| Basic Information | |
|---|---|
| Family ID | F069228 |
| Family Type | Metagenome |
| Number of Sequences | 124 |
| Average Sequence Length | 49 residues |
| Representative Sequence | VAIAYLQEFEIQDGDTSTTNYDAVVAALNLQSAPDGLLIHTAGFDH |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.56 % |
| % of genes near scaffold ends (potentially truncated) | 97.58 % |
| % of genes from short scaffolds (< 2000 bps) | 95.16 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.194 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.903 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.194 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.645 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.16% β-sheet: 16.22% Coil/Unstructured: 71.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 4.03 |
| PF00072 | Response_reg | 3.23 |
| PF03795 | YCII | 3.23 |
| PF03729 | DUF308 | 2.42 |
| PF00884 | Sulfatase | 1.61 |
| PF01047 | MarR | 1.61 |
| PF01244 | Peptidase_M19 | 1.61 |
| PF00361 | Proton_antipo_M | 1.61 |
| PF00589 | Phage_integrase | 1.61 |
| PF06736 | TMEM175 | 1.61 |
| PF00877 | NLPC_P60 | 0.81 |
| PF13407 | Peripla_BP_4 | 0.81 |
| PF13400 | Tad | 0.81 |
| PF00296 | Bac_luciferase | 0.81 |
| PF00990 | GGDEF | 0.81 |
| PF12681 | Glyoxalase_2 | 0.81 |
| PF01613 | Flavin_Reduct | 0.81 |
| PF02786 | CPSase_L_D2 | 0.81 |
| PF00069 | Pkinase | 0.81 |
| PF13374 | TPR_10 | 0.81 |
| PF13238 | AAA_18 | 0.81 |
| PF01544 | CorA | 0.81 |
| PF01863 | YgjP-like | 0.81 |
| PF00565 | SNase | 0.81 |
| PF01565 | FAD_binding_4 | 0.81 |
| PF01558 | POR | 0.81 |
| PF04655 | APH_6_hur | 0.81 |
| PF00486 | Trans_reg_C | 0.81 |
| PF00156 | Pribosyltran | 0.81 |
| PF00903 | Glyoxalase | 0.81 |
| PF00282 | Pyridoxal_deC | 0.81 |
| PF12680 | SnoaL_2 | 0.81 |
| PF06525 | SoxE | 0.81 |
| PF00122 | E1-E2_ATPase | 0.81 |
| PF13519 | VWA_2 | 0.81 |
| PF00196 | GerE | 0.81 |
| PF13527 | Acetyltransf_9 | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.23 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.23 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 2.42 |
| COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 1.61 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 1.61 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.81 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG1014 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit | Energy production and conversion [C] | 0.81 |
| COG1451 | UTP pyrophosphatase, metal-dependent hydrolase family | General function prediction only [R] | 0.81 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.81 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.81 |
| COG2216 | K+ transport ATPase, ATPase subunit KdpB | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.81 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.19 % |
| Unclassified | root | N/A | 25.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig45249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 905 | Open in IMG/M |
| 2170459023|GZGNO2B02F3G58 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiocapsa → unclassified Thiocapsa → Thiocapsa sp. KS1 | 511 | Open in IMG/M |
| 2199352025|deepsgr__Contig_87111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101179727 | Not Available | 585 | Open in IMG/M |
| 3300000891|JGI10214J12806_10569898 | Not Available | 695 | Open in IMG/M |
