 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F069246 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MAQVSNTPTHSGARRRSQRVLMQVAIRIRGKDAQGKDFEEFTE |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 93.55 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.35 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (73.387 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.806 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.226 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.839 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.90% Coil/Unstructured: 83.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00285 | Citrate_synt | 87.90 |
| PF02678 | Pirin | 1.61 |
| PF00149 | Metallophos | 0.81 |
| PF04909 | Amidohydro_2 | 0.81 |
| PF00266 | Aminotran_5 | 0.81 |
| PF03070 | TENA_THI-4 | 0.81 |
| PF08206 | OB_RNB | 0.81 |
| PF13358 | DDE_3 | 0.81 |
| PF13683 | rve_3 | 0.81 |
| PF12704 | MacB_PCD | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0372 | Citrate synthase | Energy production and conversion [C] | 87.90 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 1.61 |
| COG0557 | Exoribonuclease R | Transcription [K] | 0.81 |
| COG1158 | Transcription termination factor Rho | Transcription [K] | 0.81 |
| COG1278 | Cold shock protein, CspA family | Transcription [K] | 0.81 |
| COG4776 | Exoribonuclease II | Transcription [K] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 73.39 % |
| All Organisms | root | All Organisms | 26.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.10% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.65% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.65% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.65% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.42% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.61% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1005449721 | 3300002245 | Forest Soil | MAQSTNTSVSTGARRRSQRVLMQVAVRIRGTDAQGAAIEEE |
| JGI25616J43925_100833522 | 3300002917 | Grasslands Soil | MAQVSNTLTHTSARRRSQRVLMQVAIRIRGKDAQGKDFEEFTETL |
| Ga0062384_1007747401 | 3300004082 | Bog Forest Soil | MAQVSNTSNTTGARRRSQRVLMQVAVRIRGTDAAGQIFEEEAETL |
| Ga0062387_1001063221 | 3300004091 | Bog Forest Soil | MSPCIVEERGSMAQASNTPTTTGARRRSQRVLMQVAVRIRGTDAQGQTFEEETDTLAI |
