NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F069249

Metagenome Family F069249

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069249
Family Type Metagenome
Number of Sequences 124
Average Sequence Length 40 residues
Representative Sequence PEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL
Number of Associated Samples 108
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 96.77 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.161 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(34.677 % of family members)
Environment Ontology (ENVO) Unclassified
(33.065 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.774 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.92%    β-sheet: 0.00%    Coil/Unstructured: 63.08%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.38
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF09587PGA_cap 12.10
PF018125-FTHF_cyc-lig 8.06
PF01169UPF0016 5.65
PF09350DJC28_CD 4.03
PF13302Acetyltransf_3 3.23
PF08281Sigma70_r4_2 2.42
PF09922DUF2154 2.42
PF01513NAD_kinase 2.42
PF00743FMO-like 1.61
PF01202SKI 1.61
PF00535Glycos_transf_2 1.61
PF00196GerE 1.61
PF00106adh_short 1.61
PF13419HAD_2 0.81
PF12867DinB_2 0.81
PF01047MarR 0.81
PF01544CorA 0.81
PF01548DEDD_Tnp_IS110 0.81
PF08376NIT 0.81
PF00465Fe-ADH 0.81
PF02133Transp_cyt_pur 0.81
PF13560HTH_31 0.81
PF01381HTH_3 0.81
PF13549ATP-grasp_5 0.81
PF01402RHH_1 0.81
PF02771Acyl-CoA_dh_N 0.81
PF01636APH 0.81
PF01243Putative_PNPOx 0.81
PF01738DLH 0.81
PF04542Sigma70_r2 0.81
PF00903Glyoxalase 0.81
PF01042Ribonuc_L-PSP 0.81
PF00491Arginase 0.81
PF13412HTH_24 0.81
PF12802MarR_2 0.81
PF00294PfkB 0.81
PF13191AAA_16 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG02125-formyltetrahydrofolate cyclo-ligaseCoenzyme transport and metabolism [H] 8.06
COG2119Putative Ca2+/H+ antiporter, TMEM165/GDT1 familyGeneral function prediction only [R] 5.65
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 1.61
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.81
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.81
COG03373-dehydroquinate synthetaseAmino acid transport and metabolism [E] 0.81
COG0371Glycerol dehydrogenase or related enzyme, iron-containing ADH familyEnergy production and conversion [C] 0.81
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.81
COG0598Mg2+ and Co2+ transporter CorAInorganic ion transport and metabolism [P] 0.81
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.81
COG1454Alcohol dehydrogenase, class IVEnergy production and conversion [C] 0.81
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.81
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.81
COG1979Alcohol dehydrogenase YqhD, Fe-dependent ADH familyEnergy production and conversion [C] 0.81
COG3547TransposaseMobilome: prophages, transposons [X] 0.81
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.16 %
UnclassifiedrootN/A29.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001867|JGI12627J18819_10239312All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300005456|Ga0070678_100600224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia983Open in IMG/M
3300005547|Ga0070693_101444004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia536Open in IMG/M
3300005602|Ga0070762_10138174All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1447Open in IMG/M
3300006032|Ga0066696_10629785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria694Open in IMG/M
3300006173|Ga0070716_100576948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia842Open in IMG/M
3300006175|Ga0070712_101831068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → unclassified Geodermatophilus → Geodermatophilus sp. DSM 44511531Open in IMG/M
3300006176|Ga0070765_100766462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales912Open in IMG/M
3300006797|Ga0066659_10494374All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300006806|Ga0079220_11698456All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300009137|Ga0066709_100449846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → unclassified Mycobacterium → Mycobacterium sp. ACS16121801Open in IMG/M
3300009137|Ga0066709_101997486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii804Open in IMG/M
3300009520|Ga0116214_1425433Not Available520Open in IMG/M
3300009521|Ga0116222_1122934Not Available1117Open in IMG/M
3300009672|Ga0116215_1180866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_6932Open in IMG/M
3300009683|Ga0116224_10420710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia636Open in IMG/M
3300009824|Ga0116219_10733129Not Available540Open in IMG/M
3300010339|Ga0074046_10277920Not Available1033Open in IMG/M
3300010358|Ga0126370_10679685Not Available901Open in IMG/M
3300010358|Ga0126370_12407449Not Available523Open in IMG/M
3300010361|Ga0126378_10601794Not Available1214Open in IMG/M
3300010361|Ga0126378_10604519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1211Open in IMG/M
3300010361|Ga0126378_10942931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia968Open in IMG/M
3300010366|Ga0126379_11455798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300010373|Ga0134128_10679571Not Available1144Open in IMG/M
3300010376|Ga0126381_102326815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii769Open in IMG/M
3300010376|Ga0126381_103064730Not Available663Open in IMG/M
3300010379|Ga0136449_100779764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1584Open in IMG/M
3300010396|Ga0134126_12632632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300010398|Ga0126383_11593098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria742Open in IMG/M
3300010398|Ga0126383_12399725All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300012211|Ga0137377_11821444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus amargosae528Open in IMG/M
3300014968|Ga0157379_10678808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae966Open in IMG/M
3300016270|Ga0182036_11122275Not Available652Open in IMG/M
3300016294|Ga0182041_10932975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii782Open in IMG/M
3300016371|Ga0182034_11312693Not Available631Open in IMG/M
3300017924|Ga0187820_1181576Not Available648Open in IMG/M
3300017926|Ga0187807_1055889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1224Open in IMG/M
3300017926|Ga0187807_1266073All Organisms → cellular organisms → Bacteria → Proteobacteria564Open in IMG/M
3300017943|Ga0187819_10058409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2291Open in IMG/M
3300017955|Ga0187817_10147645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1494Open in IMG/M
3300017955|Ga0187817_10632146Not Available683Open in IMG/M
3300018001|Ga0187815_10131763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1057Open in IMG/M
3300018007|Ga0187805_10638729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii504Open in IMG/M
3300018062|Ga0187784_10218343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1554Open in IMG/M
3300020583|Ga0210401_11393727Not Available558Open in IMG/M
3300021374|Ga0213881_10305960All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300021403|Ga0210397_10935964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii671Open in IMG/M
3300021405|Ga0210387_10315735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1376Open in IMG/M
3300021405|Ga0210387_10359588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1287Open in IMG/M
3300021420|Ga0210394_10651389Not Available925Open in IMG/M
3300021433|Ga0210391_10523943All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria931Open in IMG/M
3300021474|Ga0210390_10399894All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1161Open in IMG/M
3300021477|Ga0210398_11433237Not Available539Open in IMG/M
3300025898|Ga0207692_10137295Not Available1387Open in IMG/M
3300025898|Ga0207692_10648114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii682Open in IMG/M
3300025910|Ga0207684_10263295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1488Open in IMG/M
3300025945|Ga0207679_10440543Not Available1154Open in IMG/M
3300026023|Ga0207677_11046596Not Available742Open in IMG/M
3300026552|Ga0209577_10125870All Organisms → cellular organisms → Bacteria2045Open in IMG/M
3300027096|Ga0208099_1033992Not Available731Open in IMG/M
3300027158|Ga0208725_1070189Not Available511Open in IMG/M
3300027504|Ga0209114_1021676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1047Open in IMG/M
3300027517|Ga0209113_1051824Not Available600Open in IMG/M
3300027570|Ga0208043_1203108Not Available500Open in IMG/M
3300027696|Ga0208696_1171077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria697Open in IMG/M
3300027787|Ga0209074_10364965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii596Open in IMG/M
3300027826|Ga0209060_10108571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1296Open in IMG/M
3300027889|Ga0209380_10252640Not Available1035Open in IMG/M
3300027895|Ga0209624_10231806Not Available1227Open in IMG/M
3300028381|Ga0268264_11075305Not Available812Open in IMG/M
3300028819|Ga0307296_10295154Not Available883Open in IMG/M
3300028906|Ga0308309_10648837All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia917Open in IMG/M
3300029915|Ga0311358_10799494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae676Open in IMG/M
3300030706|Ga0310039_10200702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora siamensis785Open in IMG/M
3300031525|Ga0302326_10898599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1260Open in IMG/M
3300031544|Ga0318534_10872679Not Available504Open in IMG/M
3300031573|Ga0310915_11156192Not Available536Open in IMG/M
3300031668|Ga0318542_10109801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1340Open in IMG/M
3300031668|Ga0318542_10217516Not Available966Open in IMG/M
3300031668|Ga0318542_10554154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii599Open in IMG/M
3300031680|Ga0318574_10233743Not Available1061Open in IMG/M
3300031680|Ga0318574_10727106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii582Open in IMG/M
3300031723|Ga0318493_10116371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1356Open in IMG/M
3300031723|Ga0318493_10127622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1300Open in IMG/M
3300031724|Ga0318500_10664915Not Available530Open in IMG/M
3300031747|Ga0318502_10837839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300031751|Ga0318494_10130606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1405Open in IMG/M
3300031765|Ga0318554_10150313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1322Open in IMG/M
3300031770|Ga0318521_10561598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii689Open in IMG/M
3300031778|Ga0318498_10192343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → unclassified Acidimicrobiales → Acidimicrobiales bacterium926Open in IMG/M
3300031778|Ga0318498_10212614Not Available876Open in IMG/M
3300031782|Ga0318552_10474945All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534638Open in IMG/M
3300031793|Ga0318548_10430043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii647Open in IMG/M
3300031796|Ga0318576_10563553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii537Open in IMG/M
3300031797|Ga0318550_10637514All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534511Open in IMG/M
3300031819|Ga0318568_10540969Not Available726Open in IMG/M
3300031820|Ga0307473_10724250Not Available701Open in IMG/M
3300031821|Ga0318567_10501775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii689Open in IMG/M
3300031860|Ga0318495_10362136All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300031890|Ga0306925_10252324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1901Open in IMG/M
3300031896|Ga0318551_10425064All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300031897|Ga0318520_10639715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii663Open in IMG/M
3300031910|Ga0306923_10636483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1193Open in IMG/M
3300031946|Ga0310910_10141485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Streptosporangium → Streptosporangium subroseum1833Open in IMG/M
3300031954|Ga0306926_12963277All Organisms → cellular organisms → Bacteria → Terrabacteria group508Open in IMG/M
3300032009|Ga0318563_10680411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii553Open in IMG/M
3300032025|Ga0318507_10137300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1040Open in IMG/M
3300032039|Ga0318559_10400105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → unclassified Actinomadura → Actinomadura sp. 7K534640Open in IMG/M
3300032063|Ga0318504_10197238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria939Open in IMG/M
3300032065|Ga0318513_10110164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1294Open in IMG/M
3300032066|Ga0318514_10226766All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium981Open in IMG/M
3300032089|Ga0318525_10431855Not Available675Open in IMG/M
3300032090|Ga0318518_10286375Not Available846Open in IMG/M
3300032094|Ga0318540_10622986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300032160|Ga0311301_10340067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2359Open in IMG/M
3300032180|Ga0307471_100949045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1027Open in IMG/M
3300032770|Ga0335085_10473670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1435Open in IMG/M
3300032770|Ga0335085_11746086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii639Open in IMG/M
3300032828|Ga0335080_11879109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii583Open in IMG/M
3300032892|Ga0335081_10897883All Organisms → cellular organisms → Bacteria → Terrabacteria group1045Open in IMG/M
3300033158|Ga0335077_10006138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia14818Open in IMG/M
3300033475|Ga0310811_10916176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii788Open in IMG/M
3300034163|Ga0370515_0405573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae575Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil34.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.06%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil8.06%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.84%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.61%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.61%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.61%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.61%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.61%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.81%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.81%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.81%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.81%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.81%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027096Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes)EnvironmentalOpen in IMG/M
3300027158Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes)EnvironmentalOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027517Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12627J18819_1023931233300001867Forest SoilGDIATAAAQSSSMKGNPVTLSHADLVAIVHQAIG*
Ga0070678_10060022413300005456Miscanthus RhizosphereFGIGPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIVLQAL*
Ga0070693_10144400423300005547Corn, Switchgrass And Miscanthus RhizosphereIGPAEAGGIAARAAASSSMQGNPVSLTPGDLRAILLQSI*
Ga0070762_1013817413300005602SoilADEIAAKAMTSSSMQGNPVPLSHEDLRAALIQAL*
Ga0066696_1062978533300006032SoilLAAFGIGPQHAEEIAAKAANSSSMQGNPVALSHADPQTILLQTVNHARFS*
Ga0070716_10057694823300006173Corn, Switchgrass And Miscanthus RhizosphereGPGEADGIAAKAATSSSMQGNPVPLSHDELKAVVLQAL*
Ga0070712_10183106813300006175Corn, Switchgrass And Miscanthus RhizosphereGLGPGEADGIAAKAATSSSMQGNPVPLSHDELKAVVLQAL*
Ga0070765_10076646233300006176SoilPEHADEIAAKAMTSSSMQGNPVPLSHEDLRAALIQAL*
Ga0066659_1049437423300006797SoilAFGVGPQHVDDVAAKAARSSSMQGNPVALTHSDLRAIVLQAL*
Ga0079220_1169845613300006806Agricultural SoilGNADDIAAKAMISSSMQGNPVPLSQGQLEAILLEAL*
Ga0066709_10044984643300009137Grasslands SoilAVPGLAAFGIGPQHAEEIAAKAANSSSMQGNPVALSHADPQTILLQTVNHACFS*
Ga0066709_10199748623300009137Grasslands SoilGLGSGQAGDIAAAAMTSSSMQGNPVSLSQGQLEAVFLEAL*
Ga0116214_142543313300009520Peatlands SoilTLTLAAVPCLGAFGNRPEEAGQIAAKALTSSRMQGNPFALSHGDLKAILLRAL*
Ga0116222_112293413300009521Peatlands SoilLAAFGLGPQDAGGIAAKALTSSSMQGNPVPLSRDDLEAILLRAL*
Ga0116215_118086623300009672Peatlands SoilHADEIAAKALTSSSMQGNPVALSHGDLKAILERAL*
Ga0116224_1042071013300009683Peatlands SoilQHADEIAAKALTSSSMQGNPVALSHGDLKAILERAL*
Ga0116219_1073312913300009824Peatlands SoilHADEIAAKALTSSSMQGNPVALSHGDLKAILLRAL*
Ga0074046_1027792023300010339Bog Forest SoilGPQHADEIAAKALTSSSMLGNPVALSHDDLKAILQRAL*
Ga0126370_1067968513300010358Tropical Forest SoilIGPQHADDVAVKALRSSSMQGNPVALSTGDLRAVLLRAI*
Ga0126370_1240744913300010358Tropical Forest SoilSLATFGIKPEHADDFAAKAAVSSSMQGNPIALSRTELKAIVLQAL*
Ga0126378_1060179413300010361Tropical Forest SoilGPQHADDVAAKALRSSSMQGNPVALSDGDVRAVLLRAI*
Ga0126378_1060451933300010361Tropical Forest SoilLAAFGVGQQHADDVAAKAAGSSSMQGNPVALTHGDLRAIVLQAL*
Ga0126378_1094293123300010361Tropical Forest SoilGPQHADDVAAKALRSSSMQGNPVALSASDLRAVLLEAI*
Ga0126379_1145579813300010366Tropical Forest SoilLAAFGIGPQHAGDIAARAAGSSSMQGNPVALSHSDLIAAVRQAL*
Ga0134128_1067957113300010373Terrestrial SoilGIGPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIFLQAL*
Ga0126381_10232681513300010376Tropical Forest SoilDAGDIAAKAARSSSMQGNPVPLDHGDLLAILRQAI*
Ga0126381_10306473023300010376Tropical Forest SoilGIGPEHADDIAAKAAVSSSMQGNPIALSRSELKAIVLQAR*
Ga0136449_10077976413300010379Peatlands SoilADDIAAKALTSSSMQGNPVALTQAELKGILLQAL*
Ga0134126_1263263213300010396Terrestrial SoilQAGDIAGKTARSSSMQGNPVPLTDEELRAIVLEAA*
Ga0126383_1159309823300010398Tropical Forest SoilFGLGPQHADDVAAKAARSSSMQGNPVALTDSDLRAIVLQAL*
Ga0126383_1239972523300010398Tropical Forest SoilAAFGLRPQHADDVAAKAARSSSMKGNPAALSRGDLRAIFLRAL*
Ga0137377_1182144423300012211Vadose Zone SoilGPQHVDDVAAKAARSSSMQGNPVALTHSDLRAIVLQAL*
Ga0157379_1067880833300014968Switchgrass RhizosphereGLGPGQADDIAAKAATSSSMQGNPVPLSHDELKAVVLQAL*
Ga0182036_1112227513300016270SoilGVRPEQADEAAAKAAKSSSMQGNPVVLSHDDLRAILLSAL
Ga0182041_1093297523300016294SoilGLGPDNADEIAAKAITSSSMQGNPVSLSQDDLTAILLEAL
Ga0182034_1131269323300016371SoilFGVRVQQADAIAAQAARSSSMQGNPVVLSHDDLRAILLSAL
Ga0187820_118157613300017924Freshwater SedimentQEVDDIAAKALVSSSMKGNPVPLSHADLTAILLQAL
Ga0187807_105588913300017926Freshwater SedimentPQHADEIAAKARTSSSMQGNPVALSHDDLKAALLRTL
Ga0187807_126607313300017926Freshwater SedimentGIQPQQADDIAAKAARSSSMQGNPVTLSPGDLRAILIQAI
Ga0187819_1005840913300017943Freshwater SedimentRHAGEIAAKALLSSSMKGNPVPLSQADLEAILLQAL
Ga0187817_1014764523300017955Freshwater SedimentLATSGVRPQHADEIAAKARTSSSMQGNPVALSHDDLKAALLRTL
Ga0187817_1063214613300017955Freshwater SedimentLATSGVRPQHADEIAAKARTSSSMQGNPVALSHDDLKAALRRTL
Ga0187815_1013176323300018001Freshwater SedimentPQHADEIAAKARTSSSMQGNPVALSHDDLKAALRRTL
Ga0187805_1063872933300018007Freshwater SedimentEPQQAGEIAAKALVSSSMKGNPVPLSQADLEAILLQAL
Ga0187784_1021834333300018062Tropical PeatlandGLGPQHAGDIAAKALTSSSMQGNPVPLSHDDLEAILRQAL
Ga0210401_1139372723300020583SoilLAAFGLVPPDADDIAAKALTSSSMKGNPVILSLADLEAVLIAAL
Ga0213881_1030596013300021374Exposed RockGQAGDIAAKAATSSSMQGNPVPLSHDELAAVVRQAV
Ga0210397_1093596413300021403SoilLLAVPGLATFGVGPQHADEIAAKALTSSSMQGNPVALDHGDLKAILLLAL
Ga0210387_1031573513300021405SoilPGLATFGVGPQHADEIAAKALTSSSMQGNPVALNHGDLKAILLLAL
Ga0210387_1035958813300021405SoilPGLATFGVGPQHADEIAAKALTSSSMQGNPVALDHGDLKAILLLAL
Ga0210394_1065138923300021420SoilRPQHADEIAAKALTSSSMQGNPVALSHGDLTAILQRAL
Ga0210391_1052394313300021433SoilLGSEQADEIAAKAMTSSSMQGNPAVLSRDDLRAVLIQAL
Ga0210390_1039989433300021474SoilRPGDVGEIAAAAARSSSMQGNPVLLSDDDLRAIVLAAL
Ga0210398_1143323723300021477SoilAFGLSLQDVDDVAAKAAASSSMQGNPVVLSHDDLRTILLDAI
Ga0207692_1013729533300025898Corn, Switchgrass And Miscanthus RhizosphereAAFGIGPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIVLQAL
Ga0207692_1064811423300025898Corn, Switchgrass And Miscanthus RhizosphereTAAQAGDIAAKALTSSSMQGNPVPLSQDDLESIVLAAL
Ga0207684_1026329533300025910Corn, Switchgrass And Miscanthus RhizospherePQHADDVAAKALRSSSMQGNPVALSAGDLRAVLLRAI
Ga0207679_1044054333300025945Corn RhizosphereLAAFGIGPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIFLQAL
Ga0207677_1104659613300026023Miscanthus RhizosphereSGVRPQHADDVAAKAAQSSSMQGNPVALSHADLRAIVLQAL
Ga0209577_1012587033300026552SoilVPGLAAFGIGPQHADEIAAKAANSSSMQGNPVALSHADPQTILLQAVNHARSS
Ga0208099_103399223300027096Forest SoilGQIGDVAAKALTSSSMQGNPVPLSRDDLKAVLLQAL
Ga0208725_107018913300027158Forest SoilLAAFGLSLQDVDDVAAKAAGSSSMQGNPVVLSHDDLRTILLDAI
Ga0209114_102167633300027504Forest SoilLGLPDDIATAAAQSSSMKGNPVTLSHADLVAIVHQAIG
Ga0209113_105182423300027517Forest SoilAFGLRPQDAGGIATAAAQSSSMKGNPVTLSHADLVAIVHQAIG
Ga0208043_120310823300027570Peatlands SoilDADDIAAKALTSSSMQGNPVPLSHDDLMDIVLQAL
Ga0208696_117107713300027696Peatlands SoilPQHADEIAAKALTSSSMQGNPVALSHGDLKAILERAL
Ga0209074_1036496513300027787Agricultural SoilGEADGIAAKAATSSSMQGNPVPLSHDELKAVVLQAL
Ga0209060_1010857113300027826Surface SoilGPEQAGEIAAKALVSSSMKGNPVALSPADLEAALLQAL
Ga0209380_1025264023300027889SoilPQDADDIAAKALTSSSMKGNPVILSLADLEAVLVAAL
Ga0209624_1023180633300027895Forest SoilQDVGDVAAKAAASSSMQGNPVVLSDDDLRTILLDAI
Ga0268264_1107530533300028381Switchgrass RhizosphereGPQHAGDVAAKAARSSSMQGNPVTLTPGDLRAIFLQAL
Ga0307296_1029515413300028819SoilPQHADDVAAKAAKSSSMQGNPVALSDSDLRAIFLQSL
Ga0308309_1064883733300028906SoilPEHADEIAAKAMTSSSMQGNPVPLSHEDLRAALIQAL
Ga0311358_1079949423300029915BogGIRPEHADDVAVKAARSSSMQGNPVTLSHRDLRTILLQAI
Ga0310039_1020070213300030706Peatlands SoilFGIRPQHADEIAAKALTSSSMQGNPVALSHGDLKAILERAL
Ga0302326_1089859943300031525PalsaGLASFGLGSEQADEVAAKAMTSSSMQGNPAVLSRDDLRAVLIQAL
Ga0318534_1087267923300031544SoilPGHADDVAAKAAVSSSMQGNPVSLSHDDLKAVFLRAL
Ga0310915_1115619223300031573SoilFGLGPQHADDIAAKASVSSSMKGNPVALSHADLKAILLQAL
Ga0318542_1010980133300031668SoilLGPGQADDIAAKAVRSGSMQGNPVTLSHDELQAIVLQAL
Ga0318542_1021751623300031668SoilQQADDITAKALTSSSMKGNPVALSHADLKAILLQAL
Ga0318542_1055415423300031668SoilFGLGPEDADDIAAKALTSSSMQGNPVALSQDDLTAIILEAL
Ga0318574_1023374313300031680SoilGLASFGIRPQDAGEIAAKAATSSSMQGNPIPLETGELRAIVLQAL
Ga0318574_1072710623300031680SoilDNADEIAAKAITSSSMQGNPVSLSQGDLTAILLEAL
Ga0318493_1011637113300031723SoilGLAAFGLGPGQADDIAAKAMRSGSMQGNPVTLSHDELQAIVLQAL
Ga0318493_1012762233300031723SoilASFGIRPQDAADVAVKAAASSSMQGNPIPLETGELRAIVLQAL
Ga0318500_1066491523300031724SoilIPSLATFGIKPEHAGDIAAKAAVSSSMQGNPIALSHSELKAIVLQAL
Ga0318502_1083783913300031747SoilVSGLAAFGLGPGHADDVAAKAAVSSSMQGNPVSLSHDDLKAVFLRAL
Ga0318494_1013060623300031751SoilEQADEIAAKAARSSSMQGNPVPLSGDELQAIVMAAI
Ga0318554_1015031313300031765SoilQDADAMAAQAARSSSMQGNPVVLSHDDLRAILLSAL
Ga0318521_1056159813300031770SoilGPEDADGIAAKALTSSSMQGNPVALSQGDLTAILLEAL
Ga0318498_1019234313300031778SoilPQDAADVAVKAAASSSMQGNPIPLETGELRAIVLQAL
Ga0318498_1021261413300031778SoilAAFGIGPQDADDIAAKAAVSSSMQGNPIALSHGELHAIVLEAL
Ga0318552_1047494523300031782SoilEPEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL
Ga0318548_1043004323300031793SoilLGPDNADEIAAKAITSSSMQGNPVSLSQDDLTAILLEAL
Ga0318576_1056355323300031796SoilDADGIAAKALTSSSMQGNPVALSQGDLTAILLEAL
Ga0318550_1063751423300031797SoilSEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL
Ga0318568_1054096913300031819SoilRVQDAGDIAAKALTSSSMKGNPVPLSHADLKALLLQAL
Ga0307473_1072425023300031820Hardwood Forest SoilLAAFGLGPEQAAEIAAQALVSSSMKGNPVALSVGNLRAILASAA
Ga0318567_1050177513300031821SoilAAFGLGPGNADDIAAKAMTSSSMQGNPVALSHGDLKAVFLEAL
Ga0318495_1036213613300031860SoilGLAAFGVRAEHADAIVAQAARSSSMQGNPVVLSHDDLRAILLSAL
Ga0306925_1025232433300031890SoilDADDIAAKALTSSSMQGNPVALSQDDLTAIILEAL
Ga0318551_1042506413300031896SoilGVRAEHADAIVAQAARSSSMQGNPVVLSHDDLRAILLSAL
Ga0318520_1063971513300031897SoilLAAFGLGPGNADDIAAKAMTSSSMQGNPVALSHGDLKAIVLEAL
Ga0306923_1063648313300031910SoilFGVRAEHADAIVAQAARSSSMQGNPVVLSHDDLRAILLSAL
Ga0310910_1014148513300031946SoilGVRRDQADEIAAKAAKSSSMQGNPIALSDSDLRAIVLRAL
Ga0306926_1296327723300031954SoilTFGLEPQHADDIAAKALVSSSMKGNPVALSHADLAEILLQAL
Ga0318563_1068041113300032009SoilAAFGLGPDNADEIAAKAITSSSMQGNPVSLSQGDLTAILLEAL
Ga0318507_1013730013300032025SoilPEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL
Ga0318559_1040010523300032039SoilGLGPEHADDVAAKAMTSSSMQGNPVALSHDELKAILLQAL
Ga0318504_1019723813300032063SoilASGLGPPQADDVATKAMASSSMKGNPVPLSHADLKAIFLQAL
Ga0318513_1011016423300032065SoilVRAEHADAIVAQAARSSSMQGNPVVLSHDDLRAILLSAL
Ga0318514_1022676623300032066SoilQADEIAAKAARSSSMQGNPVPLSGDELQAIVMAAI
Ga0318525_1043185523300032089SoilFGIKPEDAEDVAAKAAVSSSMQGNPIALSRGELRAIVLQAL
Ga0318518_1028637513300032090SoilLGPQLADDIAAKALTSSSMKGNPVALSHADLKAILLQAL
Ga0318540_1062298633300032094SoilLAAFGVRRDQADEIAAKAAKSSSMQGNPVALSDSDLRTIVLRAL
Ga0311301_1034006713300032160Peatlands SoilHADEIAAKALTSSSMQGNPVALSHGDLKAILLRAL
Ga0307471_10094904513300032180Hardwood Forest SoilAFGLGPGEADGIAAKAATSSSMQGNPVPLSHDELKAVVLQAL
Ga0335085_1047367033300032770SoilGLAVFGLGPGNADDIAATAMTSSSMQGNPVALSHGDLTAVLLEAL
Ga0335085_1174608613300032770SoilPGLAAFGLGPGNADDIAATAMTSSSMQGNPVALSHDDLTAILLEAL
Ga0335080_1187910923300032828SoilAFGLGPANADDIAATAMTSSSMQGNPVALSHGDLTAVLLEAL
Ga0335081_1089788313300032892SoilAASGIGPQHADDVAARAARSSSMQGNPVALSHSDLCAIVLQAL
Ga0335077_1000613813300033158SoilEHTGDIAAKAARSSSMQGNPAALSDSDLRAIVLQAL
Ga0310811_1091617613300033475SoilPGQADDIAAKAATSSSMQGNPVPLSHDELKAVVLQAL
Ga0370515_0405573_462_5753300034163Untreated Peat SoilPEHADDVAVKAARSSSMQGNPVTLSHRDLRTILLQAI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.