| 3300000956|JGI10216J12902_113084654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300004156|Ga0062589_102861672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300004157|Ga0062590_102472902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300004479|Ga0062595_100834379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300005093|Ga0062594_100816626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 865 | Open in IMG/M |
| 3300005179|Ga0066684_10376980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
| 3300005179|Ga0066684_10488095 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005184|Ga0066671_10957673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
| 3300005347|Ga0070668_101272485 | Not Available | 668 | Open in IMG/M |
| 3300005356|Ga0070674_100459163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1053 | Open in IMG/M |
| 3300005436|Ga0070713_100768165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 923 | Open in IMG/M |
| 3300005458|Ga0070681_10957518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
| 3300005459|Ga0068867_100406616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1149 | Open in IMG/M |
| 3300005468|Ga0070707_101873833 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005529|Ga0070741_10884158 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300005535|Ga0070684_100588832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1034 | Open in IMG/M |
| 3300005547|Ga0070693_100309668 | Not Available | 1067 | Open in IMG/M |
| 3300005547|Ga0070693_101400562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300005548|Ga0070665_102015502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
| 3300005564|Ga0070664_100046216 | All Organisms → cellular organisms → Bacteria | 3678 | Open in IMG/M |
| 3300005568|Ga0066703_10142718 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300005615|Ga0070702_100088278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1874 | Open in IMG/M |
| 3300005616|Ga0068852_101330788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 740 | Open in IMG/M |
| 3300005884|Ga0075291_1038842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300006031|Ga0066651_10218568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
| 3300006173|Ga0070716_101309743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300006173|Ga0070716_101793240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300009012|Ga0066710_104488270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
| 3300009098|Ga0105245_10349923 | Not Available | 1464 | Open in IMG/M |
| 3300009098|Ga0105245_10760673 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300009098|Ga0105245_11242351 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300009148|Ga0105243_12130311 | Not Available | 597 | Open in IMG/M |
| 3300009176|Ga0105242_10161435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1962 | Open in IMG/M |
| 3300010045|Ga0126311_11000782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 683 | Open in IMG/M |
| 3300010320|Ga0134109_10193747 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300010321|Ga0134067_10431655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300010358|Ga0126370_10873549 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300010358|Ga0126370_11991243 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300010371|Ga0134125_12232945 | Not Available | 595 | Open in IMG/M |
| 3300010373|Ga0134128_11720538 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300011119|Ga0105246_11719934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300011119|Ga0105246_12080917 | Not Available | 550 | Open in IMG/M |
| 3300012201|Ga0137365_10780678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 698 | Open in IMG/M |
| 3300012203|Ga0137399_11365687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| 3300012209|Ga0137379_11603908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 549 | Open in IMG/M |
| 3300012211|Ga0137377_10351204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1411 | Open in IMG/M |
| 3300012359|Ga0137385_11517003 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012359|Ga0137385_11663199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300012363|Ga0137390_10403541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1345 | Open in IMG/M |
| 3300012532|Ga0137373_10751914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300012582|Ga0137358_10455204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 864 | Open in IMG/M |
| 3300012905|Ga0157296_10324509 | Not Available | 548 | Open in IMG/M |
| 3300012915|Ga0157302_10188046 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300012923|Ga0137359_11032820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300012924|Ga0137413_11648870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300012930|Ga0137407_10388337 | Not Available | 1291 | Open in IMG/M |
| 3300012943|Ga0164241_10798727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300012955|Ga0164298_10397052 | Not Available | 890 | Open in IMG/M |
| 3300012957|Ga0164303_10064199 | Not Available | 1686 | Open in IMG/M |
| 3300012960|Ga0164301_11064145 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012977|Ga0134087_10274863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
| 3300012984|Ga0164309_10671854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 818 | Open in IMG/M |
| 3300012987|Ga0164307_10477878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 936 | Open in IMG/M |
| 3300012988|Ga0164306_10326766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_67_9 | 1128 | Open in IMG/M |
| 3300012988|Ga0164306_11182449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
| 3300013102|Ga0157371_11577570 | Not Available | 513 | Open in IMG/M |
| 3300013105|Ga0157369_11053041 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300013105|Ga0157369_12039332 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300013296|Ga0157374_12223433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300013297|Ga0157378_11305726 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300013306|Ga0163162_11705999 | Not Available | 719 | Open in IMG/M |
| 3300013306|Ga0163162_12567660 | Not Available | 586 | Open in IMG/M |
| 3300013306|Ga0163162_12759924 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300013306|Ga0163162_13144679 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300013772|Ga0120158_10208075 | Not Available | 1015 | Open in IMG/M |
| 3300014325|Ga0163163_12047806 | Not Available | 632 | Open in IMG/M |
| 3300014325|Ga0163163_12450503 | Not Available | 580 | Open in IMG/M |
| 3300014326|Ga0157380_10242682 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300014326|Ga0157380_11449831 | Not Available | 738 | Open in IMG/M |
| 3300014968|Ga0157379_11084395 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300014968|Ga0157379_11289012 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300015371|Ga0132258_10056989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8980 | Open in IMG/M |
| 3300015373|Ga0132257_101743150 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300017792|Ga0163161_11019814 | Not Available | 707 | Open in IMG/M |
| 3300017959|Ga0187779_10449960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 846 | Open in IMG/M |
| 3300018071|Ga0184618_10144958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 966 | Open in IMG/M |
| 3300018482|Ga0066669_11326277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300021560|Ga0126371_13686050 | Not Available | 517 | Open in IMG/M |
| 3300024254|Ga0247661_1059694 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300025908|Ga0207643_10096769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1727 | Open in IMG/M |
| 3300025917|Ga0207660_10382619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1131 | Open in IMG/M |
| 3300025918|Ga0207662_10751809 | Not Available | 685 | Open in IMG/M |
| 3300025922|Ga0207646_11435017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300025922|Ga0207646_11696275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
| 3300025931|Ga0207644_10818883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 779 | Open in IMG/M |
| 3300025934|Ga0207686_10135341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1696 | Open in IMG/M |
| 3300025934|Ga0207686_10886847 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300025939|Ga0207665_10833241 | Not Available | 730 | Open in IMG/M |
| 3300025972|Ga0207668_10905455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 785 | Open in IMG/M |
| 3300026067|Ga0207678_11492786 | Not Available | 597 | Open in IMG/M |
| 3300026088|Ga0207641_11812245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300026089|Ga0207648_12027572 | Not Available | 537 | Open in IMG/M |
| 3300026116|Ga0207674_11051350 | Not Available | 783 | Open in IMG/M |
| 3300026121|Ga0207683_10819423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300026142|Ga0207698_12751621 | Not Available | 500 | Open in IMG/M |
| 3300026530|Ga0209807_1130092 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300026933|Ga0207578_1016923 | Not Available | 553 | Open in IMG/M |
| 3300027842|Ga0209580_10039863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2162 | Open in IMG/M |
| 3300028802|Ga0307503_10050793 | Not Available | 1581 | Open in IMG/M |
| 3300028802|Ga0307503_10246855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 870 | Open in IMG/M |
| 3300028880|Ga0307300_10208489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300028884|Ga0307308_10013666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3655 | Open in IMG/M |
| 3300031366|Ga0307506_10417255 | Not Available | 553 | Open in IMG/M |
| 3300031716|Ga0310813_11306534 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300031962|Ga0307479_10390193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1377 | Open in IMG/M |
| 3300032126|Ga0307415_101737851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 602 | Open in IMG/M |
| 3300032179|Ga0310889_10667026 | Not Available | 541 | Open in IMG/M |
| 3300033550|Ga0247829_10030279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3595 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 7.26% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.23% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.23% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.61% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.81% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.81% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.81% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.81% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.81% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026933 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10K4-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028880 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0249.00003280 | 2166559005 | Simulated | MAIAYVQEFEIKDGDTSTTNYDAVNAALNLQDAPKDC |
| FA3_00720580 | 2170459023 | Grass Soil | VAIAYVQEFAIKDGDTSTTNYDAVNAALSLQGAPDGL |
| deepsgr_01280200 | 2199352025 | Soil | MTIAYIQEFPIREGEASTANYDAVVAALDLKAAPDGLIVHTAGFDHDAGV |
| INPhiseqgaiiFebDRAFT_1011797273 | 3300000364 | Soil | VAIAYLQEFVIQDGDTSTTNYDAVVAALNLQDAPDGLLIHTAG |
| JGI10214J12806_105698982 | 3300000891 | Soil | MAIAYLQEFKIRDGDTSTTNYDAVVEALNLTDAPDGLLI |
| JGI10216J12902_1130846542 | 3300000956 | Soil | VAIAYVQEFTIQDGDTSTTNYDAVGAALDLKEAPDGLLIHTAGFDHDA |
| Ga0062589_1028616721 | 3300004156 | Soil | MAIAYLQEFKIRDGDTSTTNYDAVVEALNLTDAPDGLLIHTAG |
| Ga0062590_1024729022 | 3300004157 | Soil | MAIAYVQEFTIQDGDTSTTNYDAVASALNLQDAPDGLLIHT |
| Ga0062595_1008343793 | 3300004479 | Soil | VAVAYLQEFVIQNGDTSTTNYDAVAAELGLADVPDGLLIHTAGFDHDA |
| Ga0062594_1008166262 | 3300005093 | Soil | VAVAYIQEFEIQAGDTSTTNYDAVVAALDLRDAPDGLLIHTAGFDHDSGVFRVFDV |
| Ga0066684_103769801 | 3300005179 | Soil | VAIAYVQEFTIQGGDTSTTNYDAVVAALDLKDAPDGLLIHTAGFDHDAGVFRIFDVWETR |
| Ga0066684_104880951 | 3300005179 | Soil | MAIAYVQEFMIQNGDTSTTNYDAVVAALNLQQAPDGLLIHTAGFDHDAGV |
| Ga0066671_109576731 | 3300005184 | Soil | MAIAYVQEFDIVDGNTSTTNYDSIAEKLGNEPGVPGLIVHT |
| Ga0070668_1012724852 | 3300005347 | Switchgrass Rhizosphere | VPIAYIQEFPMVDGDTSTTNYDAVVSKLDLQGAAPQGLLLHSAGFDTDA |
| Ga0070674_1004591631 | 3300005356 | Miscanthus Rhizosphere | VAIAYIQEFEIQAGDTSTTNYDAVVAALDLREAPDGLLIHTAGFDHD |
| Ga0070713_1007681653 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIAYVQEFKIEDGDTSTTNYDAVSAALNLQEAPDGLLIHTA |
| Ga0070681_109575181 | 3300005458 | Corn Rhizosphere | VAVAYLQEFVIQNGDTSTTNYDAVAAELGLADVPDGLLIHTAGFDHD |
| Ga0068867_1004066163 | 3300005459 | Miscanthus Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSRLDLQGAVPQGLLLHSAGFDTDAGVFRIFDVWQTREDGERFMTER |
| Ga0070707_1018738332 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIVYLQEFTIQDGDTSTTNYDAVVAALNLQDAPDGLLIHTAGFDH |
| Ga0070741_108841581 | 3300005529 | Surface Soil | VAVAFVQEFPIQDGDTSTTNYDAVVEALDLKEAPKGL |
| Ga0070684_1005888321 | 3300005535 | Corn Rhizosphere | VAIAYLQEFEIQDGDTSTTNYDAVVAALNLQSAPDGLLIHTAGFDH |
| Ga0070693_1003096682 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVVYIQEFPIQSEDTSNYDAVVAALDLKGPPDGLIVHTAGFDRDAGVFRILDVWESKAQGERFNN |
| Ga0070693_1014005621 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSRLDLQGAVPQGLLLHSAGFDTDAGVFRIFDVWQTREDGER |
| Ga0070665_1020155021 | 3300005548 | Switchgrass Rhizosphere | MAIAYVQEFAIVDGDLSTENYDRVVTELGLQEAPDGLT |
| Ga0070664_1000462166 | 3300005564 | Corn Rhizosphere | MAIAFMQEWPIKDGDTSTTNYDAVSAELNVQQAPDGLLIHTAGFDHDSGV |
| Ga0066703_101427183 | 3300005568 | Soil | VAIAYVQEFTIQGGDTSTTNYDAVVAALDLKDAPDGL |
| Ga0070702_1000882784 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSKLDLQGAVPQGLLLHSAGFDTDAGVFRIFDVWQTREDGERFMTE |
| Ga0068852_1013307881 | 3300005616 | Corn Rhizosphere | MAAAYVQEFAIRDRDTGNYDAVVAKLDLQEPPDGLIVHTAGFDDDAGVFRIFDV* |
| Ga0075291_10388421 | 3300005884 | Rice Paddy Soil | VAIAFIQEWPIRDGDTSTTNYDAVVAELDVQQAPDGLLIHTAGFDHD |
| Ga0066651_102185682 | 3300006031 | Soil | VAIAYLQEFTIKDGDTSTTNYDSVVAALDLQGNAPDGLLIHTAGFDHDGGVFR |
| Ga0070716_1013097431 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIAYLQEFTIQNGDTSTKNYDAVAAALNLQGAPNGLLIHTAG |
| Ga0070716_1017932402 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIAYLQEFKIQDGDTSTANYDAVAAALNLKDAPDGLLIHTAGFDHDGGVFRILDVWETREQGEKFI |
| Ga0066710_1044882702 | 3300009012 | Grasslands Soil | VAIAYVQEFTIQDGDTSTTNYDAVVAALNLQDAPDGLLIHTAGFDHDAVVFRILDVWQTRGQAEAFINVRLNPIIEPQAAAGPQR |
| Ga0105245_103499234 | 3300009098 | Miscanthus Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDAVVSKLDLQGAVPQGLLLHSAGF |
| Ga0105245_107606731 | 3300009098 | Miscanthus Rhizosphere | MAIAYVQEFEIVDGDTSTTNYDAISQRLNLDSAPA |
| Ga0105245_112423512 | 3300009098 | Miscanthus Rhizosphere | MQEWPIKDGDTSTTNYDAVSAELNLQHAPDGMLIHTAGFD |
| Ga0105243_121303111 | 3300009148 | Miscanthus Rhizosphere | MAIVYVQEFDVPAGDRSTTNYDAIRERLGAESDVP |
| Ga0105242_101614351 | 3300009176 | Miscanthus Rhizosphere | MAVAYVQEFTINDGDTSTTNYDAVSDALSLKAPPAGLIAHTAGF |
| Ga0126311_110007821 | 3300010045 | Serpentine Soil | VAVAYLQEFEIQDGDTSTTNYDAVVEALDLTEAPDGLLIHTAGFDHDAGVFRIFDV |
| Ga0134109_101937471 | 3300010320 | Grasslands Soil | MAIAYVQEFMIQNGDTSTTNYDAVVAALNLQQAPD |
| Ga0134067_104316551 | 3300010321 | Grasslands Soil | MAIAYVQEFVIQNGDTSTTNYDAVVAALNLQQAPD |
| Ga0126370_108735493 | 3300010358 | Tropical Forest Soil | MAVAYIQEFDIVDGDTSTTNYDAVSSALNLSSAPDGLIAHTA |
| Ga0126370_119912432 | 3300010358 | Tropical Forest Soil | MAVAFMQEWPIVDGDTSTTNYDAVAAELNLAQAPDGLLIHTAGFDH |
| Ga0134125_122329452 | 3300010371 | Terrestrial Soil | VAIAFIQEFPIMDGDTSTTNYNAVVSKLDLQGAVPQGLLLH |
| Ga0134128_117205381 | 3300010373 | Terrestrial Soil | MPVAFIQEFAIRDGDTSTTNYDAVTAELNLQEAPDGALIHTAGFDTDAGV |
| Ga0105246_117199341 | 3300011119 | Miscanthus Rhizosphere | MAVVYVQEFAIRDGDTRTDNYDAVVAKLDLQGPPEGLIVHTAGYDLEAGVFRILDVWETRAQGQRF |
| Ga0105246_120809171 | 3300011119 | Miscanthus Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSKLDLQGAVPQGLLLHSAGFDTDAGVFRIFD |
| Ga0137365_107806781 | 3300012201 | Vadose Zone Soil | VPIAFLQEFEIQGGDTSTTNYDAVSAELNLQEAPDGLLIHTAGFDHDSGVFRIFD |
| Ga0137399_113656871 | 3300012203 | Vadose Zone Soil | VAIAYLQEFTIQNGDTSTTNYDAVVAALNLQDAPDGLLIHTAGFDLDAGVFRILDVWETRAQGEKFIN |
| Ga0137379_116039081 | 3300012209 | Vadose Zone Soil | MVARNPTRTELHMAIAYVQEFEIKDGDTSTTNYDAVNAALDLQDAPDGLLIHTAGFDLDAGV |
| Ga0137377_103512041 | 3300012211 | Vadose Zone Soil | MQALSTKRSPKVAIAYLQEFTIQDGDTSTTNYDAVNAALDLKGAPDGLLIHTAGFDH |
| Ga0137385_115170031 | 3300012359 | Vadose Zone Soil | VAIAYLQEFKIQDGDTSTANYDAVNAALNLQTAPDGLLIHTAGFD |
| Ga0137385_116631991 | 3300012359 | Vadose Zone Soil | VAIAYVQEFDIKDGDTSTTNYDAVNAALDLQGAPDGLLIHTAGFDLDAG |
| Ga0137390_104035413 | 3300012363 | Vadose Zone Soil | VAIAYVQEFEIKDGDTSTTNYDAVNAALNLQGAPEGLLIHTAGFDLD |
| Ga0137373_107519141 | 3300012532 | Vadose Zone Soil | VAIAYVQEFEIQGGDTSTTNYDAVAAALNLQEAPEGLLIHTAGFDHDAGVFRILDVWETREHG |
| Ga0137358_104552044 | 3300012582 | Vadose Zone Soil | MAIAYLQEFTIQDGDTSTTNYDAVTAALNLQETPDGLL |
| Ga0157296_103245091 | 3300012905 | Soil | MAIAYLQEFQIRDGDTSTTNYDAVVEALNLTDAPDG |
| Ga0157302_101880461 | 3300012915 | Soil | MQEWPIKDGDTSTTNYDAVSAELNVQQAPDGLLIHTA |
| Ga0137359_110328202 | 3300012923 | Vadose Zone Soil | VAIAYLQEFTIQNGDTSTTNYDAVVAALNLQDAPDGLLIHTAGFDHDAGVF |
| Ga0137413_116488701 | 3300012924 | Vadose Zone Soil | VPIAYVQEFEIKDGDTSTTNYDAVNAALNLQSAPDGLLIHTAGFDLDAGVFRIFDV |
| Ga0137407_103883372 | 3300012930 | Vadose Zone Soil | MAVAYLQEFTIQNGDTSTTNYDAVTAALDLKDAPDGLLIHTAGF |
| Ga0164241_107987271 | 3300012943 | Soil | VPIAYIQEFPIVDGDTSTTNYDAVAAKLDLQGAAPQGLLLHSAGFDHDAGVFR |
| Ga0164298_103970522 | 3300012955 | Soil | MQEWPIQDGDTSTTNYDAVSAELNLQQAPEGLLIHTA |
| Ga0164303_100641991 | 3300012957 | Soil | VAVVYIQEFPIQSEDTSNYDAVVAALDLKGPPDGLIVHTAGFDRDAGVFRILDV |
| Ga0164301_110641451 | 3300012960 | Soil | MAVAYLQEFTIKDGDTSTTNYDAVVAALNLQEAPDGLLIHTAGFDHDA |
| Ga0134087_102748632 | 3300012977 | Grasslands Soil | VAIAYVQEFTIQGGDTSTTNYDAVVAALDLKDAPDGLLIHTAGFDHDAGVFRIFD |
| Ga0164309_106718541 | 3300012984 | Soil | MAIAYLQEFQIRDGDTSTTNYDAVVEELNLTDTPD |
| Ga0164307_104778782 | 3300012987 | Soil | MAIAYVQEFKILDGDTSTTNYDAVNAALDLKSAPDGLLIHTAGFDHDAGVFRILDVWETRAQGEKFIN |
| Ga0164306_103267661 | 3300012988 | Soil | MAIAYVQEFKILDGDTSTTNYDAVNAALDLKSAPDG |
| Ga0164306_111824492 | 3300012988 | Soil | VAVVYLQEFTIQNGDTSTKNYDAVAAALNLQGAPNGLLIHTAGFDLDAGVFRILDVWETR |
| Ga0157371_115775702 | 3300013102 | Corn Rhizosphere | VAIAYVQEFKIKDGDTSTTNYDAVNDALNLQSAPEGLL |
| Ga0157369_110530412 | 3300013105 | Corn Rhizosphere | MAIAFMQEWPIQDGDTSTTNYDAVSTELNLEQAPDGLLIHTAGFDH |
| Ga0157369_120393321 | 3300013105 | Corn Rhizosphere | MPVAYVQEFKIRDGDTSTTNYDAVAAELNLSDPPDGGLIHTAGFDL |
| Ga0157374_122234332 | 3300013296 | Miscanthus Rhizosphere | VAIAYVQEFEIKDGDTSTTNYDAVNAALNLQGAPEGLLIHTAGFDLDAG |
| Ga0157378_113057262 | 3300013297 | Miscanthus Rhizosphere | VAVAYLQEFTIKDGDTSTTNYDAVTKALDLQEAPDGLLIHTAGFDHD |
| Ga0163162_117059991 | 3300013306 | Switchgrass Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSRLDLQGAVPQGLLLHSAGFDTDAGVFRI |
| Ga0163162_125676601 | 3300013306 | Switchgrass Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDAVVSKLDLQGAVPQGLLLHSAGFDTDAG |
| Ga0163162_127599242 | 3300013306 | Switchgrass Rhizosphere | VAVVYIQEFPIQSDDTSNYDAVVKALDLKGAPDGLIVHTAGFDRDAGVFRILDVWESRAQGERFNNDQLGPI |
| Ga0163162_131446792 | 3300013306 | Switchgrass Rhizosphere | MAIAYVQEFEIVDGDTSTTNYDAISQRLNLDSAPAGLIAHTAGFDDEKGVFR |
| Ga0120158_102080751 | 3300013772 | Permafrost | MAIAYVQEFEIKGGDTSTTNYDAVNAALNLQGAPEGLLIHTAGFDLDAGLFRIFDVWEPREH |
| Ga0163163_120478061 | 3300014325 | Switchgrass Rhizosphere | MAIAFIQEFPIVDGDTSTTNYDAVVSKLDLQGSVPQGLLLHSAGFDADAG |
| Ga0163163_124505031 | 3300014325 | Switchgrass Rhizosphere | VAIAYVQEFEIKDGDTSTTNYDAVNAALNLQGAPEGLLIHTAGFD |
| Ga0157380_102426821 | 3300014326 | Switchgrass Rhizosphere | MAVAYVQEFTIVDGDTSTKNDDAVNDALGLSAAPQ |
| Ga0157380_114498312 | 3300014326 | Switchgrass Rhizosphere | VAVVYIQEFPIQSEDTSNYDAVVAALDLKGPPDGLIVHTAGF |
| Ga0157379_110843951 | 3300014968 | Switchgrass Rhizosphere | MAIAFMQEWPIQDGDTSTTNYDAVSTELNLEQAPDGLLIHTAGFDHD |
| Ga0157379_112890122 | 3300014968 | Switchgrass Rhizosphere | MAIAYVQEFEIVDGDTSTTNYDAISQRLNLDSAPDGLIVHTAGFD |
| Ga0132258_1005698910 | 3300015371 | Arabidopsis Rhizosphere | MAVAYIQEFDIVDGDTSTTNYDAVVEALNLSSAPDGLIAHTAG |
| Ga0132257_1017431501 | 3300015373 | Arabidopsis Rhizosphere | MAIAYVQEFAIVDGDTSTTNYDAISKELNLQSPPD |
| Ga0163161_110198141 | 3300017792 | Switchgrass Rhizosphere | VAVVYIQEFPIQSEDTSNYDAVVAALDLKGPPDGLIVHTAGFDRDAGV |
| Ga0187779_104499602 | 3300017959 | Tropical Peatland | VAVAYVQEFEIRDGNTSTANYDAVVAGVNLQAAPDGLLIHTAGFDMDAGVFRIFDVWETREQG |
| Ga0184618_101449582 | 3300018071 | Groundwater Sediment | VAIAYLQEFTIQNGDTSTTNYDAVVAALNLQDAPDGLLIHTAGFDHD |
| Ga0066669_113262771 | 3300018482 | Grasslands Soil | VAIAYVQEFTIQGGDTSTTNYDAVVAALDLKDAPDGLLIHTAGFDHDAGVFRIFDVWETRGQGEKFIN |
| Ga0126371_136860501 | 3300021560 | Tropical Forest Soil | MAVVYLQEFAIVNGDTSTTNYDAVVAALNLKEAPDG |
| Ga0247661_10596942 | 3300024254 | Soil | VAIAYLQEFEIQDGDTSTTNYDAVVAALNLQSAPDGLLIHTAGFDHDAGVFRIL |
| Ga0207643_100967691 | 3300025908 | Miscanthus Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSKLDLQGAVPQGLLLHSAGFDTDAGVFRIFDV |
| Ga0207660_103826193 | 3300025917 | Corn Rhizosphere | MAIAFMQEWPIQDGDTSTTNYDAVSTELNLEQAPDGLLIHTAGFDHDSGVFRVFDV |
| Ga0207662_107518092 | 3300025918 | Switchgrass Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSRLDLQGAVPQGLLLHSAGFDTDAGVFRIF |
| Ga0207646_114350172 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIVYLQEFTIQDGDTSTTNYDAVVAALNLQDAPDGLLIHTAGFDHDAGVFRILD |
| Ga0207646_116962751 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIGYLQEFEIQDGDTSTTNYDAVVAALNLQDAPDGLLIHTAGFDHEAGVFRIFDVWETR |
| Ga0207644_108188831 | 3300025931 | Switchgrass Rhizosphere | VAIAYVQEFKIKDGDTSTTNYDAVNAALNLQVAPEGL |
| Ga0207686_101353411 | 3300025934 | Miscanthus Rhizosphere | MAVAYVQEFKINDGDTSTTNYDAVSDALSLKSPPAG |
| Ga0207686_108868472 | 3300025934 | Miscanthus Rhizosphere | VAIAFMQEWPIQDGDTSTTNYDAVSTELNLEQAPDGLLIHTA |
| Ga0207665_108332411 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVVYIQEFPIQSEDTSNYDAVVAALDLKGPPDGLIVHTAGFDRDAGVFRILDVWESKAQGERFNND |
| Ga0207668_109054552 | 3300025972 | Switchgrass Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSRLDLQGAVPQGLLLHSAGFDTDAGVFRIFDVWQTREDGERFM |
| Ga0207678_114927862 | 3300026067 | Corn Rhizosphere | VAIAYVQEFEIKDGDTSTTNYDAVNAALNLQGAPEG |
| Ga0207641_118122451 | 3300026088 | Switchgrass Rhizosphere | VAIAYVQEFKIKDGDTSTTNYDAVNAALNLQVAPEGLLIHTAGFDLDAG |
| Ga0207648_120275721 | 3300026089 | Miscanthus Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDAVVSKLDLQGAVPQ |
| Ga0207674_110513501 | 3300026116 | Corn Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSKLDLQGAVPQGLLLHSA |
| Ga0207683_108194232 | 3300026121 | Miscanthus Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSKLDLQGAVPQGLLLHSAGFDTDAGVFRIFDVWQTREDGERFM |
| Ga0207698_113516832 | 3300026142 | Corn Rhizosphere | MAIAFIQEFPIVDGDTSTTNYDAVVQKLDLGRTAV |
| Ga0207698_127516211 | 3300026142 | Corn Rhizosphere | VAIAFIQEFPIVDGDTSTTNYDTVVSKLDLQGAVPQGLLLHSAGFDT |
| Ga0209807_11300923 | 3300026530 | Soil | MPVAFVQEFAIRDGDTSTENYDAVASALNIQHAPDGALIHTAGFDLDAGVFRIFDVWETREQGE |
| Ga0207578_10169231 | 3300026933 | Soil | MTVVFIQEFPIVDGDTSTTNYDTVVSKLDLQGAVPQGLLLHSAGFDTDAGV |
| Ga0209580_100398631 | 3300027842 | Surface Soil | VAIAYVQEFTIQDGDTSTTNYDAVNSALNLQEAPDGLLIHT |
| Ga0307503_100507931 | 3300028802 | Soil | VAIAFIQEFTIVDGDTSTTNYDAVVAKLGLQGAAPQGLLLH |
| Ga0307503_102468552 | 3300028802 | Soil | MAVAYLQEFKIVDGDTSTTNYDSVAEKLNLTTAPDGLIVHT |
| Ga0307300_102084893 | 3300028880 | Soil | VAVAYVQEFQIQGGDTSTTNYDAVVAELGLQDAPDGLLIHTAGFDHTSG |
| Ga0307308_100136661 | 3300028884 | Soil | VAIAYLQEFTIQNGDTSTTNYDAVVAALNLQDAPDGLLIHTAGFDHDAGVFRILDV |
| Ga0307506_104172551 | 3300031366 | Soil | MAVVYIQEFPIQNEDTSNYDAVVAALDLKAAPDGLIVHTAGFDRDAGVFRILDVWESRA |
| Ga0310813_113065342 | 3300031716 | Soil | MAIAYVQEFEIVDGDTSTTNYDAISQRLNLDSAPDG |
| Ga0307479_103901931 | 3300031962 | Hardwood Forest Soil | MAIAYVQEFTIQAGDTSTTNYVAVNAALNLQEAPDGLL |
| Ga0307415_1017378511 | 3300032126 | Rhizosphere | MAVAYLQEFEIQDGDTSTTNYDAVVEALNLQETPEGLLIHTAGFDHDAGV |
| Ga0310889_106670261 | 3300032179 | Soil | VAIAFIQEFPIVDGDTSTTNYDTVVSRLDLQGAVPQGLLLHSAGFDSDAGVFRIFD |
| Ga0247829_100302797 | 3300033550 | Soil | VAIAFIQEFPIMDGDTSTTNYDAVVSKLDLQGAVPQGLLLHSAG |
| ⦗Top⦘ |