Metagenome / Metatranscriptome Family F069231

Basic Information
Family ID	F069231
Family Type	Metagenome / Metatranscriptome
Number of Sequences	124
Average Sequence Length	39 residues
Representative Sequence	AYRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV
Number of Associated Samples	114
Number of Associated Scaffolds	124

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	98.39 %
% of genes from short scaffolds (< 2000 bps)	93.55 %
Associated GOLD sequencing projects	109
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.43

Most Common Taxonomy
Group	Bacteria (93.548 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.710 % of family members)
Environment Ontology (ENVO)	Unclassified (25.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (42.742 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 28.36% β-sheet: 0.00% Coil/Unstructured: 71.64%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 124 Family Scaffolds
PF00005	ABC_tran	8.06
PF00072	Response_reg	7.26
PF07978	NIPSNAP	5.65
PF00296	Bac_luciferase	5.65
PF07690	MFS_1	4.03
PF04120	Iron_permease	3.23
PF04072	LCM	2.42
PF01266	DAO	2.42
PF05685	Uma2	2.42
PF08241	Methyltransf_11	1.61
PF01207	Dus	1.61
PF01208	URO-D	1.61
PF13416	SBP_bac_8	1.61
PF14384	BrnA_antitoxin	1.61
PF13302	Acetyltransf_3	1.61
PF08448	PAS_4	1.61
PF02720	DUF222	1.61
PF02771	Acyl-CoA_dh_N	1.61
PF01408	GFO_IDH_MocA	0.81
PF00664	ABC_membrane	0.81
PF10137	TIR-like	0.81
PF09365	DUF2461	0.81
PF09619	YscW	0.81
PF02452	PemK_toxin	0.81
PF01799	Fer2_2	0.81
PF13649	Methyltransf_25	0.81
PF00069	Pkinase	0.81
PF09851	SHOCT	0.81
PF00881	Nitroreductase	0.81
PF10518	TAT_signal	0.81
PF00126	HTH_1	0.81
PF00561	Abhydrolase_1	0.81
PF00528	BPD_transp_1	0.81
PF03069	FmdA_AmdA	0.81
PF13620	CarboxypepD_reg	0.81
PF00583	Acetyltransf_1	0.81
PF01979	Amidohydro_1	0.81
PF13561	adh_short_C2	0.81
PF00149	Metallophos	0.81
PF06841	Phage_T4_gp19	0.81
PF04392	ABC_sub_bind	0.81
PF00496	SBP_bac_5	0.81
PF02627	CMD	0.81
PF01557	FAA_hydrolase	0.81
PF04365	BrnT_toxin	0.81
PF12847	Methyltransf_18	0.81

COG ID	Name	Functional Category	% Frequency in 124 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	5.65
COG0515	Serine/threonine protein kinase	Signal transduction mechanisms [T]	3.23
COG3315	O-Methyltransferase involved in polyketide biosynthesis	Secondary metabolites biosynthesis, transport and catabolism [Q]	2.42
COG4636	Endonuclease, Uma2 family (restriction endonuclease fold)	General function prediction only [R]	2.42
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	1.61
COG0407	Uroporphyrinogen-III decarboxylase HemE	Coenzyme transport and metabolism [H]	1.61
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	1.61
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	0.81
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	0.81
COG2337	mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module	Defense mechanisms [V]	0.81
COG2421	Acetamidase/formamidase	Energy production and conversion [C]	0.81
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	0.81
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.81

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.55 %
Unclassified	root	N/A	6.45 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.55 %
Unclassified	root	N/A	6.45 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.55 %
Unclassified	root	N/A	6.45 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	34.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	12.90 %
Unclassified	root	N/A	6.45 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2.42 %
Nitrospinae/Tectomicrobia group	clade	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group	0.81 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	34.68 %
Unclassified	root	N/A	6.45 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2.42 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.42 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.61 %
Candidatus Tectomicrobia	phylum	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia	0.81 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	34.68 %
Unclassified	root	N/A	6.45 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.61 %
Pseudomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales	0.81 %
Candidatus Entotheonella	genus	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella	0.81 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.81 %