| Ga0066395_103523521 | 3300004633 | Tropical Forest Soil | MVQINHKPTGAGARRRSQRVLMQVPVRMRGEDAQGKAFEEYGETLAI |
| Ga0062388_1015691383 | 3300004635 | Bog Forest Soil | MAQVSNTSTTTGARRRSQRVLMQVAVRIRGTDAAGQIFEEEAETL |
| Ga0066672_104031672 | 3300005167 | Soil | MVQVSYTTTHTGARLRSQRVLMQVPVRIRGKNAQGAEFEEFTE |
| Ga0066679_103663752 | 3300005176 | Soil | MHAGARRRSQRVLMQVGIRIRGKDTQGKDFEEFTETLAINAHG |
| Ga0066688_100955211 | 3300005178 | Soil | MFRVSTTPTHALSRRRSQRVLMQVGIRVRGKDAQGKDFEEMTETLAINAH |
| Ga0068869_1006864282 | 3300005334 | Miscanthus Rhizosphere | MGNTPNTSVGAGARRRSQRVLMQVAVRIRGTDAQGKQVDEEA |
| Ga0070704_1011442782 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNTPNTSVGAGARRRSQRVLMQVAVRIRGTDAQGKQVDEEAE |
| Ga0066699_108912882 | 3300005561 | Soil | MFRVSTTPTHALSRRRSQRVLMQVGIRVRGKDAQG |
| Ga0066703_106247051 | 3300005568 | Soil | MAQVSNTTAHTGVRRRSQRVLMQVPVRIRGKNAQGAEFDEHTE |
| Ga0066703_108808221 | 3300005568 | Soil | MAHVSNTTAHTGVRRRSQRVLMQVPVRIRGKNAQGAEFDEHTE |
| Ga0066708_105120222 | 3300005576 | Soil | MAQVSNTTAHTGVRRRSQRVLMQVPVRIRGKNAQGAEFDEHTETL |
| Ga0070761_103192841 | 3300005591 | Soil | MAQSTNTTPNTGARRRSQRVLMQVAVRIRGTDPQGHKIEEETETLA |
| Ga0066706_110892662 | 3300005598 | Soil | MSQVSQTPIHTAGTRRRSQRVLMQVSIRIRGKDAQGKDFEEMTET |
| Ga0066652_1013202941 | 3300006046 | Soil | MAQVSNTTAHTGVRRRSQRVLMQVPVRIRGKNAQGAEFDEHTETLAI |
| Ga0075017_1008219401 | 3300006059 | Watersheds | MSRVSNPSANPVARRRSQRVLMQVGIRIRGENTKGTPFEE |
| Ga0075019_106622371 | 3300006086 | Watersheds | MSQGTITPLNPVSRRRSQRVLMQVSVRLRGKDAQGRDFEEFTET |
| Ga0070716_1006315811 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQGSYTPLHPGARRRSQRVLMQVGVRIRGKDAQGKDFEEFT |
| Ga0070765_1005236031 | 3300006176 | Soil | MAQVANTPSNTGARRRSQRVLMQVAVRIRGTDAQG |
| Ga0079222_121438691 | 3300006755 | Agricultural Soil | MSQVSTPHTHTGARRRSQRVLMQVGVRVRGKDAQGKDFEEGTETLAIN |
| Ga0066658_106986942 | 3300006794 | Soil | MTQVSNTPMHAGARRRSQRVLMQVGIRIRGKDSQGKDFEEFTETLAINAH |
| Ga0066665_108000661 | 3300006796 | Soil | MAQVSHSPLRTSARRRSQRVLMQVGILIRGKDTHETPFEEQTETLAINAHGALI |
| Ga0073928_1000627515 | 3300006893 | Iron-Sulfur Acid Spring | MSQNPNGSSHVARRRSQRVLMQVAVRIRGEDVQGKNIEEETE |
| Ga0073928_111029012 | 3300006893 | Iron-Sulfur Acid Spring | MGQNPNGSSHVARRRSQRVLMQVAVRIRGEDVQGKNIEEETE |
| Ga0099793_101375112 | 3300007258 | Vadose Zone Soil | MAQVSNTPTHSGARRRSQRVLMQVAIRIRGKDAQGKDFEEFTE |
