45% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 6.45% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.65% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.03% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.03% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.23% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.23% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.42% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.42% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.61% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.61% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.81% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.81% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.81% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.81% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.81% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.81% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Iowa-Corn-GraphCirc_00742970 | 2140918013 | Soil | MDIKRPAKSKVKKRIRTAALIAVGVAAIGGITFGLTRLKPAAPTLXXXXXXX |
JGI10215J12807_10580261 | 3300000881 | Soil | MDIKRPAKSKVKKRIRTGALVAVGVAAIGGITFGLT |
JGI25406J46586_100052244 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MDIKRAPKSKIKKNIRTIIMIVVGXAAIGGITYGLTKLKPA |
soilL2_100198743 | 3300003319 | Sugarcane Root And Bulk Soil | MDIKRPPKSKIKKKIRNVIMIVVGIAAIGGITYGLTKLKPA |
Ga0062589_1004395921 | 3300004156 | Soil | MDIKRPPKSKVKKRIRTGALVAIGVAAIGGITFGLTRLKPAAP |
Ga0062589_1014741841 | 3300004156 | Soil | MDIKRTPKSKLKKRIRTTALIVIGVVAIGGITYGLSKMKPA |
Ga0062382_103005821 | 3300004782 | Wetland Sediment | MDIKRPGKSKSKRVIRIVVLVVVGAAAIGGITYGLTKLKP |
Ga0066680_102895202 | 3300005174 | Soil | MDIKRPAKSKLKRRIRNAVLIVIGLGAIGGITFGLTKLKPAAPTLD |
Ga0065712_108293761 | 3300005290 | Miscanthus Rhizosphere | MDIKRTPKSKIKKKIRNAVMIVVGVAALGGITYGLTKLKPAAPTLDPSTA |
Ga0065707_103781181 | 3300005295 | Switchgrass Rhizosphere | MDIKRPPKSKIKKKIKMAILIVVGLIAVGGITYALAKLKPA |
Ga0070680_1012124072 | 3300005336 | Corn Rhizosphere | MDIKRTPKSKIKKKIRNGVMIVVGVAALGGITYGLTKLKPAAPTLDP |
Ga0070687_1004942671 | 3300005343 | Switchgrass Rhizosphere | MDIKRSPKSKLKKRIRTAVLIVIGVAAIAGITYGLSKMKP |
Ga0070687_1005522701 | 3300005343 | Switchgrass Rhizosphere | MDIKRPPKSKIKKKIRTALMIVIGIAAIGGITYGLTKLKPAA |
Ga0070669_1003963192 | 3300005353 | Switchgrass Rhizosphere | MDIKRTGKSKLKKRVRSGILIAVGLIAVGGITFGLTRLKPAAPTLDRSTAVI |
Ga0070701_105668932 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MVDIKRTGKSKLKKRIRSVVLIVVGVAAIGGITFGLSRLERAAPTLDRST |
Ga0070705_1014209211 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIKRPPKSKIKKKIRNVIMIVVGIAAIGGITYGLTKLKPAA |
Ga0070708_1021608331 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIKRTPKSKLKKRLRTGVLILVGLAAIGGITYGLAKMKPAAPTLDR |