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	0.81 %

Name	Rank	Taxonomy	Distribution
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	26.61 %
Unclassified	root	N/A	6.45 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.61 %
unclassified Chloroflexia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia	0.81 %
Phyllobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae	0.81 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.81 %
Pseudomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	26.61 %
Unclassified	root	N/A	6.45 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.61 %
Mesorhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium	0.81 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.81 %
Pseudomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas	0.81 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	26.61 %
Unclassified	root	N/A	6.45 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.61 %
unclassified Mesorhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium	0.81 %
unclassified Pseudomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas	0.81 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.81 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.81 %

Name	Rank	Taxonomy	Distribution
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	26.61 %
Unclassified	root	N/A	6.45 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.61 %
Mesorhizobium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	0.81 %
Pseudomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp.	0.81 %
Chloroflexia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	0.81 %
Candidatus Entotheonella factor	species	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	0.81 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000891\|JGI10214J12806_11355779	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300000955\|JGI1027J12803_109101740	Not Available	776	Open in IMG/M
3300002245\|JGIcombinedJ26739_100912684	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	761	Open in IMG/M
3300004025\|Ga0055433_10127610	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	600	Open in IMG/M
3300005290\|Ga0065712_10623291	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	580	Open in IMG/M
3300005295\|Ga0065707_10843572	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300005332\|Ga0066388_108212267	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	521	Open in IMG/M
3300005344\|Ga0070661_101920592	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300005444\|Ga0070694_100262091	All Organisms → cellular organisms → Bacteria → Proteobacteria	1311	Open in IMG/M
3300005447\|Ga0066689_10116674	All Organisms → cellular organisms → Bacteria → Proteobacteria	1552	Open in IMG/M
3300005447\|Ga0066689_10669332	Not Available	651	Open in IMG/M
3300005536\|Ga0070697_102142512	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	500	Open in IMG/M
3300005540\|Ga0066697_10480648	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300005546\|Ga0070696_101127458	All Organisms → cellular organisms → Bacteria	660	Open in IMG/M
3300005552\|Ga0066701_10460608	All Organisms → cellular organisms → Bacteria	789	Open in IMG/M
3300005555\|Ga0066692_10387099	All Organisms → cellular organisms → Bacteria	886	Open in IMG/M
3300005558\|Ga0066698_10225408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp.	1288	Open in IMG/M
3300005586\|Ga0066691_10033020	All Organisms → cellular organisms → Bacteria	2687	Open in IMG/M
3300005617\|Ga0068859_100782118	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1043	Open in IMG/M
3300005764\|Ga0066903_100341324	All Organisms → cellular organisms → Bacteria	2412	Open in IMG/M
3300005764\|Ga0066903_101081563	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1476	Open in IMG/M
3300005764\|Ga0066903_107264071	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	573	Open in IMG/M
3300005829\|Ga0074479_10062653	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	656	Open in IMG/M
3300005842\|Ga0068858_100860205	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	886	Open in IMG/M
3300006046\|Ga0066652_100159160	All Organisms → cellular organisms → Bacteria	1902	Open in IMG/M
3300006173\|Ga0070716_101228065	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300006844\|Ga0075428_101219382	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	793	Open in IMG/M
3300006854\|Ga0075425_101107025	All Organisms → cellular organisms → Bacteria	902	Open in IMG/M
3300006871\|Ga0075434_101822140	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	615	Open in IMG/M
3300006881\|Ga0068865_101235105	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300006904\|Ga0075424_100853002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	972	Open in IMG/M
3300006954\|Ga0079219_12310605	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	520	Open in IMG/M
3300006969\|Ga0075419_11152296	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	570	Open in IMG/M
3300009012\|Ga0066710_103643795	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300009038\|Ga0099829_11282621	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	606	Open in IMG/M
3300009089\|Ga0099828_10837904	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	823	Open in IMG/M
3300009100\|Ga0075418_10750598	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1053	Open in IMG/M
3300009137\|Ga0066709_100463495	All Organisms → cellular organisms → Bacteria → Proteobacteria	1775	Open in IMG/M
3300009137\|Ga0066709_102370011	All Organisms → cellular organisms → Bacteria	723	Open in IMG/M
3300009147\|Ga0114129_10060254	All Organisms → cellular organisms → Bacteria	5307	Open in IMG/M
3300009162\|Ga0075423_10258818	Not Available	1823	Open in IMG/M
3300009176\|Ga0105242_12827221	All Organisms → cellular organisms → Bacteria	536	Open in IMG/M
3300009792\|Ga0126374_11887235	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	502	Open in IMG/M
3300009803\|Ga0105065_1052902	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300009805\|Ga0105079_1045730	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	511	Open in IMG/M
3300009820\|Ga0105085_1082650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.	612	Open in IMG/M
3300009821\|Ga0105064_1094961	All Organisms → cellular organisms → Bacteria → Proteobacteria	606	Open in IMG/M
3300010046\|Ga0126384_10780251	All Organisms → cellular organisms → Bacteria	854	Open in IMG/M
3300010046\|Ga0126384_12068473	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	546	Open in IMG/M
3300010047\|Ga0126382_10738567	Not Available	831	Open in IMG/M
3300010048\|Ga0126373_13166710	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300010320\|Ga0134109_10060955	All Organisms → cellular organisms → Bacteria → Proteobacteria	1263	Open in IMG/M
3300010359\|Ga0126376_10225026	All Organisms → cellular organisms → Bacteria	1575	Open in IMG/M
3300010360\|Ga0126372_10762702	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300010398\|Ga0126383_11100957	All Organisms → cellular organisms → Bacteria	884	Open in IMG/M
3300010400\|Ga0134122_12746282	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	545	Open in IMG/M
3300010401\|Ga0134121_10451998	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1173	Open in IMG/M
3300010403\|Ga0134123_13129412	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	532	Open in IMG/M
3300011271\|Ga0137393_10567191	All Organisms → cellular organisms → Bacteria	974	Open in IMG/M
3300012189\|Ga0137388_11392143	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300012198\|Ga0137364_10806866	All Organisms → cellular organisms → Bacteria	709	Open in IMG/M
3300012203\|Ga0137399_11791823	All Organisms → cellular organisms → Bacteria	502	Open in IMG/M
3300012204\|Ga0137374_10114169	All Organisms → cellular organisms → Bacteria → Proteobacteria	2504	Open in IMG/M
3300012205\|Ga0137362_10364801	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1251	Open in IMG/M
3300012358\|Ga0137368_10500909	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	783	Open in IMG/M
3300012360\|Ga0137375_10384568	All Organisms → cellular organisms → Bacteria	1232	Open in IMG/M
3300012362\|Ga0137361_10600887	All Organisms → cellular organisms → Bacteria	1008	Open in IMG/M
3300012399\|Ga0134061_1308857	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	705	Open in IMG/M
3300012917\|Ga0137395_10176290	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1477	Open in IMG/M
3300012917\|Ga0137395_10523498	All Organisms → cellular organisms → Bacteria → Proteobacteria	855	Open in IMG/M
3300012918\|Ga0137396_10998129	Not Available	606	Open in IMG/M
3300012930\|Ga0137407_11527335	All Organisms → cellular organisms → Bacteria → Proteobacteria	635	Open in IMG/M
3300012944\|Ga0137410_11348683	Not Available	618	Open in IMG/M
3300012948\|Ga0126375_10524998	All Organisms → cellular organisms → Bacteria	888	Open in IMG/M
3300012971\|Ga0126369_10711943	All Organisms → cellular organisms → Bacteria	1082	Open in IMG/M
3300012971\|Ga0126369_12386855	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	615	Open in IMG/M
3300012972\|Ga0134077_10115054	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1052	Open in IMG/M
3300014269\|Ga0075302_1146836	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	569	Open in IMG/M
3300014324\|Ga0075352_1174484	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	620	Open in IMG/M
3300015241\|Ga0137418_10261927	All Organisms → cellular organisms → Bacteria	1462	Open in IMG/M
3300015356\|Ga0134073_10257206	Not Available	605	Open in IMG/M
3300015372\|Ga0132256_101566964	All Organisms → cellular organisms → Bacteria	769	Open in IMG/M
3300015373\|Ga0132257_104275035	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	520	Open in IMG/M
3300016270\|Ga0182036_10790370	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	773	Open in IMG/M
3300016371\|Ga0182034_10707042	All Organisms → cellular organisms → Bacteria	857	Open in IMG/M
3300017656\|Ga0134112_10148547	All Organisms → cellular organisms → Bacteria	901	Open in IMG/M
3300017659\|Ga0134083_10429996	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300018000\|Ga0184604_10000784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3941	Open in IMG/M
3300018028\|Ga0184608_10294332	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	714	Open in IMG/M
3300018079\|Ga0184627_10120101	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1391	Open in IMG/M
3300018084\|Ga0184629_10089411	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1489	Open in IMG/M
3300018431\|Ga0066655_11312038	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	520	Open in IMG/M
3300018433\|Ga0066667_10354512	All Organisms → cellular organisms → Bacteria	1168	Open in IMG/M
3300018433\|Ga0066667_10784885	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	808	Open in IMG/M
3300023067\|Ga0247743_1027975	All Organisms → cellular organisms → Bacteria	758	Open in IMG/M
3300025910\|Ga0207684_10255483	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1512	Open in IMG/M
3300025911\|Ga0207654_11192961	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	555	Open in IMG/M
3300025922\|Ga0207646_10481799	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	1118	Open in IMG/M
3300025930\|Ga0207701_10961070	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300025941\|Ga0207711_10331705	All Organisms → cellular organisms → Bacteria	1407	Open in IMG/M
3300025965\|Ga0210090_1038729	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300026298\|Ga0209236_1130862	All Organisms → cellular organisms → Bacteria	1094	Open in IMG/M
3300026328\|Ga0209802_1002581	All Organisms → cellular organisms → Bacteria	12494	Open in IMG/M
3300026332\|Ga0209803_1100736	All Organisms → cellular organisms → Bacteria	1181	Open in IMG/M
3300026333\|Ga0209158_1010311	All Organisms → cellular organisms → Bacteria	4639	Open in IMG/M
3300026469\|Ga0257169_1077061	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300026536\|Ga0209058_1319186	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300027527\|Ga0209684_1065035	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	567	Open in IMG/M
3300027775\|Ga0209177_10104536	All Organisms → cellular organisms → Bacteria → Proteobacteria	903	Open in IMG/M
3300027876\|Ga0209974_10146235	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	851	Open in IMG/M
3300027909\|Ga0209382_10516682	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1313	Open in IMG/M
3300027909\|Ga0209382_11250791	All Organisms → cellular organisms → Bacteria	756	Open in IMG/M
3300027954\|Ga0209859_1032262	All Organisms → cellular organisms → Bacteria → Proteobacteria	880	Open in IMG/M
3300028381\|Ga0268264_10472205	All Organisms → cellular organisms → Bacteria	1219	Open in IMG/M
3300031720\|Ga0307469_11343930	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	680	Open in IMG/M
3300031764\|Ga0318535_10518192	All Organisms → cellular organisms → Bacteria	529	Open in IMG/M