| Ga0099793_102249822 | 3300007258 | Vadose Zone Soil | MNQGSYTPLHPGARRLSQRVLMQVGVRIRGKDAQGKDF |
| Ga0099829_117685441 | 3300009038 | Vadose Zone Soil | MARVPNTPIHTGARRRSQRVLMQVGVRVSGADALGNNFEEYTETL |
| Ga0099828_102002092 | 3300009089 | Vadose Zone Soil | MAQVPNTPTHTGAKRRSQRVLMQVGIRIRGKDAQGKDFEEFTQ |
| Ga0099828_102956102 | 3300009089 | Vadose Zone Soil | MAEIPNRTTHKGARRRSQRVLMQVGIRIRGKDAQGKDFEEF |
| Ga0099828_118103242 | 3300009089 | Vadose Zone Soil | MAQVPNTPTHLGAKRRSQRVLMQVGIRIRGKDAQGKDFEEFTQTL |
| Ga0099828_120439972 | 3300009089 | Vadose Zone Soil | MARVPNTPIHTGARRRSQRVLMQVGVRVSGADALGKNFEEHTETLA |
| Ga0099792_108804952 | 3300009143 | Vadose Zone Soil | MSQANNASTNPVARRRSQRVLMQVAVRIRGEDVLGKNIEEETE |
| Ga0126384_115648812 | 3300010046 | Tropical Forest Soil | MAQGSNMPGNPGPRRRSQRVLMQVPVRLHGMDAQGSKFDEE |
| Ga0126384_121833951 | 3300010046 | Tropical Forest Soil | MSQVSAPHTQTGARRRSQRVLMQVGIRVRGKDAQGKDFEEITETLAINAHGA |
| Ga0126373_102920442 | 3300010048 | Tropical Forest Soil | MAQISNMPTNMGARRRSQRVLMQVPVRIRGTDSQGKSLDEETETLA |
| Ga0134063_103092591 | 3300010335 | Grasslands Soil | MNQGSYTPLHPGARRRSQRVLMQVGVRIRGKDAQGKD |
| Ga0074044_103493171 | 3300010343 | Bog Forest Soil | MAQVSNTSTTTGARRRSQRVLMQVAVRIRGTDARGQT |
| Ga0126376_132489822 | 3300010359 | Tropical Forest Soil | MSQVPTPHIPSGARRRSQRVLMQVGIRVRGKDAQG |
| Ga0126378_118272672 | 3300010361 | Tropical Forest Soil | MVQVSNTSLNLGGARRRSQRVLMQVGVRIRGTDAKGT |
| Ga0137391_102828481 | 3300011270 | Vadose Zone Soil | MAQVPSTPIHTGAKRRSQRVLMQVGIRIRGKDAQGKDFEELTQTLAI |
| Ga0137391_112256481 | 3300011270 | Vadose Zone Soil | MHRGARRRSQRVLMQVAIRLRGKDAQGNEFEEFTET |
| Ga0137388_111204362 | 3300012189 | Vadose Zone Soil | MGQVSNTINPAARRRSQRVLMQVAVRISGQDSQGKPLEEETETLAINAHG |
| Ga0137382_102548302 | 3300012200 | Vadose Zone Soil | MNQGSYTPLHPGARRRSQRVLMQVGVRIRGKDAQGKDFEEFTA |
| Ga0137363_103985492 | 3300012202 | Vadose Zone Soil | MAEVPHTPVHAGARRRSQRVLMQVGIRMRGKDAQGKDFEEFTETLAI |
| Ga0137381_117295782 | 3300012207 | Vadose Zone Soil | MARVPNTPIYTGARRRSQRVLMQVGVRVSGADALGK |
| Ga0137379_109649241 | 3300012209 | Vadose Zone Soil | MAQVSNTPTHKGARRRSQRVLMQVPVRVRGKNAQGADFEEFTETLAINAH |
| Ga0137366_104436742 | 3300012354 | Vadose Zone Soil | MARVPNTPFHTGTRRRSQRVLMQVGVRVNGTNALGKNFEEHTETL |
| Ga0137385_116228192 | 3300012359 | Vadose Zone Soil | MARVPNTPIYTGARRRSQRVLMQVGVRVSGADALG |