Ga0070707_1015924451 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIKRPPKSKIKKKIRNAVMIVVGLAAIGGITYGLTKLKPAL |
Ga0070699_1000057727 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIKRPPKSKLKKKIRNAGMIVVGVAALGGITYGLTKLKPAAP |
Ga0070699_1015594051 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIKRSPKSKLKKRIRMAALITIGLAAVGGITYGLAKMKP |
Ga0070696_1019230091 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIKRPPKSKIKKKIKTAILIVVGLAALGGITYGLAKLKP |
Ga0068859_1002640151 | 3300005617 | Switchgrass Rhizosphere | MDIKRPGKSKLKKRIRNTVLIVIGLVAVGGITYGL |
Ga0068864_1012844231 | 3300005618 | Switchgrass Rhizosphere | MDIKRTGKSKLKKRVRSGILIAVGLIAVGGITFGLTRLKPAAPTLDRSTAV |
Ga0068870_103007281 | 3300005840 | Miscanthus Rhizosphere | MDIKRPPKSKLKKKIRTVILAVVGVAAIGGITYALA |
Ga0068860_1001196374 | 3300005843 | Switchgrass Rhizosphere | MDIKRAPKSKIKKKIRNAIMIVVGIAAIGGITYGLTKLK |
Ga0068862_1010916321 | 3300005844 | Switchgrass Rhizosphere | MDIKRAPKSKIKKKIRNAVMIVVGLAAIGGITYGLTKLKPAAPTLDA |
Ga0070716_1005609061 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MDIKRPGKSKFKKRFRTAVVILVGLMAIGGITFGLAKLKP |
Ga0079222_101749301 | 3300006755 | Agricultural Soil | MDIKRPAKSKLKKRIRTAVLIVIGLVAIGGITYGLSKMKPAAPTL |
Ga0066659_114785411 | 3300006797 | Soil | MDIKRTPKSKLKKRIRTGVLILVGLAAIGGITYGLAKMKPAAPTLDRS |
Ga0099828_117141201 | 3300009089 | Vadose Zone Soil | MDIKRPAKSKIKKRIRTLIIIFLGLVAVGGITFGLTKLKPAAPTLD |
Ga0105245_116053321 | 3300009098 | Miscanthus Rhizosphere | MDIKRTPKSKIKKKIRNAAMIVIGVAALGGITYGLTKLKPAAPTLDPS |
Ga0066709_1034167221 | 3300009137 | Grasslands Soil | MDIKRPAKSKIKKRIRNGMLIVIGVAALGGITYGLSKMKPA |
Ga0099792_105376211 | 3300009143 | Vadose Zone Soil | MDIKRPGKSKLKRRIRTGILVAIGLAAVGGITFVLAKLKPAAPTLDR |
Ga0105243_124793961 | 3300009148 | Miscanthus Rhizosphere | MVDIKRTGKSKLKKRIRSIVLIVIGVAAIGGITFGLSRL |
Ga0105241_106699861 | 3300009174 | Corn Rhizosphere | MDIKRPPKSKLKKKVRTAIMIVVGLAAVGGITYGLTK |
Ga0105241_121708091 | 3300009174 | Corn Rhizosphere | MDIKRSPKSKLKKRIRTAVLIVIGVAAIAGITYGLSKMKPAA |
Ga0105242_122776702 | 3300009176 | Miscanthus Rhizosphere | MVDIKRTGKSKLKKRIRTIVLIVVGVVAIGGITFGLSRLERAAPTLDRSTAVIDT |
Ga0105248_110273851 | 3300009177 | Switchgrass Rhizosphere | MDIKRAPKSKIKKKIRTAIMIVVGIAAIGGITYGLTKLKPAAPTL |
Ga0105248_118895171 | 3300009177 | Switchgrass Rhizosphere | MDIKRTPKSKIKKKIRNAVMIVVGVAALGGITYGLTKLKPAAPTL |
Ga0105248_127509941 | 3300009177 | Switchgrass Rhizosphere | MDIKRAPKSKIKKRIRNGVFIAIGVAAIGGITYGLSKMKPAAPTLDR |
Ga0126305_112520251 | 3300010036 | Serpentine Soil | MDIKRAPKSKIKKKIRNAVMIVIGVAALAGITYGLTKL |
Ga0126312_110482501 | 3300010041 | Serpentine Soil | MDIKRPPKSKIKKKIKMGILIVVGLIAVGGITYALAKLKPAA |
Ga0126310_100304735 | 3300010044 | Serpentine Soil | MDIKRPPKSKIKKKIRTALMIVIGLAAIGGITYGL |
Ga0126311_100023731 | 3300010045 | Serpentine Soil | MDIKRAPKSKIKKKIRNAIMIVVGLAAIGGITYGLTK |
Ga0126311_102591562 | 3300010045 | Serpentine Soil | MDIKRPPKSKIKKKIRNAVMIVIGLAAIGGITYGLTKLKP |
Ga0126382_101040762 | 3300010047 | Tropical Forest Soil | MDIKRPAKSKIKKKIRTAIFIVIGVPAIGGITYGLAKLQPALPTVDRA |
Ga0126382_119683491 | 3300010047 | Tropical Forest Soil | MDIKRPPKSKIKKKIKNAIMIVVGVAAIGGITYGLT |
Ga0134082_102823101 | 3300010303 | Grasslands Soil | MDIKRTPKSKLKKRIRTGVLILVGLAAIGGITYGLAKMKPAAPTLDRST |
Ga0126379_113475652 | 3300010366 | Tropical Forest Soil | MDIQRSPKSKLKKRIRTGAFALVGVTAIGGITLGLTRLKVAAPTLDRSTAIIDTV |
Ga0126379_126078053 | 3300010366 | Tropical Forest Soil | MDIKRPPKSKIKKRIRNAVLIVIGVAAIGGITYGLSKMKP |
Ga0134128_125757831 | 3300010373 | Terrestrial Soil | MDIKRTGKSKLKKRVRSGILIAVGLIAVGGITFGLTRLKPAAPTLDRST |
Ga0134124_114414141 | 3300010397 | Terrestrial Soil | MVDIKRTGKSKLKKRIRSIVLIVIGVEAIGGITFGLSRL |
Ga0126383_109436991 | 3300010398 | Tropical Forest Soil | MDIKRPPKSKIKKRIRTCLLIVIGVVAIGRITYGLSKMKPAAPTIGRS |
Ga0134127_102989891 | 3300010399 | Terrestrial Soil | MDIKRPPKSKLKKKIRTVILAVVGVAAIGGITYALAKIKPAAPT |
Ga0134127_107021932 | 3300010399 | Terrestrial Soil | MDIKRPAKSKLKKRARMGIMIGAGVLAIGAVTFGLAKLKPASPTLDRQTAVFG |
Ga0134127_127953291 | 3300010399 | Terrestrial Soil | MVDIKRTGKSKLKKRIRTIVLIVVGVVAIGGITFGLSRLERAA |
Ga0134127_129174372 | 3300010399 | Terrestrial Soil | MDIKRAPKSKIKKKIRNAVMIVVGLAGIGGITYGLTKLKPAAPTLDPST |
Ga0134121_107555581 | 3300010401 | Terrestrial Soil | MDIKRTPKSKIKKKIRNAVMIVVGVAALGGITYGLTKLKPAA |
Ga0134123_126364641 | 3300010403 | Terrestrial Soil | MVDIKRTGKSKLKKRIRSIVLIVIGVAAIGGITFGLSRLERAAPT |
Ga0138514_1001274961 | 3300011003 | Soil | MDIKRTGKSKVKKRIRTVLLIVVGLVAVGGITYGLTKLKPAAPTLE |
Ga0120118_11626361 | 3300012010 | Permafrost | MDIKRPAKSKLKKRIRTVVFIVIGLAAIVGITFGLTRLNPAAPTLDRSTAVIDTVK |
Ga0137382_111301611 | 3300012200 | Vadose Zone Soil | MDIKRTPKSKLKKRIRTGLLILVGLAAIGGITYGLAKMKPAA |
Ga0137399_110383051 | 3300012203 | Vadose Zone Soil | MDIKRPGKSKLKRRIRTGILVAMGLAAVGGITFVLAKLKP |
Ga0137399_112560401 | 3300012203 | Vadose Zone Soil | MDIKRPGKSKLKKRIRIGILVVIGLGAVGGITFVLAKLKPAAPTLDRS |
Ga0137381_112528042 | 3300012207 | Vadose Zone Soil | MDIKRSGKSKIKKRVRTSILLVAGLAAAGGITIVLAKLKPAAPTL |
Ga0137376_109281933 | 3300012208 | Vadose Zone Soil | MDIKRTAKSKVKKRIRTAILILVGLIAVGGITFALAKL |
Ga0137386_100723981 | 3300012351 | Vadose Zone Soil | MDIKRPPKSKLKKRIRTAVLLVLGLIAVGGITYALAKLKPAA |
Ga0137360_111075551 | 3300012361 | Vadose Zone Soil | MDIKRTPKSKLKKRARTGVLILVGLAAIGGITYGLAK |
Ga0137394_111952401 | 3300012922 | Vadose Zone Soil | MDIKRPGKSKLKKRIRMGILVVIGLGAVGGITFVLAKLKPAAPTLDRSAA |
Ga0137404_118426591 | 3300012929 | Vadose Zone Soil | MDIKRTPKSKLKKRARTGVLILVGLAAIGGITYGLAKMKPAA |
Ga0137404_122624092 | 3300012929 | Vadose Zone Soil | MVDIKRTGKSKLKKRIRSIVLIVIGVAAIGGITFGLSRLERA |
Ga0137410_119696271 | 3300012944 | Vadose Zone Soil | MDIKRPAKSKLKKRLRTGSLIVVGLAAVGGSTFGLAKLKPAAPTL |
Ga0126375_106729491 | 3300012948 | Tropical Forest Soil | MDIKRPAKSKLKKRIRTVLLIIMGLAAVGGITYAL |
Ga0126375_110473702 | 3300012948 | Tropical Forest Soil | MDIKRPAKSKIKKKIRTAIFIVIGVAAIGGITYGLAKLQP |
Ga0134076_102383312 | 3300012976 | Grasslands Soil | MDIKRTPKSKLNKRIRTAVLLVLGVIAVGGITYALAKLKP |
Ga0157373_106782592 | 3300013100 | Corn Rhizosphere | MDIKRAPKSKIKKKIRTAVMIVIGLAGIGGITYGLTKL |
Ga0157373_109702101 | 3300013100 | Corn Rhizosphere | MDIKRAPKSKIKKKIRNGIMIVVGIAAIGGITYGLTKLKPAAPTLD |
Ga0157378_111344621 | 3300013297 | Miscanthus Rhizosphere | MDIKRAPKTKIKKRIRNGVFIAIGVAAIGGITYGLSKMKPAAPTLDRSTAIIG |
Ga0157375_125438811 | 3300013308 | Miscanthus Rhizosphere | MDIKRPPKSKLKKKIRTAIFIVIGVVGIGGITYGLSKLKPA |
Ga0157375_129001682 | 3300013308 | Miscanthus Rhizosphere | MDIKRPGKSKLKKRIRTAVLIVVGLVAVCGITYGLSKLKPAATT |
Ga0157375_132153961 | 3300013308 | Miscanthus Rhizosphere | MDIKRPPKSKIKKKIRTALMIVIGIAAIGGITYGLTKLK |
Ga0134079_104103701 | 3300014166 | Grasslands Soil | MDIKRSPKSKLRKRIRTGALIAGGVVAIGGITYGLSKMKPAAPTLDRSTA |
Ga0157380_134527161 | 3300014326 | Switchgrass Rhizosphere | MDIKRSGKSKLKKKVRTGILIAVGLIAVGGITFGLTKLKPASPTLDRSTAVI |
Ga0180083_11202831 | 3300014875 | Soil | MDIKRPAKSKFKKRLRTTVFIIVGLAAIGGITYGLTKLKPA |
Ga0132255_1063269771 | 3300015374 | Arabidopsis Rhizosphere | MDIKRTPKSKIKKKIRNAVMIVIGVAALGGITYGLTK |
Ga0136617_102232062 | 3300017789 | Polar Desert Sand | MDIKRPGKFKLKKRIRNATFIVAGLVAIGGITFVLARLKPASPT |
Ga0190274_120718351 | 3300018476 | Soil | MDIKRPPKSKIKKKIRNAVMIVVGIAAIGGITYGLTKLKP |
Ga0190271_125917661 | 3300018481 | Soil | MDIKRPPKSKIKKNIRMAIFIVIGVAGIGGITYGLAKLKPAAPTLD |
Ga0190273_108309472 | 3300018920 | Soil | MDIKRPAKSKIKKRIRSIALVVIGVAAIGGITFGLT |
Ga0190264_118548741 | 3300019377 | Soil | MDIKRPAKSKIKKRVRTGVLITVGLLAVGAVTIGLAKLKPA |
Ga0187892_100073901 | 3300019458 | Bio-Ooze | MDIKRPPKSKIKKRVRTAVLISLGVAAVGGITFGLAKLPRAAPTVD |
Ga0193727_11974391 | 3300019886 | Soil | MDIKRPGKSKLKKRIRTAILIIIGLGAVGGITFGLTKLKPAAP |
Ga0193717_10300993 | 3300020060 | Soil | MDIKRPGKSKLKKRIRNGVLIGAGLIAVGGITVGLTKLKPA |
Ga0193695_11069931 | 3300021418 | Soil | MVDIKRTGKSKLKKRVRTITLIVVGLIAVGGITFGLTKLKPAAPTL |
Ga0207680_108841191 | 3300025903 | Switchgrass Rhizosphere | MDIKRPPKSKIKKKIRTAILVVVGLVAVGGITYGLT |
Ga0207647_107370481 | 3300025904 | Corn Rhizosphere | MDIKRPPKSKLKKKIRTVILAVVGVAAIGGITYALAKIKP |
Ga0207662_102487651 | 3300025918 | Switchgrass Rhizosphere | MDIKRAPKSKIKKRIRNGVFIAIGVAAIGGITYGLSKMKPAAPTLDRSTAI |
Ga0207650_104042062 | 3300025925 | Switchgrass Rhizosphere | MDIKRPQKSKLKKKIRTAILIVVAVTGIGGITYGLSKLKP |
Ga0207706_115077421 | 3300025933 | Corn Rhizosphere | MDIKRSGKSKLKKKVRTGILIAVGLIAVGGITFGLTKLKPASPTLDRST |
Ga0207686_104406461 | 3300025934 | Miscanthus Rhizosphere | MVDIKRTGKSKLKKRIRSVVLIVVGVAAIGGITFGLSRLERAAPTLDRSTAVIDT |
Ga0207686_117277071 | 3300025934 | Miscanthus Rhizosphere | MDIKRSTKSKSRKRIRTGILIAVGLVAIAGITYGLAKMKPAAPTLDRATAVID |
Ga0207670_111500811 | 3300025936 | Switchgrass Rhizosphere | MDIKRAPKSKIKKKIRTAIMIVVGIAAIGGITYGLTKLK |
Ga0207689_107228242 | 3300025942 | Miscanthus Rhizosphere | MDIKRPGKSKLKKRIRNAVLIVIGLVAVGGITYGLSKLKPAA |
Ga0207679_115990241 | 3300025945 | Corn Rhizosphere | MDIKRTPKSKIKKKIRNAVMIVVGVAALGGITYGLTKLKPA |
Ga0207651_103784252 | 3300025960 | Switchgrass Rhizosphere | MDIKRPPKSKIKKKIRNAIMIVVGIAAIGGITYGLTKLKPA |
Ga0207651_113141812 | 3300025960 | Switchgrass Rhizosphere | MDIKRAPKSKIKKKIRNAVMIVVGVAALGGITYGLT |
Ga0207703_103141311 | 3300026035 | Switchgrass Rhizosphere | MDIKRPPKSKLKKKIRTAVMIVVGLAAIGGITYGL |
Ga0207703_117550092 | 3300026035 | Switchgrass Rhizosphere | MDIKRTPKSKIKKKIRNAAMIVIGVAALGGITYGLTKL |
Ga0207639_115955051 | 3300026041 | Corn Rhizosphere | MDIKRPPKSKIKKRIRTAVLTVVAVAAVGGITYALAK |
Ga0207702_117375681 | 3300026078 | Corn Rhizosphere | MDIKRAPKSKIKKKIRTAVMIVIGLAGIGGITYGLTKLKPAAP |
Ga0207676_123056871 | 3300026095 | Switchgrass Rhizosphere | MDIKRPPKSKIKKKIRTAILAVVGVAAIGGITYGLTKLKPAAP |
Ga0207675_1009827242 | 3300026118 | Switchgrass Rhizosphere | MDIKRPPKSKIKKKIRNAVMIVVGLAALGGITYGLTKLK |
Ga0209331_11155901 | 3300027603 | Forest Soil | MDIKRSGKAKLKKRIRSAILIAIGLVVVGGITFGVAKLRPA |
Ga0209683_102737761 | 3300027840 | Wetland Sediment | MDIKRPGKSKSKRVIRIVVLVVVGAAAIGGITYGLTKLKPA |
Ga0268264_100069051 | 3300028381 | Switchgrass Rhizosphere | MDIKRPPKSKIKKKIRNAIMIVVGIAAIGGITYGLTK |
Ga0307503_103084791 | 3300028802 | Soil | MDIKRPPKSKIKKKIRTAILAVVGIAAIGGITYVLAKLKPASPT |
Ga0268243_10409911 | 3300030510 | Soil | MDIKRPPKSKIKKKIRNAVMIVVGVAGLAGITYGLTKLKPAAPTLDPSTAVIE |
Ga0073994_112455042 | 3300030991 | Soil | MDIKRPAKSKLKKRLRTGGLIVIGLAAVGGITFGLAKLKPAAPT |
Ga0170819_109452171 | 3300031469 | Forest Soil | MDIKRPAKSKLKKRIRTAVLIVVGLAAVGGITYGLAKLKPVAPTLDRSTAVI |
Ga0307469_111961372 | 3300031720 | Hardwood Forest Soil | MDIKRSQKSKLKKRVRTGALIVLGLAAIGGITYGLAKMKPAAPTLDR |
Ga0307406_105941212 | 3300031901 | Rhizosphere | MDIKRPPKSKIKRKIRNAVMIVVGIAAIGGITYGLT |
Ga0307412_119403182 | 3300031911 | Rhizosphere | MDIKRPPKSKIKKKIRNAVMIVVGLAAIGGITYGLTKLK |
Ga0307479_104023511 | 3300031962 | Hardwood Forest Soil | MAEGTDGSRKSFMDIKRPAKSKLKKRIRVVVLVILLLAAVGGITYGLSKLHPAAPTLDRSSSVI |
Ga0307471_1025628981 | 3300032180 | Hardwood Forest Soil | MDIKRPAKSKLKKRIRTGVLILIGLAAVGGITFALAKMKPAAPTLDRSTAVIA |
⦗Top⦘ |