3300031858\|Ga0310892_11304680	Not Available	520	Open in IMG/M
3300031903\|Ga0307407_10434673	All Organisms → cellular organisms → Bacteria	949	Open in IMG/M
3300031946\|Ga0310910_10968173	All Organisms → cellular organisms → Bacteria	666	Open in IMG/M
3300032013\|Ga0310906_10784368	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium	672	Open in IMG/M
3300032122\|Ga0310895_10153899	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	995	Open in IMG/M
3300032174\|Ga0307470_10042605	All Organisms → cellular organisms → Bacteria	2261	Open in IMG/M
3300032174\|Ga0307470_11871909	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	510	Open in IMG/M
3300032180\|Ga0307471_104288456	All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor	504	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	81.45%
Host-Associated	Host-Associated	18.55%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	75.81%
Plants	Host-Associated → Plants	18.55%
Aquatic	Environmental → Aquatic	5.65%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	75.81%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.90%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.65%
Sediment	Environmental → Aquatic → Sediment	4.03%
Marine	Environmental → Aquatic → Marine	1.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	60.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	11.29%
Loam	Environmental → Terrestrial → Soil → Loam	9.68%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.03%
Sand	Environmental → Terrestrial → Soil → Sand	4.03%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.03%
Wetlands	Environmental → Aquatic → Marine → Wetlands	1.61%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.61%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.61%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	30.65%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	17.74%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	11.29%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.26%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.84%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.03%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	4.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.03%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.42%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.42%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.61%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.61%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	13.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	11.29%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.87%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	8.06%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	5.65%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	4.84%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.84%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	4.03%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	4.03%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.23%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	3.23%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.42%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.42%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.61%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.61%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.61%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.81%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.81%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.81%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.81%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.81%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.81%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300004025	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005558	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300006969	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009803	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50	Environmental	Open in IMG/M
3300009805	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10	Environmental	Open in IMG/M
3300009820	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60	Environmental	Open in IMG/M
3300009821	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012399	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012972	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300014269	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1	Environmental	Open in IMG/M
3300014324	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1	Environmental	Open in IMG/M
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300017656	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015	Environmental	Open in IMG/M
3300017659	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018079	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300023067	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025965	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026298	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)	Environmental	Open in IMG/M
3300026328	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300026333	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)	Environmental	Open in IMG/M
3300026469	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B	Environmental	Open in IMG/M
3300026536	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)	Environmental	Open in IMG/M
3300027527	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300027954	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031764	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Host-Associated	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.43
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.43
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F069231

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI10214J12806_113557791	3300000891	Soil	DAYQQTFVDEPRLYSKVQEIGEKLLARTGVTLPRSRWPIV*
JGI1027J12803_1091017402	3300000955	Soil	VDGYRQTFVDEGRLFQKIQEIGERLQARTGITFPRSR
JGIcombinedJ26739_1009126842	3300002245	Forest Soil	QTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMS*
Ga0055433_101276102	3300004025	Natural And Restored Wetlands	VVDAYRQTFADERRLFSKVQEIGERLQARTGITFPRSKWPMS*
Ga0065712_106232911	3300005290	Miscanthus Rhizosphere	VIDAYQQTFVDEPRLYSKVQEMGEKLLARTGVKPGLPRWPIV*
Ga0065707_108435722	3300005295	Switchgrass Rhizosphere	IDGRVVVDAYRQSFVDEPKLYAKVQEMGEKLMARTDTTFPRSRWQIV*
Ga0066388_1082122671	3300005332	Tropical Forest Soil	VVDAYRQSFVDEDRLFEKVQEIGERLQVRTGITFPRSRWPIV*
Ga0070661_1019205921	3300005344	Corn Rhizosphere	VDAYRQSFVDEPRLFARVQEIGERLLARTGVELPRSRWPII*
Ga0070694_1002620911	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	VDAYRQTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMS*
Ga0066689_101166741	3300005447	Soil	AYRQTFVDEPRLFAQVQEIGEKLQRRTGTTFPRSRWPIL*
Ga0066689_106693321	3300005447	Soil	VDAYRQSFVDEGRLFAKVQEIGEQLQARTGITFPRSRWPIV*
Ga0070697_1021425121	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	VVDAYRQTFVDEPRLYAQVQEIGERLQARTGISFPRSRWPMS*
Ga0066697_104806483	3300005540	Soil	FVDEGRLFATVQEIGERLQSRTGITFPRSRWPVV*
Ga0070696_1011274581	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	VVVDAYRQTFADEPRLFAKVQDIGERLQARTGITFPRSKWPMG*
Ga0066701_104606084	3300005552	Soil	YRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV*
Ga0066692_103870994	3300005555	Soil	QSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV*
Ga0066698_102254083	3300005558	Soil	RQSFVDEARLFAKVQEIGERLQARTGITFPRSRWPIV*
Ga0066691_100330201	3300005586	Soil	TFVDEPKLYAKVQVVGEQLMARTGTSFPRSRWNII*
Ga0068859_1007821181	3300005617	Switchgrass Rhizosphere	RVVVDAYRQSFVDEPKLFARVQEIGEQLQARTGITFPRSRWPIV*
Ga0066903_1003413244	3300005764	Tropical Forest Soil	QTFVDEGRLFQKVQEIGEQLQARTGITFPRSRWPIV*
Ga0066903_1010815631	3300005764	Tropical Forest Soil	VVIDAYRQTFVDEPRLFAKVQEIGEKLQRRTGTSFPRSRWQIL*
Ga0066903_1072640711	3300005764	Tropical Forest Soil	VIDAYRQSFVDEGRLFATVQEIGERLQKRTGITFPRSRWPIV*
Ga0074479_100626531	3300005829	Sediment (Intertidal)	RQTFADEPRLFAKVQEIGERLQARTGITFPRSKWPMS*
Ga0068858_1008602051	3300005842	Switchgrass Rhizosphere	YRQSFVDEPKLFAKVQEIGEQLQARTGITFPRSRWPIV*
Ga0066652_1001591603	3300006046	Soil	RQTFVDESRLFATVQEIGERLQARTGITFPRSRWPIL*
Ga0070716_1012280651	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	VDAYRQTFVDEPRLFAKVQEIGEKLQTRTGTTFPRARWQIV*
Ga0075428_1012193821	3300006844	Populus Rhizosphere	QSFADEGKLFAQAQEIGERLLARTGVSFPRSRWPVI*
Ga0075425_1011070251	3300006854	Populus Rhizosphere	FVDEPRLFAKVQEIGEKLQRRTGTTFPRSRWQIV*
Ga0075434_1018221402	3300006871	Populus Rhizosphere	RVVVDAYRQTFVDETRLFGKVQEIGEKLQARTGITFPLSRWPMG*