| Ga0137390_107740971 | 3300012363 | Vadose Zone Soil | MNPVARRRSQRVLMQVSVRIRGEDAQGRSIEEETETLAIN |
| Ga0137419_106833832 | 3300012925 | Vadose Zone Soil | MAQSPITPANSGARRRSQRVLMQVALRLRGVDAQGQDF |
| Ga0137407_118321542 | 3300012930 | Vadose Zone Soil | MGQSPNIPGHPGPKRRSQRVLMQVPIRICGKDAQGKKFEEE |
| Ga0137407_123878461 | 3300012930 | Vadose Zone Soil | MAQVSNTPIHTGARRRSQRVLMQVGVRIRGKDTQGKDFEEFSETLAINAH |
| Ga0164303_105117862 | 3300012957 | Soil | MAQSPITSSTSGARRRSQRVLMHVALRLRGVDTQG |
| Ga0126369_132369981 | 3300012971 | Tropical Forest Soil | MAQPNNPPVHPGPKRRSQRVLMQVPVRLRGQDAQGGIFDEE |
| Ga0134077_104106752 | 3300012972 | Grasslands Soil | MAQVSNTTAHTGVRRRSQRVLMQVPVRIRGKNAQGAEFDEHTETLAIN |
| Ga0137411_11166151 | 3300015052 | Vadose Zone Soil | MAQNPVTTSNSGARRRSQRVLMQVPLRLRGVDAQGQNFEEFTETLSINAH |
| Ga0137411_12229512 | 3300015052 | Vadose Zone Soil | MSQANNASMNPVARRRSQRVLMQVAVRIRGEDVLGKNIEEETETLAINA |
| Ga0137420_12814402 | 3300015054 | Vadose Zone Soil | MAQSPITPANSGARRRSQRVLMQDPLRLRGVDAQGRNFEEFTETLAINAHGALVL |
| Ga0137412_100800171 | 3300015242 | Vadose Zone Soil | MSQANNASTNPVARRRSQRVLMQVGVRISGKDVLGKN |
| Ga0187779_113086192 | 3300017959 | Tropical Peatland | MTQISPTPTNTGARRRSQRVLMQVGVQIRGKDAQGK |
| Ga0066655_114074871 | 3300018431 | Grasslands Soil | MSQVTPTKAHSGVRRRSQRVLMQVGVRVRGKAAQGK |
| Ga0066669_124259402 | 3300018482 | Grasslands Soil | MAQVSNTTAHTGARRRSQRVLMQVPVRIRGKNAQGAE |
| Ga0193753_104430651 | 3300020034 | Soil | MAQVTNPSSNPVARRRSQRVLMQVSVRIRGNDAQGKAFEEQTE |
| Ga0179592_104605721 | 3300020199 | Vadose Zone Soil | MSQANNASMNPVARRRSQRVLMQVAVRIRGEDVLGKNIEEETETLA |
| Ga0210407_109903201 | 3300020579 | Soil | MAQGSGARRRSQRVLMQVGVRIRGNDAQGKGFEEITET |
| Ga0210407_111153552 | 3300020579 | Soil | MAQVTNTPTNAGTRRRSQRVLMQVAVRIRGTDAQGKAVEEEAQTL |
| Ga0210403_109304982 | 3300020580 | Soil | MDQVSNTPPHTVRRRSQRILMQVPIRVRGKDAQGKD |
| Ga0210399_110967511 | 3300020581 | Soil | MNPVARRRSQRVLMQVAVRIRGEDVQGKNIEEETETLAISAHGALVLM |
| Ga0210408_103406551 | 3300021178 | Soil | MAQVSNTSAGTGARRRSQRVLMQVGVRIRGTDAQGKTIDEET |
| Ga0210408_110314642 | 3300021178 | Soil | MAQVSNTVNPAARRRSQRVLMQVAVRISGQDSQGK |
| Ga0210393_115363382 | 3300021401 | Soil | MAQPTNATPNTGARRRSQRVLMQVAVRIRGTDPQGHKIEEETETLAINAHGAL |
| Ga0210385_102884063 | 3300021402 | Soil | MAQSTNTTPNTGARRRSQRVLMQVAVRIRGTDPQGHKVEEETETLAINAHGAL |
| Ga0210387_114748731 | 3300021405 | Soil | MAQSTNTTPNTGARRRSQRVLMQVAVRIRGNDAQGHKIEEETETLA |
| Ga0210386_115147181 | 3300021406 | Soil | MGQSPNTPAHPGPRRRSQRVLMQVPIRIWGNDAQGKKFEEE |
| Ga0210383_117692451 | 3300021407 | Soil | MAQVTNTPTGTGARRRSQRVLMQVPVRIRGTDAQGKAV |
| Ga0210384_117248272 | 3300021432 | Soil | MAQVSNNPVNTGARRRSQRVLMQVGVRIRGVDSQGKAFEEYTETLAIN |
| Ga0210390_111373211 | 3300021474 | Soil | MAQSTNTTPNTGARRRSQRVLMQVAVRIRGTDPQGHKVE |
| Ga0210410_106668672 | 3300021479 | Soil | MAQVSNTPTHTGARRRSQRVLMQVPIRLRGTDVQGKDFEE |
| Ga0210409_111473642 | 3300021559 | Soil | MAQSTNTSVSTGARRRSQRVLMQVAVRIRGTDAQGAAIEEETETLAINAH |
| Ga0126371_133607031 | 3300021560 | Tropical Forest Soil | MVQINHKPTGAGARRRSQRVLMQVPVRMRGEDAQGKAFEEYDETLAINAHG |
| Ga0222729_10746301 | 3300022507 | Soil | MTQVPNTPVHAGARRRSQRVLMQVGIRIRGKDTQGKDFEEFTET |
| Ga0137417_13667201 | 3300024330 | Vadose Zone Soil | MHAGARRRSQRVLMQVAIRIRGKDAQGKDFEEFTETLAI |
| Ga0207704_106151291 | 3300025938 | Miscanthus Rhizosphere | MGNTPNTSVGAGARRRSQRVLMQVAVRIRGTDAQGKQVDEEAETLAI |
| Ga0209838_10792001 | 3300026214 | Soil | MAQATNTTPNTGARRRSQRVLMQVAVRIRGNDAQGTK |
| Ga0209350_11333771 | 3300026277 | Grasslands Soil | MHAGARRRSQRVLMQVGIRIRGKDSQGKDFEEFTET |
| Ga0209234_10498701 | 3300026295 | Grasslands Soil | MQGSNTPMHPGARRRSQRVLMQVAIRIRGKDAQGKDFE |
| Ga0209265_10020171 | 3300026308 | Soil | MSQVSQTPIHTAGTRRRSQRVLMQVSIRIRGKDAQGKDFEEMTETLAINA |
| Ga0209131_13423861 | 3300026320 | Grasslands Soil | MSQANNASTNPVARRRSQRVLMQVGVRISGKDVLGKNIE |
| Ga0209470_13273121 | 3300026324 | Soil | MAQVPSTPIHTGAKRRSQRVLMQVPIRMRGKDAQGKEF |
| Ga0209804_10835442 | 3300026335 | Soil | MHAGARRRSQRVLMQVGIRIRGKDSQGKDFEEFTETLAINAHGSL |
| Ga0257157_10069882 | 3300026496 | Soil | MAQVSNTPTHSGARRRSQRVLMQVAIRIRGKDAQGKDF |
| Ga0257157_10679401 | 3300026496 | Soil | MTQVPNTPMHAGVRRRSQRVLMQVGIRIRGKDTQGK |
| Ga0209160_10583963 | 3300026532 | Soil | MAQVPSTPTHTSAKRRSQRVLMQVGIRIRGKDAQGKEFE |
| Ga0209648_100717311 | 3300026551 | Grasslands Soil | MNPIARRRSQRVLMQVAVRIRGEDVQGKSIEEETQ |
| Ga0179587_103167202 | 3300026557 | Vadose Zone Soil | MAQVSNTPTHSGARRRSQRVLMQVAIRIRGKDVQGKDFEEFTET |
| Ga0208097_10084342 | 3300027173 | Forest Soil | MDQVSNTPPHTVRRRSQRILMQVPIRVRGKDAQGKDFEEYT |
| Ga0209388_10291342 | 3300027655 | Vadose Zone Soil | MHAGVRRRSQRVLMQVAIRIRGKDAQGKDFEEFTETL |
| Ga0208990_11941972 | 3300027663 | Forest Soil | MTQVSNVPAHTGAKRRSQRVLVQVGVRIRGKDAQGKDFEENTQTL |
| Ga0209178_10018736 | 3300027725 | Agricultural Soil | MSQVFTPHTPSGARRRSQRVLMQVGIRVRGKDAQGK |
| Ga0209038_102341701 | 3300027737 | Bog Forest Soil | MAQVTNTSLNTGAKRRSQRVLMQVGVRIRGTDAQGKPIDEETETLAINAHGALVML |
| Ga0209655_100265421 | 3300027767 | Bog Forest Soil | MAQVSNTSTTTGARRRSQRVLMQVAVRIRGTDAQGQTFEEEAETLAIN |
| Ga0209701_104162421 | 3300027862 | Vadose Zone Soil | MSQANNASTNPVARRRSQRVLMQVAVRIRGADVLGKNIEEETETL |
| Ga0209283_101132591 | 3300027875 | Vadose Zone Soil | MAQVPNTPTHTGAKRRSQRVLMQVGIRIRGKDAQGKDFEEFTQTLAIN |
| Ga0209283_105465812 | 3300027875 | Vadose Zone Soil | MAQVPNTPTHLGAKRRSQRVLMQVGIRIRGKDAQGKDFEEFTQT |
| Ga0268265_113319411 | 3300028380 | Switchgrass Rhizosphere | MGNTPNTSVGAGARRRSQRVLMQVAVRIRGTDAQGKQVDEEAETLAINAHG |
| Ga0308309_107630561 | 3300028906 | Soil | MAQSTNTTPNTGARRRSQRVLMQVAVRIRGTDPQGHKVEEETE |
| Ga0170819_168655611 | 3300031469 | Forest Soil | MSQVISSVPTNPAVRRRSQRVLMQVGVRIRGTDTHHKPF |
| Ga0318528_100881072 | 3300031561 | Soil | MFQVSTTPTNAASRRRSQRVLMQVGIRVRGKDAQGKDFEEMT |
| Ga0318561_103817062 | 3300031679 | Soil | MFQVSTTPTNAASRRRSQRVLMQVGIRVRGKDAQGKDFE |
| Ga0310686_1148981072 | 3300031708 | Soil | VRRRSQRVLMQVAVRVKGKDAQGNAFEEETETLAIN |
| Ga0307469_111799441 | 3300031720 | Hardwood Forest Soil | MSLPTVTASNTGARRRSQRVLMQVSVRLNGIDAQGKPFDEEADTL |
| Ga0307469_115638121 | 3300031720 | Hardwood Forest Soil | MAQVPNTPPTGPKRRSQRVLMQVPIRVRGVDAQGKSFAEETETLAISAHGAL |
| Ga0318492_100812152 | 3300031748 | Soil | MFQVSTTPTNAASRRRSQRVLMQVGIRVRGICWCC |
| Ga0307477_109377491 | 3300031753 | Hardwood Forest Soil | MSDVSNTPTYPAARRRSQRVLMQVGIHVRGKDAQGKDFAEYTKTLAINAH |
| Ga0307477_110457871 | 3300031753 | Hardwood Forest Soil | MGKAHNVSMNPVARRRSQRVLMQVAVRIRGEDVKGESIEE |
| Ga0318567_101382721 | 3300031821 | Soil | MFQVSTTPTNAASRRRSQRVLMQVGIRVRGKDAQGK |
| Ga0307479_106774822 | 3300031962 | Hardwood Forest Soil | MAEFPHTPVHTGARRRSQRVLMQVGVRMRGKDAQGKDF |
| Ga0307479_119882351 | 3300031962 | Hardwood Forest Soil | MAQAHNATMNPVARRRSQRVLMQVAVRIRGEDVQGHGIEEETETLAINAHGAL |
| Ga0307471_1004047221 | 3300032180 | Hardwood Forest Soil | MGKAQNTSMNPVARRRSQRVLMQVAVRIRGEDVKGENIEEETETLAINAH |
| Ga0335079_122322382 | 3300032783 | Soil | MSQVSQTSANTGTKRRSQRVLMQVGVRIRGKDAQGSDFQEDTETLA |
| Ga0335080_101331831 | 3300032828 | Soil | MAQVPNAPTGAVARRRSQRVLMQVAIRMRGQDSQGHPF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |