| Basic Information | |
|---|---|
| Family ID | F069230 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 42 residues |
| Representative Sequence | KVRELRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 96.77 % |
| % of genes from short scaffolds (< 2000 bps) | 87.10 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.484 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (44.355 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (41.129 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 6.45 |
| PF00753 | Lactamase_B | 4.03 |
| PF00501 | AMP-binding | 2.42 |
| PF00196 | GerE | 2.42 |
| PF01183 | Glyco_hydro_25 | 2.42 |
| PF00202 | Aminotran_3 | 1.61 |
| PF02230 | Abhydrolase_2 | 1.61 |
| PF16859 | TetR_C_11 | 1.61 |
| PF12900 | Pyridox_ox_2 | 1.61 |
| PF01978 | TrmB | 1.61 |
| PF00211 | Guanylate_cyc | 1.61 |
| PF02566 | OsmC | 1.61 |
| PF06094 | GGACT | 1.61 |
| PF01955 | CbiZ | 1.61 |
| PF06441 | EHN | 1.61 |
| PF08327 | AHSA1 | 0.81 |
| PF12146 | Hydrolase_4 | 0.81 |
| PF00589 | Phage_integrase | 0.81 |
| PF00239 | Resolvase | 0.81 |
| PF13271 | DUF4062 | 0.81 |
| PF07676 | PD40 | 0.81 |
| PF13469 | Sulfotransfer_3 | 0.81 |
| PF00069 | Pkinase | 0.81 |
| PF01510 | Amidase_2 | 0.81 |
| PF10935 | DUF2637 | 0.81 |
| PF12697 | Abhydrolase_6 | 0.81 |
| PF01988 | VIT1 | 0.81 |
| PF01370 | Epimerase | 0.81 |
| PF03358 | FMN_red | 0.81 |
| PF14451 | Ub-Mut7C | 0.81 |
| PF03737 | RraA-like | 0.81 |
| PF00041 | fn3 | 0.81 |
| PF00892 | EamA | 0.81 |
| PF13602 | ADH_zinc_N_2 | 0.81 |
| PF00850 | Hist_deacetyl | 0.81 |
| PF08281 | Sigma70_r4_2 | 0.81 |
| PF12802 | MarR_2 | 0.81 |
| PF00682 | HMGL-like | 0.81 |
| PF03795 | YCII | 0.81 |
| PF01177 | Asp_Glu_race | 0.81 |
| PF00190 | Cupin_1 | 0.81 |
| PF09678 | Caa3_CtaG | 0.81 |
| PF11066 | DUF2867 | 0.81 |
| PF00072 | Response_reg | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.23 |
| COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 2.42 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.61 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 1.61 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 1.61 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 1.61 |
| COG1865 | Adenosylcobinamide amidohydrolase | Coenzyme transport and metabolism [H] | 1.61 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.61 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.81 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.81 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.81 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.48 % |
| Unclassified | root | N/A | 39.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100724307 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300004082|Ga0062384_100854874 | Not Available | 640 | Open in IMG/M |
| 3300005187|Ga0066675_10454776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 952 | Open in IMG/M |
| 3300005332|Ga0066388_102906439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 875 | Open in IMG/M |
| 3300005332|Ga0066388_107312332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300005332|Ga0066388_108373864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300005337|Ga0070682_100021666 | All Organisms → cellular organisms → Bacteria | 3796 | Open in IMG/M |
| 3300005434|Ga0070709_10677330 | Not Available | 801 | Open in IMG/M |
| 3300005435|Ga0070714_100118098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2356 | Open in IMG/M |
| 3300005436|Ga0070713_100115257 | All Organisms → cellular organisms → Bacteria | 2348 | Open in IMG/M |
| 3300005764|Ga0066903_106363872 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300005840|Ga0068870_10111856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1561 | Open in IMG/M |
| 3300006028|Ga0070717_10141132 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300006173|Ga0070716_101277076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 592 | Open in IMG/M |
| 3300006176|Ga0070765_102151048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 521 | Open in IMG/M |
| 3300006755|Ga0079222_10504618 | Not Available | 887 | Open in IMG/M |
| 3300006800|Ga0066660_10431554 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300009174|Ga0105241_10043860 | All Organisms → cellular organisms → Bacteria | 3388 | Open in IMG/M |
| 3300009792|Ga0126374_11419912 | Not Available | 566 | Open in IMG/M |
| 3300009824|Ga0116219_10125762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1490 | Open in IMG/M |
| 3300010043|Ga0126380_10000555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 12746 | Open in IMG/M |
| 3300010359|Ga0126376_13041537 | Not Available | 518 | Open in IMG/M |
| 3300010360|Ga0126372_10026861 | All Organisms → cellular organisms → Bacteria | 3526 | Open in IMG/M |
| 3300010360|Ga0126372_10887166 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300010361|Ga0126378_10470068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1372 | Open in IMG/M |
| 3300010379|Ga0136449_100274092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3107 | Open in IMG/M |
| 3300010398|Ga0126383_10599201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Piscinibacter → Piscinibacter defluvii | 1173 | Open in IMG/M |
| 3300012199|Ga0137383_10280255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1221 | Open in IMG/M |
| 3300012201|Ga0137365_10369216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1059 | Open in IMG/M |
| 3300012206|Ga0137380_10431018 | Not Available | 1168 | Open in IMG/M |
| 3300012209|Ga0137379_10149616 | Not Available | 2243 | Open in IMG/M |
| 3300012356|Ga0137371_11169340 | Not Available | 575 | Open in IMG/M |
| 3300012971|Ga0126369_12380348 | Not Available | 616 | Open in IMG/M |
| 3300014165|Ga0181523_10023408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4056 | Open in IMG/M |
| 3300014326|Ga0157380_11354986 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300016270|Ga0182036_11776762 | Not Available | 522 | Open in IMG/M |
| 3300016294|Ga0182041_11153505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 705 | Open in IMG/M |
| 3300016341|Ga0182035_11946561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300016371|Ga0182034_11395734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 612 | Open in IMG/M |
| 3300017821|Ga0187812_1147232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 759 | Open in IMG/M |
| 3300017928|Ga0187806_1313440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 555 | Open in IMG/M |
| 3300017946|Ga0187879_10566591 | Not Available | 631 | Open in IMG/M |
| 3300017955|Ga0187817_10296999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1030 | Open in IMG/M |
| 3300017973|Ga0187780_11489693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 500 | Open in IMG/M |
| 3300017975|Ga0187782_11590233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300018064|Ga0187773_10601052 | Not Available | 672 | Open in IMG/M |
| 3300018085|Ga0187772_11030795 | Not Available | 602 | Open in IMG/M |
| 3300018090|Ga0187770_11693344 | Not Available | 517 | Open in IMG/M |
| 3300020582|Ga0210395_10743944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 732 | Open in IMG/M |
| 3300021178|Ga0210408_10389053 | Not Available | 1111 | Open in IMG/M |
| 3300021178|Ga0210408_10428718 | Not Available | 1053 | Open in IMG/M |
| 3300021432|Ga0210384_10417103 | Not Available | 1209 | Open in IMG/M |
| 3300021474|Ga0210390_10165077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1868 | Open in IMG/M |
| 3300021478|Ga0210402_10805157 | Not Available | 865 | Open in IMG/M |
| 3300021560|Ga0126371_10593391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1257 | Open in IMG/M |
| 3300021560|Ga0126371_11174039 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300021560|Ga0126371_12549102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300025899|Ga0207642_11162792 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300025916|Ga0207663_10545786 | Not Available | 906 | Open in IMG/M |
| 3300025921|Ga0207652_11830022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → unclassified Nocardia → Nocardia sp. ncl2 | 512 | Open in IMG/M |
| 3300025935|Ga0207709_10736259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → unclassified Nocardia → Nocardia sp. ncl2 | 792 | Open in IMG/M |
| 3300026067|Ga0207678_10092586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2583 | Open in IMG/M |
| 3300026551|Ga0209648_10205320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1499 | Open in IMG/M |
| 3300027824|Ga0209040_10087207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1791 | Open in IMG/M |
| 3300027857|Ga0209166_10514788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300031549|Ga0318571_10158406 | Not Available | 787 | Open in IMG/M |
| 3300031564|Ga0318573_10463978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300031573|Ga0310915_11269917 | Not Available | 508 | Open in IMG/M |
| 3300031668|Ga0318542_10338691 | Not Available | 773 | Open in IMG/M |
| 3300031679|Ga0318561_10816137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ISL-99 | 512 | Open in IMG/M |
| 3300031680|Ga0318574_10346254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 866 | Open in IMG/M |
| 3300031682|Ga0318560_10564517 | Not Available | 616 | Open in IMG/M |
| 3300031713|Ga0318496_10032302 | All Organisms → cellular organisms → Bacteria | 2652 | Open in IMG/M |
| 3300031723|Ga0318493_10901230 | Not Available | 501 | Open in IMG/M |
| 3300031724|Ga0318500_10691005 | Not Available | 520 | Open in IMG/M |
| 3300031744|Ga0306918_10240220 | Not Available | 1379 | Open in IMG/M |
| 3300031747|Ga0318502_10285877 | Not Available | 968 | Open in IMG/M |
| 3300031747|Ga0318502_10476358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 747 | Open in IMG/M |
| 3300031747|Ga0318502_10693334 | Not Available | 615 | Open in IMG/M |
| 3300031751|Ga0318494_10079128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1783 | Open in IMG/M |
| 3300031769|Ga0318526_10388433 | Not Available | 570 | Open in IMG/M |
| 3300031771|Ga0318546_10028104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3319 | Open in IMG/M |
| 3300031771|Ga0318546_10074074 | Not Available | 2181 | Open in IMG/M |
| 3300031771|Ga0318546_10232415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300031777|Ga0318543_10479937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
| 3300031779|Ga0318566_10161870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1110 | Open in IMG/M |
| 3300031781|Ga0318547_10098800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus africanus | 1664 | Open in IMG/M |
| 3300031781|Ga0318547_10108742 | Not Available | 1593 | Open in IMG/M |
| 3300031781|Ga0318547_10775593 | Not Available | 597 | Open in IMG/M |
| 3300031782|Ga0318552_10152043 | Not Available | 1163 | Open in IMG/M |
| 3300031797|Ga0318550_10522518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
| 3300031798|Ga0318523_10010162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3794 | Open in IMG/M |
| 3300031799|Ga0318565_10307506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 770 | Open in IMG/M |
| 3300031799|Ga0318565_10345237 | Not Available | 722 | Open in IMG/M |
| 3300031832|Ga0318499_10096091 | Not Available | 1144 | Open in IMG/M |
| 3300031832|Ga0318499_10143810 | Not Available | 930 | Open in IMG/M |
| 3300031835|Ga0318517_10348537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 669 | Open in IMG/M |
| 3300031845|Ga0318511_10387506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 639 | Open in IMG/M |
| 3300031859|Ga0318527_10049119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1638 | Open in IMG/M |
| 3300031860|Ga0318495_10198273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 903 | Open in IMG/M |
| 3300031894|Ga0318522_10057594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus africanus | 1385 | Open in IMG/M |
| 3300031894|Ga0318522_10297581 | Not Available | 612 | Open in IMG/M |
| 3300031896|Ga0318551_10212335 | Not Available | 1074 | Open in IMG/M |
| 3300031910|Ga0306923_12374225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 527 | Open in IMG/M |
| 3300031912|Ga0306921_12742830 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031941|Ga0310912_10190778 | Not Available | 1564 | Open in IMG/M |
| 3300031941|Ga0310912_10312929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1217 | Open in IMG/M |
| 3300031941|Ga0310912_10886505 | Not Available | 687 | Open in IMG/M |
| 3300031946|Ga0310910_10090745 | Not Available | 2249 | Open in IMG/M |
| 3300031954|Ga0306926_10407424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1678 | Open in IMG/M |
| 3300031954|Ga0306926_11420858 | Not Available | 804 | Open in IMG/M |
| 3300032001|Ga0306922_10908455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 914 | Open in IMG/M |
| 3300032008|Ga0318562_10525879 | Not Available | 685 | Open in IMG/M |
| 3300032025|Ga0318507_10276947 | Not Available | 729 | Open in IMG/M |
| 3300032043|Ga0318556_10234080 | Not Available | 958 | Open in IMG/M |
| 3300032044|Ga0318558_10076343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1533 | Open in IMG/M |
| 3300032044|Ga0318558_10702345 | Not Available | 506 | Open in IMG/M |
| 3300032076|Ga0306924_10961780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 940 | Open in IMG/M |
| 3300032089|Ga0318525_10101555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus africanus | 1466 | Open in IMG/M |
| 3300032089|Ga0318525_10389761 | Not Available | 714 | Open in IMG/M |
| 3300032089|Ga0318525_10539290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
| 3300032180|Ga0307471_103225484 | Not Available | 578 | Open in IMG/M |
| 3300032261|Ga0306920_103187331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Flexivirga → Flexivirga caeni | 614 | Open in IMG/M |
| 3300032828|Ga0335080_11620247 | Not Available | 637 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 44.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.61% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.81% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1007243071 | 3300000956 | Soil | LGARRADGLTYRELAAEFGISDTSAHAAVNRKTWVHVS* |
| Ga0062384_1008548741 | 3300004082 | Bog Forest Soil | VGNPQAKLSDDKVRKLRSRRADGLTYRQLATEFGISDVSAYAAVHRKTWAHVT* |
| Ga0066675_104547761 | 3300005187 | Soil | GKVQQLRARRADGLTYQQLADEFGISDVSARSAVNGRTWAHVA* |
| Ga0066388_1029064391 | 3300005332 | Tropical Forest Soil | RAKLTSGKVRELRARRADGLTYRQLAAEFGISDASACAAVNRKTWAHVS* |
| Ga0066388_1073123322 | 3300005332 | Tropical Forest Soil | QLRARRADGLTYRQLAAEFGISDATACAAVNRKTWAHVS* |
| Ga0066388_1083738642 | 3300005332 | Tropical Forest Soil | RAKLTSGKVRELRARRADGLTYRQLAAEFGISDASACAAANRKTWAHVS* |
| Ga0070682_1000216661 | 3300005337 | Corn Rhizosphere | KVRKLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA* |
| Ga0070709_106773301 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | NVRRLRARRADGLTYQQLADEFGISDVSAHAAVNRRTWAHVA* |
| Ga0070714_1001180984 | 3300005435 | Agricultural Soil | AKLTSGKVRELRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS* |
| Ga0070713_1001152571 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLRARRADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA* |
| Ga0066903_1063638722 | 3300005764 | Tropical Forest Soil | EGNRRAKLTSVRVRQLRARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVS* |
| Ga0068870_101118561 | 3300005840 | Miscanthus Rhizosphere | KFEGYERGADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA* |
| Ga0070717_101411322 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VGNPQAKLSDDSVRKLRSHRADGLTYRQLATEFGISDVSAYAAVHRKTWAHVT* |
| Ga0070716_1012770761 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LRARRADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA* |
| Ga0070765_1021510482 | 3300006176 | Soil | KLTAGKVAELRARRADGLTYRQLADEFCISDVSAHAAVNRRTWAHVA* |
| Ga0079222_105046182 | 3300006755 | Agricultural Soil | RELRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA* |
| Ga0066660_104315541 | 3300006800 | Soil | KLTDDKVRQLRALRADGMTYRQLAAEFGISDVSACAAVNRKTWAHVT* |
| Ga0105241_100438604 | 3300009174 | Corn Rhizosphere | TAEKVRKLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA* |
| Ga0126374_114199121 | 3300009792 | Tropical Forest Soil | RRADGLTYRQLAAEFGISDVTASAAVNRKTWAHVN* |
| Ga0116219_101257622 | 3300009824 | Peatlands Soil | AKLTTRKVRQLRARRAQGLTYRQLAAEFGISDVSAYAAANRRTWAHVS* |
| Ga0126380_100005557 | 3300010043 | Tropical Forest Soil | LTSGKVRELRARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVS* |
| Ga0126376_130415371 | 3300010359 | Tropical Forest Soil | LRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS* |
| Ga0126372_100268616 | 3300010360 | Tropical Forest Soil | ELRARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVS* |
| Ga0126372_108871661 | 3300010360 | Tropical Forest Soil | GKVRELRARRADGLTYRQLAAEFGISDTSAHAAVNRKTWAHVS* |
| Ga0126378_104700681 | 3300010361 | Tropical Forest Soil | AKLTSGKVRELRARRADGLTYRQLAAEFGISDVTASAAVNRKHWRM* |
| Ga0136449_1002740921 | 3300010379 | Peatlands Soil | LSDDKVTKLRARRTDGLTYRQLAAEFGISDVSACAAVNRRTWAHVT* |
| Ga0126383_105992011 | 3300010398 | Tropical Forest Soil | VRQLRARRADGLTYRQLAAEFDISDVTACAAVNRKTWAHVN* |
| Ga0137383_102802554 | 3300012199 | Vadose Zone Soil | ARRADGLTYRQLAVEFGISDVSACAAVNRKTWAHVS* |
| Ga0137365_103692161 | 3300012201 | Vadose Zone Soil | RADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS* |
| Ga0137380_104310181 | 3300012206 | Vadose Zone Soil | RLRARRADGLTYRQLAGEFGISDVSAYAAVNRTTWAHVA* |
| Ga0137379_101496161 | 3300012209 | Vadose Zone Soil | KVRRLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA* |
| Ga0137371_111693401 | 3300012356 | Vadose Zone Soil | SRKVRQLRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS* |
| Ga0126369_123803481 | 3300012971 | Tropical Forest Soil | LRARRADGLTYRQLAAEFGISDVTACAAVNRKTWAHVN* |
| Ga0181523_100234081 | 3300014165 | Bog | VRKLRALRAGGLTYRQLAAEFGISDVSACAAVNRKTWA |
| Ga0157380_113549861 | 3300014326 | Switchgrass Rhizosphere | LTAEKVRRLRARRADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA* |
| Ga0182036_117767621 | 3300016270 | Soil | DKVRRLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS |
| Ga0182041_111535052 | 3300016294 | Soil | RAKLTNGKVRQLRARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVT |
| Ga0182035_119465612 | 3300016341 | Soil | RARRAQGLTYRQLAADFGISDVSARAAVNGTTWRHIA |
| Ga0182034_113957342 | 3300016371 | Soil | RARRADGLTYRQLAAEFGISDVTARAAVNRKTWTHVT |
| Ga0187812_11472322 | 3300017821 | Freshwater Sediment | KLTDEKVRGLRARRADGLTYQQLAAEFGISDVSACAAVNRKT |
| Ga0187806_13134402 | 3300017928 | Freshwater Sediment | AKLTNAKVTELRARRADGLTYRQLAAEFGISDVSAWAAVNRRTWTHVN |
| Ga0187879_105665911 | 3300017946 | Peatland | VRKLRALRAGGLTYRQLAAEFGISDVSACAAVNRKTWAHVP |
| Ga0187817_102969991 | 3300017955 | Freshwater Sediment | RRAQGLTYRQLAARFGISDVTAWAAVNGKTWRHIA |
| Ga0187780_114896932 | 3300017973 | Tropical Peatland | KVRELRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS |
| Ga0187782_115902331 | 3300017975 | Tropical Peatland | VRQLRARRADGLTYRQLAAEFGVSDASACAAVNRKTWAHVS |
| Ga0187773_106010522 | 3300018064 | Tropical Peatland | AKLTAGKVRELRARRADGLTFRQLAREFGISDVSACAAVNRRTWAHVS |
| Ga0187772_110307951 | 3300018085 | Tropical Peatland | RRADGLTYRQLAAEFGISDVSACAAVNRRTWVHVA |
| Ga0187770_116933441 | 3300018090 | Tropical Peatland | LRARRADGLTYRQLAAEFGISDVSACAAVNRRTWVHVA |
| Ga0210395_107439442 | 3300020582 | Soil | RKVRQLRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS |
| Ga0210408_103890531 | 3300021178 | Soil | SPHAKLTAGNVRRLRARRADGLTYQQLADEFGISDVSAHAAVNRRTWAHVA |
| Ga0210408_104287181 | 3300021178 | Soil | VRRLRARRADGLTYQQLADEFGISDVSAHAAVNRRTWAHVA |
| Ga0210384_104171033 | 3300021432 | Soil | EKVRQLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA |
| Ga0210390_101650774 | 3300021474 | Soil | DKVRTLRALRAGGLTYRQLAAEFGISDVSACAAVNRKTWAHVT |
| Ga0210402_108051572 | 3300021478 | Soil | AKLTAEKVRKLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA |
| Ga0126371_105933913 | 3300021560 | Tropical Forest Soil | VGEGNRRAKLTSGKVRELRARRADGLTYRQLAAEFGISDVTASAAVNRKTWAHVN |
| Ga0126371_111740391 | 3300021560 | Tropical Forest Soil | NRRAKLTTAKVRQLRARRAGGLTYRQLAAEFGISDSSACAAVNRKTWAHVN |
| Ga0126371_125491021 | 3300021560 | Tropical Forest Soil | KLTDNKVRQLRARRADGVTYRQLAAEFGISDVSAWAAVNGRTWAHVS |
| Ga0207642_111627922 | 3300025899 | Miscanthus Rhizosphere | KLRARRADGLTYRQLAGEFGISDVSAHAAVNGRTWAHVA |
| Ga0207663_105457862 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | EKVRRLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA |
| Ga0207652_118300221 | 3300025921 | Corn Rhizosphere | VRKLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA |
| Ga0207709_107362591 | 3300025935 | Miscanthus Rhizosphere | RRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA |
| Ga0207678_100925861 | 3300026067 | Corn Rhizosphere | KVRKLRARRADGLTYRQLAGELGISDVSAHAAVNRTTWAHVA |
| Ga0209648_102053203 | 3300026551 | Grasslands Soil | ARRVEGLTYRQLAGEFGISDASACAAVNRRTWAHVA |
| Ga0209040_100872071 | 3300027824 | Bog Forest Soil | AKLTNDKVRQLRARRADGLTYRQLAAESGISDVSAWAAVNGKTWAHVS |
| Ga0209166_105147881 | 3300027857 | Surface Soil | RRAQGLTFRQLAAEFGISDVSAWAAVNGKTWRHVT |
| Ga0318571_101584062 | 3300031549 | Soil | KLTAEKVRQLRARRADGLTYQQLAGEFGISDVSAHAAVNRRTWAHIA |
| Ga0318573_104639782 | 3300031564 | Soil | AKVKQLRARRADGLTYRQLAAEFGISDVTAYAAVNRKTWAHVR |
| Ga0310915_112699172 | 3300031573 | Soil | ARRAEGLTYRQLAAEFGISDVTARAAVQRTTWAHVS |
| Ga0318542_103386912 | 3300031668 | Soil | ARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS |
| Ga0318561_108161371 | 3300031679 | Soil | GKVRELRARRAAGLTYRQLAAEFGISDASACAAVNRKTWAHVS |
| Ga0318574_103462542 | 3300031680 | Soil | VRQLRARRAEGLTYRQLATKFGISDVSACAAVNRKTWAHVT |
| Ga0318560_105645171 | 3300031682 | Soil | RKLRARRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS |
| Ga0318496_100323024 | 3300031713 | Soil | AKLTSRKVRKLRARRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS |
| Ga0318493_109012301 | 3300031723 | Soil | ELRTRRAEGVTYRKLAAEFSISDVSACSAVNRKTWAHVV |
| Ga0318500_106910052 | 3300031724 | Soil | VRQLRARRADGLTYRQLAAEFGISDVSAWAAVNGKTWTHVS |
| Ga0306918_102402202 | 3300031744 | Soil | KLTNAKVRQLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS |
| Ga0318502_102858771 | 3300031747 | Soil | RKVRRLRARRADGLTYRQLAAEFGISDVSACAAVNRKTWAHVS |
| Ga0318502_104763581 | 3300031747 | Soil | TAEKVRQLRARRSDGLTYQQLAGEFGISDVSACAVVNRRTWAHVA |
| Ga0318502_106933342 | 3300031747 | Soil | RKVRKLRARRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS |
| Ga0318494_100791283 | 3300031751 | Soil | RRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS |
| Ga0318526_103884331 | 3300031769 | Soil | LTSRKVRKLRARRAAGLTYRQLAAEFGISDVTARAAVQRTTWAHVS |
| Ga0318546_100281045 | 3300031771 | Soil | KVRQLRARRADGLTYRQLAAEFGISDVSAWAAVNGKTWTHVS |
| Ga0318546_100740741 | 3300031771 | Soil | QVRQLRARRADGLTYRQLAAEFGISDMTARAAANRKTWAHVN |
| Ga0318546_102324153 | 3300031771 | Soil | RRAEGLTYRQLAAEFGISDVTARAAVQRTTWAHVS |
| Ga0318543_104799371 | 3300031777 | Soil | VRELRARRAAGLTYRQLAAEFGISDASACAAVNRKTWAHVS |
| Ga0318566_101618701 | 3300031779 | Soil | LSDGKVRKLRARRADGLTYKQLAAEFGISDVSARAAVNRKTWTHVT |
| Ga0318547_100988001 | 3300031781 | Soil | RAKLTPGKVRKLRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA |
| Ga0318547_101087423 | 3300031781 | Soil | VRQLRARRADGATYRQLAAEFGISDMTARAAANRKTWAHVT |
| Ga0318547_107755931 | 3300031781 | Soil | VRQLRARRAAGLTYRQLAAEFGISDLSACAVVNRKTWAHVI |
| Ga0318552_101520432 | 3300031782 | Soil | KLTSGQVRQLRARRADGLTYRQLAAEFGISDMTARAAANRKTWAHVT |
| Ga0318550_105225182 | 3300031797 | Soil | AKLTNGKVRQLRARRADGLTYRQLAAEFGISDVTARAAVNRKTWTHVT |
| Ga0318523_100101624 | 3300031798 | Soil | AKLTNAKVRQLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS |
| Ga0318565_103075061 | 3300031799 | Soil | TAGKVRELRARRADGLTYQQLATEFGISDVSAWAAVNGKTWAHVN |
| Ga0318565_103452372 | 3300031799 | Soil | LTPGKVRKLRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA |
| Ga0318499_100960912 | 3300031832 | Soil | EKVRQLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS |
| Ga0318499_101438102 | 3300031832 | Soil | TSGRVRELRARRAAGLTYRQLAAEFGISDASARAAANRKTWAHVS |
| Ga0318517_103485372 | 3300031835 | Soil | RRAGGLTYRQPAAEFGISDVSACAAVNRKTWAQVP |
| Ga0318511_103875061 | 3300031845 | Soil | KVRQLRARRADGLTYRQLAAEFGISDVTARAAVNRKTWTHVT |
| Ga0318527_100491191 | 3300031859 | Soil | RKVRELRARRAEGLTYRQLAAEFGISDASACAAVNRKTWAHVP |
| Ga0318495_101982733 | 3300031860 | Soil | KVRELRARRAEGLTYRQLAAEFGISDASACAAVNRKTWAHVP |
| Ga0318522_100575943 | 3300031894 | Soil | PGKVRKLRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA |
| Ga0318522_102975812 | 3300031894 | Soil | KLTGRKVRELRARRAEGLTYRQLAAEFGISDASACAAVNRKTWAHVP |
| Ga0318551_102123352 | 3300031896 | Soil | IGQGNPRAILTDAKVRLLRARRAQGLTYRQLAAEFGISDVSAWAAANGRTWRHVA |
| Ga0306923_123742252 | 3300031910 | Soil | KLTADKVRQLRARRADGLTYRQLAGEFGISDVSACAVVNRRTWAHVA |
| Ga0306921_127428301 | 3300031912 | Soil | KVRQLRARRADGLTYRQLAAEFGVSDVSACAAVNRKTWAHVN |
| Ga0310912_101907781 | 3300031941 | Soil | RARRADGLTYRQLAAEFGVSDVSACAAVNRKTWAHVN |
| Ga0310912_103129291 | 3300031941 | Soil | RARRADGLTYRQLAAEFGISDVAACAAVNRKTWAHVT |
| Ga0310912_108865051 | 3300031941 | Soil | TNAKVRQLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS |
| Ga0310910_100907451 | 3300031946 | Soil | VRQLRARRADGLTYRQLAAEFGISDMTARAAANRKTWAHVT |
| Ga0306926_104074242 | 3300031954 | Soil | RELRARRAAGLTYRQLAAEFGISDASARAAANRKTWAHVS |
| Ga0306926_114208582 | 3300031954 | Soil | RAKLTSGKVRVLRARRTAGLTYRQLAAEFGISDASARAAVNRKTWAHVS |
| Ga0306922_109084551 | 3300032001 | Soil | ARRAAGLTYRQLAAEFGISDASACAAVNRKTWAHVS |
| Ga0318562_105258792 | 3300032008 | Soil | QLRARRADGATYRQLAAEFGISDMTARAAANRKTWAHVT |
| Ga0318507_102769471 | 3300032025 | Soil | TDDKVRQLRARRADGLTYRQLAAEFGISDVSAWAAVNGKTWTHVS |
| Ga0318556_102340801 | 3300032043 | Soil | QLRARRADGLTYRQLAAEFGISDMSACAAVNRKTWAHVS |
| Ga0318558_100763431 | 3300032044 | Soil | VRELRARRAEGLTYRQLAAEFGISDASACAAVNRKTWAHVP |
| Ga0318558_107023451 | 3300032044 | Soil | ARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA |
| Ga0306924_109617803 | 3300032076 | Soil | VRQLRARRADGLTYRQLAAEFGISDTSACAAVNRKTWAHVR |
| Ga0318525_101015551 | 3300032089 | Soil | TPGKVRKLRARRADGLTYKQLADEFGISDVSAHAAVNRRTWAHVA |
| Ga0318525_103897612 | 3300032089 | Soil | AEKVRQLRARRADGLTYQQLASEFGISDVSAHAAVNRRTWAHIA |
| Ga0318525_105392901 | 3300032089 | Soil | EKVRQLRARRADGLTYRQLAGEFGISDVSAHAAVNRRTWAHVG |
| Ga0307471_1032254841 | 3300032180 | Hardwood Forest Soil | VRRLRARRADGLTYRQLAGEFGISDVSAHAAVNRTTWAHVA |
| Ga0306920_1031873312 | 3300032261 | Soil | ARRADGLTYRQLASEFGISDVSACAAVNRRTWAHIT |
| Ga0335080_116202471 | 3300032828 | Soil | TSGKVRQLRARRADGLTYRQLAAEFGISDTSACAAVNGKTWAHVS |
| ⦗Top⦘ |