Ga0068865_1012351052	3300006881	Miscanthus Rhizosphere	QTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMI*
Ga0075424_1008530021	3300006904	Populus Rhizosphere	IDGRVVVDAYRQSFVDEPRLYAKVQEMGEKLLARTDTTFPRSRWQIV*
Ga0079219_123106053	3300006954	Agricultural Soil	VDAYQQSFVDEPRLYSKVQEIGESLLARTGVSHPRSRWPMV*
Ga0075419_111522961	3300006969	Populus Rhizosphere	GKQRFVDADRLYGQIQEIGESLQARTGITFPRSRWPIV*
Ga0066710_1036437952	3300009012	Grasslands Soil	DAYRQTFVDEPRLFAQVQEIGEKLQRRTGTTFPRSRWPIL
Ga0099829_112826211	3300009038	Vadose Zone Soil	FVDETRLFGKVQEIGEKLQARTGITFPLSKWPMS*
Ga0099828_108379042	3300009089	Vadose Zone Soil	DAYRQSFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV*
Ga0075418_107505981	3300009100	Populus Rhizosphere	GRVVVDAYRQTFVDEPSLYAQVQEIGEKLQRRTGTTFPRSRWPIL*
Ga0066709_1004634953	3300009137	Grasslands Soil	VVDAYRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV*
Ga0066709_1023700111	3300009137	Grasslands Soil	FVDEGRLFATVQEIGERLQSRTGITFPRSRWPVL*
Ga0114129_100602546	3300009147	Populus Rhizosphere	YRQTFVDEARLYSTVQEIGERLQARTGISFPRSRWPIS*
Ga0075423_102588184	3300009162	Populus Rhizosphere	GYRQTFVDAARLFSTVQEIGERLQARTGISFPRSRWPIV*
Ga0105242_128272213	3300009176	Miscanthus Rhizosphere	YKQSFVDEPRLFSKVQEIGESLLARTGVSQPRSRWPMV*
Ga0126374_118872351	3300009792	Tropical Forest Soil	VDNYRQTFADEPRLFAKVQEIGEQLQARTGISFARSKWPMS*
Ga0105065_10529022	3300009803	Groundwater Sand	VDAYRQTFVDEPRLFAKVQEIGERLQARTGISFPRSRWPMS*
Ga0105079_10457302	3300009805	Groundwater Sand	FVEEARLFGRVQEIGERLLARTGVTLPRSRWPIV*
Ga0105085_10826502	3300009820	Groundwater Sand	SFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV*
Ga0105064_10949611	3300009821	Groundwater Sand	QSFVDEPQLFAKVQEIGEKLQARTGTTFPRSRWQIV*
Ga0126384_107802512	3300010046	Tropical Forest Soil	VDAYRQSFVDEDRLFGEVQEIGERLQARTGITFPRSRWPIV*
Ga0126384_120684731	3300010046	Tropical Forest Soil	QSFVDEERLFARVQEIGEQLLARTGVALPRSRWPIV*
Ga0126382_107385671	3300010047	Tropical Forest Soil	TFVDEPRLFAKVQEIGEKLQRRTGTSFPRSRWQIV*
Ga0126373_131667103	3300010048	Tropical Forest Soil	DGYRQTFVDERRLFATVQEIGERLQARTGIHFPLTRWPVV*
Ga0134109_100609551	3300010320	Grasslands Soil	AYKQTFVDEPKLYARVQAVGEQLMARTGTSFPRSRWNIL*
Ga0126376_102250261	3300010359	Tropical Forest Soil	GHRQTFVDAARLFSTVQEIGERLQARTGITFPRSRWPVV*
Ga0126372_107627023	3300010360	Tropical Forest Soil	DAYRQSFVDEPKLYAMVQEIGEKLQARTGTTFPRSRWQIV*
Ga0126383_111009573	3300010398	Tropical Forest Soil	VVVDAYRQTFVDERRLYGTVQEIGERLQARTGVTFPTSRWPIV*
Ga0134122_127462821	3300010400	Terrestrial Soil	YRQTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMI*
Ga0134121_104519981	3300010401	Terrestrial Soil	DGKVVVDTYRQTFVDEPQLYAKVQEIGEKLQTRTGTTFPRSRWQIV*
Ga0134123_131294122	3300010403	Terrestrial Soil	FVDEPRLFARVQEIGERLLARTGVELPRSRWPIV*
Ga0137393_105671911	3300011271	Vadose Zone Soil	DDYRQAFVDEARLFATVQEIGERLQARTGITFPRSRWPVV*
Ga0137388_113921432	3300012189	Vadose Zone Soil	DAYRQAFVDEARLFAKVQEIGDRLQARNGVTFPRPGWPIV*
Ga0137364_108068663	3300012198	Vadose Zone Soil	IVVDNYRQTFVDEARLFSTVQEIGERLQARTGITFPRSRWPVL*
Ga0137399_117918231	3300012203	Vadose Zone Soil	DAYKQSFVDEPRLYSKVQEIGESLLARTGVSHPRSRWPMV*
Ga0137374_101141691	3300012204	Vadose Zone Soil	RQSFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV*
Ga0137362_103648012	3300012205	Vadose Zone Soil	SFVEESRLFAKVQEIGERLQARTGITYPRSRWPII*
Ga0137368_105009092	3300012358	Vadose Zone Soil	FVDEPQLFAKVQEIGEKLQARTGTTFPRSRWQIV*
Ga0137375_103845683	3300012360	Vadose Zone Soil	DAYRQSFVDEPRLFARVQEIGERLQARTGVSFPRSRWPMS*
Ga0137361_106008871	3300012362	Vadose Zone Soil	YRQTFVDAPRLYAQVQEIGEKLQRRTGTTFPRSRWPIL*
Ga0134061_13088572	3300012399	Grasslands Soil	QSFVDEARLFAKVQEIGEQLQARTGITFPRSRWPIV*
Ga0137395_101762901	3300012917	Vadose Zone Soil	YRQTFVDEPRLFAKVQEIGEKLQTRTGTTFPRSRWPIV*
Ga0137395_105234981	3300012917	Vadose Zone Soil	RVVVDAYRQTFVDEARLFGKVQEIGERLQARTGITFPLSRWPMG*
Ga0137396_109981291	3300012918	Vadose Zone Soil	TFVDEARLFATVQEIGERLQARTGITFPRSRWPVV*
Ga0137407_115273351	3300012930	Vadose Zone Soil	AYRQSFVDEPRLFAQVQEIGEKLQARTGTTFPRSRWQIV*
Ga0137410_113486831	3300012944	Vadose Zone Soil	AFVDEARLFATVQEIGERLQARTGITFPRSRWPVV*
Ga0126375_105249982	3300012948	Tropical Forest Soil	RQTFVDEPRLFAKVQEIGEKLQTRTGTSFPRSRWPVV*
Ga0126369_107119433	3300012971	Tropical Forest Soil	FVDEPTLFSRVQEMGEKLLARTGVSFPRSRWPVV*
Ga0126369_123868552	3300012971	Tropical Forest Soil	RVVVDAYRQSFVDEDRLFEKVQEIGERLQVRTGITFPRSRWPIV*
Ga0134077_101150541	3300012972	Grasslands Soil	QSFVDEARLFAKVQEIGEQLQARTGVTFPRSRWPIV*
Ga0075302_11468361	3300014269	Natural And Restored Wetlands	TFADEPRLFGKVQEIGERLQARTGITFPRSKWPMS*
Ga0075352_11744843	3300014324	Natural And Restored Wetlands	QSFADEGKLYATVQEIGERLQARTGITFPRSRWPFA*
Ga0137418_102619272	3300015241	Vadose Zone Soil	MGNLPGPGRVVVDAYRQTFVDETRLFGKVQEIGEKLQARTGITFPLSKWPMS*
Ga0134073_102572061	3300015356	Grasslands Soil	RQSFVDEGRLFATVQEIGERLQSRTGITFPRSRWPIL*
Ga0132256_1015669643	3300015372	Arabidopsis Rhizosphere	VVDAYRQTFVNEARLFGKVQEIGERLQARTGITFPLSRWPMG*
Ga0132257_1042750351	3300015373	Arabidopsis Rhizosphere	KVVVDAYRQTFVDEPQLYAKVQEIGEKLQTRTGTTFPRSRWQIV*
Ga0182036_107903701	3300016270	Soil	DGKVVIDAYRQTFVDEPRLFAKVQEIGEKLQTRTGTTFPRSRWQMV
Ga0182034_107070421	3300016371	Soil	RVVVDNYRQTFADEPRLFAKVQEIGEQLQARTGITFPRSKWPMS
Ga0134112_101485471	3300017656	Grasslands Soil	RQTFVDESRLFATVQEIGERLQARTGITFPRSRWPIL
Ga0134083_104299961	3300017659	Grasslands Soil	SFVDEPQLFARVQEIGEKLQARTGTTFPRSRWQIL
Ga0184604_100007846	3300018000	Groundwater Sediment	YRQSFVDEPRLFARVQEIGERLQARTGVSFPRSRWPMS
Ga0184608_102943321	3300018028	Groundwater Sediment	TFVDEPRLYAKVQEIGEKLLARTGVSLPPSRWPIV
Ga0184627_101201013	3300018079	Groundwater Sediment	QTFVDEPRLYATVQEIGERLLARTGVSFPRSRWPIV
Ga0184629_100894112	3300018084	Groundwater Sediment	VVVDGYRQTFVDERRLYATVQEIGERLQARTGIKAPPSRWPVV
Ga0066655_113120382	3300018431	Grasslands Soil	AYRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV
Ga0066667_103545121	3300018433	Grasslands Soil	SFVDEGRLFGKVQEIGERLQARTGITFPRSRWPIV
Ga0066667_107848852	3300018433	Grasslands Soil	VVDAYRQSFVDEPRLYAKVQEVGEKLLARTGVTPAPPRWPVV
Ga0247743_10279751	3300023067	Soil	VDAYRQRFVDEPRLFAKVQEIGERLQARTGIRFPRSRWPLS
Ga0207684_102554831	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	QTFVDEPCLYARVQEIGERLQARTGISFPRSRWPLS
Ga0207654_111929613	3300025911	Corn Rhizosphere	DAYRQSFVDEPKLFAKVQEIGERLQARTGITFPRSRWPIV
Ga0207646_104817993	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	VVFNAYRQTFVDEPRLYARVQEIGERLQARTGISFPRSRWPLS
Ga0207701_109610702	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	YRQRFVDEPRLFAKVQEIGEKLQTRTGTTFPRARWQIV
Ga0207711_103317051	3300025941	Switchgrass Rhizosphere	VVDAYRQSFVDEPKLFAKVQEIGEQLQARTGITFPRSRWPIV
Ga0210090_10387292	3300025965	Natural And Restored Wetlands	YRQSFVDEPRLYARVQEIGEQLQARTGVSFPRSRWPMS
Ga0209236_11308621	3300026298	Grasslands Soil	DAYRQSFVDEPRLYAKVQEIGESLLARTGVSHPRSRWPMV
Ga0209802_100258111	3300026328	Soil	DAYRQSFVDEARLFAKVQEIGERLQARTGVTFPRSRWPIV
Ga0209803_11007361	3300026332	Soil	RVDAYRQTFVDEPRLFAQVQEIGEKLQRRTGTTFPRSRWPIL
Ga0209158_10103111	3300026333	Soil	TFVDEPKLYAKVQVVGEQLMARTGTSFPRSRWNII
Ga0257169_10770611	3300026469	Soil	HRQSFVDEGRLFGKVQEIGERLQARTGITFPRSRWPIV
Ga0209058_13191862	3300026536	Soil	AYRQSFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV
Ga0209684_10650352	3300027527	Tropical Forest Soil	NYRQTFADEPRLFAKVQEIGEQLQARTGITFPRSKWPMS
Ga0209177_101045363	3300027775	Agricultural Soil	RQTFVDEPRLYARVQEIGERLQARTGISFPRSRWPMI
Ga0209974_101462352	3300027876	Arabidopsis Thaliana Rhizosphere	DAYRQAFVDEARLFAQVQEIGERLQARTGVRFPPSRWPIV
Ga0209382_105166821	3300027909	Populus Rhizosphere	IVVDNYRQTFVDEARLFSTVQEIGERLQARTGITFPRSRWPVS
Ga0209382_112507912	3300027909	Populus Rhizosphere	IDAYRQTFVDEPRLYSKVQEIGEKLLARTGVTLPRSRWPIV
Ga0209859_10322621	3300027954	Groundwater Sand	QTFVDEPRLFAKVQEIGEKLQARTGTTFPRSRWQIV
Ga0268264_104722053	3300028381	Switchgrass Rhizosphere	QSFVDEPKLFAKVQEIGERLQARTGITFPRSRWPIV
Ga0307469_113439301	3300031720	Hardwood Forest Soil	AYRQTFVDEPRLFAKVQEIGEKLQRRTGTTIPRSRWQIV
Ga0318535_105181922	3300031764	Soil	GRVVVDAYRQSFVDEPQLYAKVQEIGEKLQTRTGTTFPRSRWQII
Ga0310892_113046801	3300031858	Soil	YKQSFVDEARLFAKVQEIGESLQARTGITFPRSRWPIV
Ga0307407_104346732	3300031903	Rhizosphere	AYRQTFVDERRLYARVQEIGENLLARTGVAPGRPRWPIV
Ga0310910_109681731	3300031946	Soil	YRQSFVDEPQLYAKVQEIGEKLQTRTGTTFPRSRWQII
Ga0310906_107843681	3300032013	Soil	KQRFVDADALYGKVQAIGESLQTRTGITFPRSRWPIV
Ga0310895_101538992	3300032122	Soil	DGRVRVDAYRQTFVDEPRLFAQVQEIGEKLQRRTGTSFPRSRWPIL
Ga0307470_100426053	3300032174	Hardwood Forest Soil	VVDAYRQTFADEPRLFAKVQDIGERLQARTGITFPRSKWPMG
Ga0307470_118719092	3300032174	Hardwood Forest Soil	DAYRQAFVDEPRLFAKVQEIGEKLQTRTGTTFPRSRWQIV
Ga0307471_1042884561	3300032180	Hardwood Forest Soil	AYRQSFVDEGRLYAKVQEIGERLLARTAVTFPRSRWPVV

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign