| Basic Information | |
|---|---|
| Family ID | F069249 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 40 residues |
| Representative Sequence | PEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.19 % |
| % of genes from short scaffolds (< 2000 bps) | 96.77 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.161 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.677 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.065 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.774 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF09587 | PGA_cap | 12.10 |
| PF01812 | 5-FTHF_cyc-lig | 8.06 |
| PF01169 | UPF0016 | 5.65 |
| PF09350 | DJC28_CD | 4.03 |
| PF13302 | Acetyltransf_3 | 3.23 |
| PF08281 | Sigma70_r4_2 | 2.42 |
| PF09922 | DUF2154 | 2.42 |
| PF01513 | NAD_kinase | 2.42 |
| PF00743 | FMO-like | 1.61 |
| PF01202 | SKI | 1.61 |
| PF00535 | Glycos_transf_2 | 1.61 |
| PF00196 | GerE | 1.61 |
| PF00106 | adh_short | 1.61 |
| PF13419 | HAD_2 | 0.81 |
| PF12867 | DinB_2 | 0.81 |
| PF01047 | MarR | 0.81 |
| PF01544 | CorA | 0.81 |
| PF01548 | DEDD_Tnp_IS110 | 0.81 |
| PF08376 | NIT | 0.81 |
| PF00465 | Fe-ADH | 0.81 |
| PF02133 | Transp_cyt_pur | 0.81 |
| PF13560 | HTH_31 | 0.81 |
| PF01381 | HTH_3 | 0.81 |
| PF13549 | ATP-grasp_5 | 0.81 |
| PF01402 | RHH_1 | 0.81 |
| PF02771 | Acyl-CoA_dh_N | 0.81 |
| PF01636 | APH | 0.81 |
| PF01243 | Putative_PNPOx | 0.81 |
| PF01738 | DLH | 0.81 |
| PF04542 | Sigma70_r2 | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF01042 | Ribonuc_L-PSP | 0.81 |
| PF00491 | Arginase | 0.81 |
| PF13412 | HTH_24 | 0.81 |
| PF12802 | MarR_2 | 0.81 |
| PF00294 | PfkB | 0.81 |
| PF13191 | AAA_16 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 8.06 |
| COG2119 | Putative Ca2+/H+ antiporter, TMEM165/GDT1 family | General function prediction only [R] | 5.65 |
| COG2072 | Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD | Inorganic ion transport and metabolism [P] | 1.61 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.81 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.81 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.81 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.81 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.81 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.81 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.81 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.81 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.81 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.81 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.16 % |
| Unclassified | root | N/A | 29.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10239312 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005456|Ga0070678_100600224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 983 | Open in IMG/M |
| 3300005547|Ga0070693_101444004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300005602|Ga0070762_10138174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1447 | Open in IMG/M |
| 3300006032|Ga0066696_10629785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
| 3300006173|Ga0070716_100576948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300006175|Ga0070712_101831068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → unclassified Geodermatophilus → Geodermatophilus sp. DSM 44511 | 531 | Open in IMG/M |
| 3300006176|Ga0070765_100766462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 912 | Open in IMG/M |
| 3300006797|Ga0066659_10494374 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300006806|Ga0079220_11698456 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300009137|Ga0066709_100449846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. ACS1612 | 1801 | Open in IMG/M |
| 3300009137|Ga0066709_101997486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 804 | Open in IMG/M |
| 3300009520|Ga0116214_1425433 | Not Available | 520 | Open in IMG/M |
| 3300009521|Ga0116222_1122934 | Not Available | 1117 | Open in IMG/M |
| 3300009672|Ga0116215_1180866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6 | 932 | Open in IMG/M |
| 3300009683|Ga0116224_10420710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 636 | Open in IMG/M |
| 3300009824|Ga0116219_10733129 | Not Available | 540 | Open in IMG/M |
| 3300010339|Ga0074046_10277920 | Not Available | 1033 | Open in IMG/M |
| 3300010358|Ga0126370_10679685 | Not Available | 901 | Open in IMG/M |
| 3300010358|Ga0126370_12407449 | Not Available | 523 | Open in IMG/M |
| 3300010361|Ga0126378_10601794 | Not Available | 1214 | Open in IMG/M |
| 3300010361|Ga0126378_10604519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1211 | Open in IMG/M |
| 3300010361|Ga0126378_10942931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 968 | Open in IMG/M |
| 3300010366|Ga0126379_11455798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 791 | Open in IMG/M |
| 3300010373|Ga0134128_10679571 | Not Available | 1144 | Open in IMG/M |
| 3300010376|Ga0126381_102326815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 769 | Open in IMG/M |
| 3300010376|Ga0126381_103064730 | Not Available | 663 | Open in IMG/M |
| 3300010379|Ga0136449_100779764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1584 | Open in IMG/M |
| 3300010396|Ga0134126_12632632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 546 | Open in IMG/M |
| 3300010398|Ga0126383_11593098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 742 | Open in IMG/M |
| 3300010398|Ga0126383_12399725 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012211|Ga0137377_11821444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus amargosae | 528 | Open in IMG/M |
| 3300014968|Ga0157379_10678808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 966 | Open in IMG/M |
| 3300016270|Ga0182036_11122275 | Not Available | 652 | Open in IMG/M |
| 3300016294|Ga0182041_10932975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 782 | Open in IMG/M |
| 3300016371|Ga0182034_11312693 | Not Available | 631 | Open in IMG/M |
| 3300017924|Ga0187820_1181576 | Not Available | 648 | Open in IMG/M |
| 3300017926|Ga0187807_1055889 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1224 | Open in IMG/M |
| 3300017926|Ga0187807_1266073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
| 3300017943|Ga0187819_10058409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2291 | Open in IMG/M |
| 3300017955|Ga0187817_10147645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1494 | Open in IMG/M |
| 3300017955|Ga0187817_10632146 | Not Available | 683 | Open in IMG/M |
| 3300018001|Ga0187815_10131763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1057 | Open in IMG/M |
| 3300018007|Ga0187805_10638729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 504 | Open in IMG/M |
| 3300018062|Ga0187784_10218343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1554 | Open in IMG/M |
| 3300020583|Ga0210401_11393727 | Not Available | 558 | Open in IMG/M |
| 3300021374|Ga0213881_10305960 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300021403|Ga0210397_10935964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 671 | Open in IMG/M |
| 3300021405|Ga0210387_10315735 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1376 | Open in IMG/M |
| 3300021405|Ga0210387_10359588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1287 | Open in IMG/M |
| 3300021420|Ga0210394_10651389 | Not Available | 925 | Open in IMG/M |
| 3300021433|Ga0210391_10523943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
| 3300021474|Ga0210390_10399894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300021477|Ga0210398_11433237 | Not Available | 539 | Open in IMG/M |
| 3300025898|Ga0207692_10137295 | Not Available | 1387 | Open in IMG/M |
| 3300025898|Ga0207692_10648114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 682 | Open in IMG/M |
| 3300025910|Ga0207684_10263295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1488 | Open in IMG/M |
| 3300025945|Ga0207679_10440543 | Not Available | 1154 | Open in IMG/M |
| 3300026023|Ga0207677_11046596 | Not Available | 742 | Open in IMG/M |
| 3300026552|Ga0209577_10125870 | All Organisms → cellular organisms → Bacteria | 2045 | Open in IMG/M |
| 3300027096|Ga0208099_1033992 | Not Available | 731 | Open in IMG/M |
| 3300027158|Ga0208725_1070189 | Not Available | 511 | Open in IMG/M |
| 3300027504|Ga0209114_1021676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1047 | Open in IMG/M |
| 3300027517|Ga0209113_1051824 | Not Available | 600 | Open in IMG/M |
| 3300027570|Ga0208043_1203108 | Not Available | 500 | Open in IMG/M |
| 3300027696|Ga0208696_1171077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300027787|Ga0209074_10364965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 596 | Open in IMG/M |
| 3300027826|Ga0209060_10108571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
| 3300027889|Ga0209380_10252640 | Not Available | 1035 | Open in IMG/M |
| 3300027895|Ga0209624_10231806 | Not Available | 1227 | Open in IMG/M |
| 3300028381|Ga0268264_11075305 | Not Available | 812 | Open in IMG/M |
| 3300028819|Ga0307296_10295154 | Not Available | 883 | Open in IMG/M |
| 3300028906|Ga0308309_10648837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 917 | Open in IMG/M |
| 3300029915|Ga0311358_10799494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 676 | Open in IMG/M |
| 3300030706|Ga0310039_10200702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora siamensis | 785 | Open in IMG/M |
| 3300031525|Ga0302326_10898599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1260 | Open in IMG/M |
| 3300031544|Ga0318534_10872679 | Not Available | 504 | Open in IMG/M |
| 3300031573|Ga0310915_11156192 | Not Available | 536 | Open in IMG/M |
| 3300031668|Ga0318542_10109801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1340 | Open in IMG/M |
| 3300031668|Ga0318542_10217516 | Not Available | 966 | Open in IMG/M |
| 3300031668|Ga0318542_10554154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 599 | Open in IMG/M |
| 3300031680|Ga0318574_10233743 | Not Available | 1061 | Open in IMG/M |
| 3300031680|Ga0318574_10727106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 582 | Open in IMG/M |
| 3300031723|Ga0318493_10116371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1356 | Open in IMG/M |
| 3300031723|Ga0318493_10127622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1300 | Open in IMG/M |
| 3300031724|Ga0318500_10664915 | Not Available | 530 | Open in IMG/M |
| 3300031747|Ga0318502_10837839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300031751|Ga0318494_10130606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1405 | Open in IMG/M |
| 3300031765|Ga0318554_10150313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1322 | Open in IMG/M |
| 3300031770|Ga0318521_10561598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 689 | Open in IMG/M |
| 3300031778|Ga0318498_10192343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium | 926 | Open in IMG/M |
| 3300031778|Ga0318498_10212614 | Not Available | 876 | Open in IMG/M |
| 3300031782|Ga0318552_10474945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 638 | Open in IMG/M |
| 3300031793|Ga0318548_10430043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 647 | Open in IMG/M |
| 3300031796|Ga0318576_10563553 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 537 | Open in IMG/M |
| 3300031797|Ga0318550_10637514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 511 | Open in IMG/M |
| 3300031819|Ga0318568_10540969 | Not Available | 726 | Open in IMG/M |
| 3300031820|Ga0307473_10724250 | Not Available | 701 | Open in IMG/M |
| 3300031821|Ga0318567_10501775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 689 | Open in IMG/M |
| 3300031860|Ga0318495_10362136 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300031890|Ga0306925_10252324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1901 | Open in IMG/M |
| 3300031896|Ga0318551_10425064 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300031897|Ga0318520_10639715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 663 | Open in IMG/M |
| 3300031910|Ga0306923_10636483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1193 | Open in IMG/M |
| 3300031946|Ga0310910_10141485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium subroseum | 1833 | Open in IMG/M |
| 3300031954|Ga0306926_12963277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 508 | Open in IMG/M |
| 3300032009|Ga0318563_10680411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 553 | Open in IMG/M |
| 3300032025|Ga0318507_10137300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1040 | Open in IMG/M |
| 3300032039|Ga0318559_10400105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534 | 640 | Open in IMG/M |
| 3300032063|Ga0318504_10197238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 939 | Open in IMG/M |
| 3300032065|Ga0318513_10110164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1294 | Open in IMG/M |
| 3300032066|Ga0318514_10226766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 981 | Open in IMG/M |
| 3300032089|Ga0318525_10431855 | Not Available | 675 | Open in IMG/M |
| 3300032090|Ga0318518_10286375 | Not Available | 846 | Open in IMG/M |
| 3300032094|Ga0318540_10622986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300032160|Ga0311301_10340067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2359 | Open in IMG/M |
| 3300032180|Ga0307471_100949045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1027 | Open in IMG/M |
| 3300032770|Ga0335085_10473670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1435 | Open in IMG/M |
| 3300032770|Ga0335085_11746086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 639 | Open in IMG/M |
| 3300032828|Ga0335080_11879109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 583 | Open in IMG/M |
| 3300032892|Ga0335081_10897883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1045 | Open in IMG/M |
| 3300033158|Ga0335077_10006138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14818 | Open in IMG/M |
| 3300033475|Ga0310811_10916176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 788 | Open in IMG/M |
| 3300034163|Ga0370515_0405573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae | 575 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.06% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.06% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.84% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.81% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027517 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_102393123 | 3300001867 | Forest Soil | GDIATAAAQSSSMKGNPVTLSHADLVAIVHQAIG* |
| Ga0070678_1006002241 | 3300005456 | Miscanthus Rhizosphere | FGIGPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIVLQAL* |
| Ga0070693_1014440042 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | IGPAEAGGIAARAAASSSMQGNPVSLTPGDLRAILLQSI* |
| Ga0070762_101381741 | 3300005602 | Soil | ADEIAAKAMTSSSMQGNPVPLSHEDLRAALIQAL* |
| Ga0066696_106297853 | 3300006032 | Soil | LAAFGIGPQHAEEIAAKAANSSSMQGNPVALSHADPQTILLQTVNHARFS* |
| Ga0070716_1005769482 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GPGEADGIAAKAATSSSMQGNPVPLSHDELKAVVLQAL* |
| Ga0070712_1018310681 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | GLGPGEADGIAAKAATSSSMQGNPVPLSHDELKAVVLQAL* |
| Ga0070765_1007664623 | 3300006176 | Soil | PEHADEIAAKAMTSSSMQGNPVPLSHEDLRAALIQAL* |
| Ga0066659_104943742 | 3300006797 | Soil | AFGVGPQHVDDVAAKAARSSSMQGNPVALTHSDLRAIVLQAL* |
| Ga0079220_116984561 | 3300006806 | Agricultural Soil | GNADDIAAKAMISSSMQGNPVPLSQGQLEAILLEAL* |
| Ga0066709_1004498464 | 3300009137 | Grasslands Soil | AVPGLAAFGIGPQHAEEIAAKAANSSSMQGNPVALSHADPQTILLQTVNHACFS* |
| Ga0066709_1019974862 | 3300009137 | Grasslands Soil | GLGSGQAGDIAAAAMTSSSMQGNPVSLSQGQLEAVFLEAL* |
| Ga0116214_14254331 | 3300009520 | Peatlands Soil | TLTLAAVPCLGAFGNRPEEAGQIAAKALTSSRMQGNPFALSHGDLKAILLRAL* |
| Ga0116222_11229341 | 3300009521 | Peatlands Soil | LAAFGLGPQDAGGIAAKALTSSSMQGNPVPLSRDDLEAILLRAL* |
| Ga0116215_11808662 | 3300009672 | Peatlands Soil | HADEIAAKALTSSSMQGNPVALSHGDLKAILERAL* |
| Ga0116224_104207101 | 3300009683 | Peatlands Soil | QHADEIAAKALTSSSMQGNPVALSHGDLKAILERAL* |
| Ga0116219_107331291 | 3300009824 | Peatlands Soil | HADEIAAKALTSSSMQGNPVALSHGDLKAILLRAL* |
| Ga0074046_102779202 | 3300010339 | Bog Forest Soil | GPQHADEIAAKALTSSSMLGNPVALSHDDLKAILQRAL* |
| Ga0126370_106796851 | 3300010358 | Tropical Forest Soil | IGPQHADDVAVKALRSSSMQGNPVALSTGDLRAVLLRAI* |
| Ga0126370_124074491 | 3300010358 | Tropical Forest Soil | SLATFGIKPEHADDFAAKAAVSSSMQGNPIALSRTELKAIVLQAL* |
| Ga0126378_106017941 | 3300010361 | Tropical Forest Soil | GPQHADDVAAKALRSSSMQGNPVALSDGDVRAVLLRAI* |
| Ga0126378_106045193 | 3300010361 | Tropical Forest Soil | LAAFGVGQQHADDVAAKAAGSSSMQGNPVALTHGDLRAIVLQAL* |
| Ga0126378_109429312 | 3300010361 | Tropical Forest Soil | GPQHADDVAAKALRSSSMQGNPVALSASDLRAVLLEAI* |
| Ga0126379_114557981 | 3300010366 | Tropical Forest Soil | LAAFGIGPQHAGDIAARAAGSSSMQGNPVALSHSDLIAAVRQAL* |
| Ga0134128_106795711 | 3300010373 | Terrestrial Soil | GIGPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIFLQAL* |
| Ga0126381_1023268151 | 3300010376 | Tropical Forest Soil | DAGDIAAKAARSSSMQGNPVPLDHGDLLAILRQAI* |
| Ga0126381_1030647302 | 3300010376 | Tropical Forest Soil | GIGPEHADDIAAKAAVSSSMQGNPIALSRSELKAIVLQAR* |
| Ga0136449_1007797641 | 3300010379 | Peatlands Soil | ADDIAAKALTSSSMQGNPVALTQAELKGILLQAL* |
| Ga0134126_126326321 | 3300010396 | Terrestrial Soil | QAGDIAGKTARSSSMQGNPVPLTDEELRAIVLEAA* |
| Ga0126383_115930982 | 3300010398 | Tropical Forest Soil | FGLGPQHADDVAAKAARSSSMQGNPVALTDSDLRAIVLQAL* |
| Ga0126383_123997252 | 3300010398 | Tropical Forest Soil | AAFGLRPQHADDVAAKAARSSSMKGNPAALSRGDLRAIFLRAL* |
| Ga0137377_118214442 | 3300012211 | Vadose Zone Soil | GPQHVDDVAAKAARSSSMQGNPVALTHSDLRAIVLQAL* |
| Ga0157379_106788083 | 3300014968 | Switchgrass Rhizosphere | GLGPGQADDIAAKAATSSSMQGNPVPLSHDELKAVVLQAL* |
| Ga0182036_111222751 | 3300016270 | Soil | GVRPEQADEAAAKAAKSSSMQGNPVVLSHDDLRAILLSAL |
| Ga0182041_109329752 | 3300016294 | Soil | GLGPDNADEIAAKAITSSSMQGNPVSLSQDDLTAILLEAL |
| Ga0182034_113126932 | 3300016371 | Soil | FGVRVQQADAIAAQAARSSSMQGNPVVLSHDDLRAILLSAL |
| Ga0187820_11815761 | 3300017924 | Freshwater Sediment | QEVDDIAAKALVSSSMKGNPVPLSHADLTAILLQAL |
| Ga0187807_10558891 | 3300017926 | Freshwater Sediment | PQHADEIAAKARTSSSMQGNPVALSHDDLKAALLRTL |
| Ga0187807_12660731 | 3300017926 | Freshwater Sediment | GIQPQQADDIAAKAARSSSMQGNPVTLSPGDLRAILIQAI |
| Ga0187819_100584091 | 3300017943 | Freshwater Sediment | RHAGEIAAKALLSSSMKGNPVPLSQADLEAILLQAL |
| Ga0187817_101476452 | 3300017955 | Freshwater Sediment | LATSGVRPQHADEIAAKARTSSSMQGNPVALSHDDLKAALLRTL |
| Ga0187817_106321461 | 3300017955 | Freshwater Sediment | LATSGVRPQHADEIAAKARTSSSMQGNPVALSHDDLKAALRRTL |
| Ga0187815_101317632 | 3300018001 | Freshwater Sediment | PQHADEIAAKARTSSSMQGNPVALSHDDLKAALRRTL |
| Ga0187805_106387293 | 3300018007 | Freshwater Sediment | EPQQAGEIAAKALVSSSMKGNPVPLSQADLEAILLQAL |
| Ga0187784_102183433 | 3300018062 | Tropical Peatland | GLGPQHAGDIAAKALTSSSMQGNPVPLSHDDLEAILRQAL |
| Ga0210401_113937272 | 3300020583 | Soil | LAAFGLVPPDADDIAAKALTSSSMKGNPVILSLADLEAVLIAAL |
| Ga0213881_103059601 | 3300021374 | Exposed Rock | GQAGDIAAKAATSSSMQGNPVPLSHDELAAVVRQAV |
| Ga0210397_109359641 | 3300021403 | Soil | LLAVPGLATFGVGPQHADEIAAKALTSSSMQGNPVALDHGDLKAILLLAL |
| Ga0210387_103157351 | 3300021405 | Soil | PGLATFGVGPQHADEIAAKALTSSSMQGNPVALNHGDLKAILLLAL |
| Ga0210387_103595881 | 3300021405 | Soil | PGLATFGVGPQHADEIAAKALTSSSMQGNPVALDHGDLKAILLLAL |
| Ga0210394_106513892 | 3300021420 | Soil | RPQHADEIAAKALTSSSMQGNPVALSHGDLTAILQRAL |
| Ga0210391_105239431 | 3300021433 | Soil | LGSEQADEIAAKAMTSSSMQGNPAVLSRDDLRAVLIQAL |
| Ga0210390_103998943 | 3300021474 | Soil | RPGDVGEIAAAAARSSSMQGNPVLLSDDDLRAIVLAAL |
| Ga0210398_114332372 | 3300021477 | Soil | AFGLSLQDVDDVAAKAAASSSMQGNPVVLSHDDLRTILLDAI |
| Ga0207692_101372953 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AAFGIGPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIVLQAL |
| Ga0207692_106481142 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TAAQAGDIAAKALTSSSMQGNPVPLSQDDLESIVLAAL |
| Ga0207684_102632953 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PQHADDVAAKALRSSSMQGNPVALSAGDLRAVLLRAI |
| Ga0207679_104405433 | 3300025945 | Corn Rhizosphere | LAAFGIGPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIFLQAL |
| Ga0207677_110465961 | 3300026023 | Miscanthus Rhizosphere | SGVRPQHADDVAAKAAQSSSMQGNPVALSHADLRAIVLQAL |
| Ga0209577_101258703 | 3300026552 | Soil | VPGLAAFGIGPQHADEIAAKAANSSSMQGNPVALSHADPQTILLQAVNHARSS |
| Ga0208099_10339922 | 3300027096 | Forest Soil | GQIGDVAAKALTSSSMQGNPVPLSRDDLKAVLLQAL |
| Ga0208725_10701891 | 3300027158 | Forest Soil | LAAFGLSLQDVDDVAAKAAGSSSMQGNPVVLSHDDLRTILLDAI |
| Ga0209114_10216763 | 3300027504 | Forest Soil | LGLPDDIATAAAQSSSMKGNPVTLSHADLVAIVHQAIG |
| Ga0209113_10518242 | 3300027517 | Forest Soil | AFGLRPQDAGGIATAAAQSSSMKGNPVTLSHADLVAIVHQAIG |
| Ga0208043_12031082 | 3300027570 | Peatlands Soil | DADDIAAKALTSSSMQGNPVPLSHDDLMDIVLQAL |
| Ga0208696_11710771 | 3300027696 | Peatlands Soil | PQHADEIAAKALTSSSMQGNPVALSHGDLKAILERAL |
| Ga0209074_103649651 | 3300027787 | Agricultural Soil | GEADGIAAKAATSSSMQGNPVPLSHDELKAVVLQAL |
| Ga0209060_101085711 | 3300027826 | Surface Soil | GPEQAGEIAAKALVSSSMKGNPVALSPADLEAALLQAL |
| Ga0209380_102526402 | 3300027889 | Soil | PQDADDIAAKALTSSSMKGNPVILSLADLEAVLVAAL |
| Ga0209624_102318063 | 3300027895 | Forest Soil | QDVGDVAAKAAASSSMQGNPVVLSDDDLRTILLDAI |
| Ga0268264_110753053 | 3300028381 | Switchgrass Rhizosphere | GPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIFLQAL |
| Ga0307296_102951541 | 3300028819 | Soil | PQHADDVAAKAAKSSSMQGNPVALSDSDLRAIFLQSL |
| Ga0308309_106488373 | 3300028906 | Soil | PEHADEIAAKAMTSSSMQGNPVPLSHEDLRAALIQAL |
| Ga0311358_107994942 | 3300029915 | Bog | GIRPEHADDVAVKAARSSSMQGNPVTLSHRDLRTILLQAI |
| Ga0310039_102007021 | 3300030706 | Peatlands Soil | FGIRPQHADEIAAKALTSSSMQGNPVALSHGDLKAILERAL |
| Ga0302326_108985994 | 3300031525 | Palsa | GLASFGLGSEQADEVAAKAMTSSSMQGNPAVLSRDDLRAVLIQAL |
| Ga0318534_108726792 | 3300031544 | Soil | PGHADDVAAKAAVSSSMQGNPVSLSHDDLKAVFLRAL |
| Ga0310915_111561922 | 3300031573 | Soil | FGLGPQHADDIAAKASVSSSMKGNPVALSHADLKAILLQAL |
| Ga0318542_101098013 | 3300031668 | Soil | LGPGQADDIAAKAVRSGSMQGNPVTLSHDELQAIVLQAL |
| Ga0318542_102175162 | 3300031668 | Soil | QQADDITAKALTSSSMKGNPVALSHADLKAILLQAL |
| Ga0318542_105541542 | 3300031668 | Soil | FGLGPEDADDIAAKALTSSSMQGNPVALSQDDLTAIILEAL |
| Ga0318574_102337431 | 3300031680 | Soil | GLASFGIRPQDAGEIAAKAATSSSMQGNPIPLETGELRAIVLQAL |
| Ga0318574_107271062 | 3300031680 | Soil | DNADEIAAKAITSSSMQGNPVSLSQGDLTAILLEAL |
| Ga0318493_101163711 | 3300031723 | Soil | GLAAFGLGPGQADDIAAKAMRSGSMQGNPVTLSHDELQAIVLQAL |
| Ga0318493_101276223 | 3300031723 | Soil | ASFGIRPQDAADVAVKAAASSSMQGNPIPLETGELRAIVLQAL |
| Ga0318500_106649152 | 3300031724 | Soil | IPSLATFGIKPEHAGDIAAKAAVSSSMQGNPIALSHSELKAIVLQAL |
| Ga0318502_108378391 | 3300031747 | Soil | VSGLAAFGLGPGHADDVAAKAAVSSSMQGNPVSLSHDDLKAVFLRAL |
| Ga0318494_101306062 | 3300031751 | Soil | EQADEIAAKAARSSSMQGNPVPLSGDELQAIVMAAI |
| Ga0318554_101503131 | 3300031765 | Soil | QDADAMAAQAARSSSMQGNPVVLSHDDLRAILLSAL |
| Ga0318521_105615981 | 3300031770 | Soil | GPEDADGIAAKALTSSSMQGNPVALSQGDLTAILLEAL |
| Ga0318498_101923431 | 3300031778 | Soil | PQDAADVAVKAAASSSMQGNPIPLETGELRAIVLQAL |
| Ga0318498_102126141 | 3300031778 | Soil | AAFGIGPQDADDIAAKAAVSSSMQGNPIALSHGELHAIVLEAL |
| Ga0318552_104749452 | 3300031782 | Soil | EPEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL |
| Ga0318548_104300432 | 3300031793 | Soil | LGPDNADEIAAKAITSSSMQGNPVSLSQDDLTAILLEAL |
| Ga0318576_105635532 | 3300031796 | Soil | DADGIAAKALTSSSMQGNPVALSQGDLTAILLEAL |
| Ga0318550_106375142 | 3300031797 | Soil | SEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL |
| Ga0318568_105409691 | 3300031819 | Soil | RVQDAGDIAAKALTSSSMKGNPVPLSHADLKALLLQAL |
| Ga0307473_107242502 | 3300031820 | Hardwood Forest Soil | LAAFGLGPEQAAEIAAQALVSSSMKGNPVALSVGNLRAILASAA |
| Ga0318567_105017751 | 3300031821 | Soil | AAFGLGPGNADDIAAKAMTSSSMQGNPVALSHGDLKAVFLEAL |
| Ga0318495_103621361 | 3300031860 | Soil | GLAAFGVRAEHADAIVAQAARSSSMQGNPVVLSHDDLRAILLSAL |
| Ga0306925_102523243 | 3300031890 | Soil | DADDIAAKALTSSSMQGNPVALSQDDLTAIILEAL |
| Ga0318551_104250641 | 3300031896 | Soil | GVRAEHADAIVAQAARSSSMQGNPVVLSHDDLRAILLSAL |
| Ga0318520_106397151 | 3300031897 | Soil | LAAFGLGPGNADDIAAKAMTSSSMQGNPVALSHGDLKAIVLEAL |
| Ga0306923_106364831 | 3300031910 | Soil | FGVRAEHADAIVAQAARSSSMQGNPVVLSHDDLRAILLSAL |
| Ga0310910_101414851 | 3300031946 | Soil | GVRRDQADEIAAKAAKSSSMQGNPIALSDSDLRAIVLRAL |
| Ga0306926_129632772 | 3300031954 | Soil | TFGLEPQHADDIAAKALVSSSMKGNPVALSHADLAEILLQAL |
| Ga0318563_106804111 | 3300032009 | Soil | AAFGLGPDNADEIAAKAITSSSMQGNPVSLSQGDLTAILLEAL |
| Ga0318507_101373001 | 3300032025 | Soil | PEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL |
| Ga0318559_104001052 | 3300032039 | Soil | GLGPEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL |
| Ga0318504_101972381 | 3300032063 | Soil | ASGLGPPQADDVATKAMASSSMKGNPVPLSHADLKAIFLQAL |
| Ga0318513_101101642 | 3300032065 | Soil | VRAEHADAIVAQAARSSSMQGNPVVLSHDDLRAILLSAL |
| Ga0318514_102267662 | 3300032066 | Soil | QADEIAAKAARSSSMQGNPVPLSGDELQAIVMAAI |
| Ga0318525_104318552 | 3300032089 | Soil | FGIKPEDAEDVAAKAAVSSSMQGNPIALSRGELRAIVLQAL |
| Ga0318518_102863751 | 3300032090 | Soil | LGPQLADDIAAKALTSSSMKGNPVALSHADLKAILLQAL |
| Ga0318540_106229863 | 3300032094 | Soil | LAAFGVRRDQADEIAAKAAKSSSMQGNPVALSDSDLRTIVLRAL |
| Ga0311301_103400671 | 3300032160 | Peatlands Soil | HADEIAAKALTSSSMQGNPVALSHGDLKAILLRAL |
| Ga0307471_1009490451 | 3300032180 | Hardwood Forest Soil | AFGLGPGEADGIAAKAATSSSMQGNPVPLSHDELKAVVLQAL |
| Ga0335085_104736703 | 3300032770 | Soil | GLAVFGLGPGNADDIAATAMTSSSMQGNPVALSHGDLTAVLLEAL |
| Ga0335085_117460861 | 3300032770 | Soil | PGLAAFGLGPGNADDIAATAMTSSSMQGNPVALSHDDLTAILLEAL |
| Ga0335080_118791092 | 3300032828 | Soil | AFGLGPANADDIAATAMTSSSMQGNPVALSHGDLTAVLLEAL |
| Ga0335081_108978831 | 3300032892 | Soil | AASGIGPQHADDVAARAARSSSMQGNPVALSHSDLCAIVLQAL |
| Ga0335077_100061381 | 3300033158 | Soil | EHTGDIAAKAARSSSMQGNPAALSDSDLRAIVLQAL |
| Ga0310811_109161761 | 3300033475 | Soil | PGQADDIAAKAATSSSMQGNPVPLSHDELKAVVLQAL |
| Ga0370515_0405573_462_575 | 3300034163 | Untreated Peat Soil | PEHADDVAVKAARSSSMQGNPVTLSHRDLRTILLQAI |
| ⦗Top⦘ |