| Basic Information | |
|---|---|
| Family ID | F069212 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MGEDRLHVVFGTGQVGSALAAHLAGLGIAVRAVSRHRPPVLAGVDWR |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.08 % |
| % of genes near scaffold ends (potentially truncated) | 95.97 % |
| % of genes from short scaffolds (< 2000 bps) | 90.32 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (66.935 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.290 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.548 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.258 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 16.00% β-sheet: 13.33% Coil/Unstructured: 70.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF12802 | MarR_2 | 16.94 |
| PF04024 | PspC | 12.90 |
| PF00196 | GerE | 8.06 |
| PF13460 | NAD_binding_10 | 4.03 |
| PF14329 | DUF4386 | 4.03 |
| PF07883 | Cupin_2 | 1.61 |
| PF08240 | ADH_N | 1.61 |
| PF13185 | GAF_2 | 0.81 |
| PF01545 | Cation_efflux | 0.81 |
| PF00723 | Glyco_hydro_15 | 0.81 |
| PF01047 | MarR | 0.81 |
| PF00689 | Cation_ATPase_C | 0.81 |
| PF14026 | DUF4242 | 0.81 |
| PF09339 | HTH_IclR | 0.81 |
| PF11716 | MDMPI_N | 0.81 |
| PF00005 | ABC_tran | 0.81 |
| PF03176 | MMPL | 0.81 |
| PF01566 | Nramp | 0.81 |
| PF01740 | STAS | 0.81 |
| PF14333 | DUF4389 | 0.81 |
| PF07681 | DoxX | 0.81 |
| PF00440 | TetR_N | 0.81 |
| PF05977 | MFS_3 | 0.81 |
| PF00583 | Acetyltransf_1 | 0.81 |
| PF00106 | adh_short | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.81 |
| COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.81 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.81 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.81 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.81 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.81 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3387 | Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family | Carbohydrate transport and metabolism [G] | 0.81 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.81 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.74 % |
| Unclassified | root | N/A | 32.26 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001408|JGI20206J14855_1035980 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300001418|JGI20188J14859_1002322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2617 | Open in IMG/M |
| 3300001471|JGI12712J15308_10174703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Anaeromyxobacteraceae → Anaeromyxobacter → unclassified Anaeromyxobacter → Anaeromyxobacter sp. K | 560 | Open in IMG/M |
| 3300002906|JGI25614J43888_10154731 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300002914|JGI25617J43924_10058984 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300004080|Ga0062385_10785298 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300004152|Ga0062386_100053455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3043 | Open in IMG/M |
| 3300004213|Ga0066648_10644732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 595 | Open in IMG/M |
| 3300004479|Ga0062595_100545635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
| 3300005338|Ga0068868_102241901 | Not Available | 520 | Open in IMG/M |
| 3300005406|Ga0070703_10562309 | Not Available | 521 | Open in IMG/M |
| 3300005437|Ga0070710_11266817 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005445|Ga0070708_100742813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 923 | Open in IMG/M |
| 3300005458|Ga0070681_11377979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300005468|Ga0070707_100460866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1232 | Open in IMG/M |
| 3300005535|Ga0070684_101458280 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005541|Ga0070733_10821535 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005541|Ga0070733_11002575 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005614|Ga0068856_100259087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1754 | Open in IMG/M |
| 3300005921|Ga0070766_10632178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300005921|Ga0070766_11277257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300006028|Ga0070717_11804724 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006050|Ga0075028_100672535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 621 | Open in IMG/M |
| 3300006059|Ga0075017_100191241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1476 | Open in IMG/M |
| 3300006173|Ga0070716_101741889 | Not Available | 515 | Open in IMG/M |
| 3300006176|Ga0070765_102010110 | Not Available | 541 | Open in IMG/M |
| 3300006354|Ga0075021_11089207 | Not Available | 523 | Open in IMG/M |
| 3300006358|Ga0068871_101757777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
| 3300006572|Ga0074051_11697322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 645 | Open in IMG/M |
| 3300006581|Ga0074048_13509878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300006854|Ga0075425_101997770 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300006904|Ga0075424_102525743 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009522|Ga0116218_1291741 | Not Available | 731 | Open in IMG/M |
| 3300009523|Ga0116221_1435175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
| 3300009525|Ga0116220_10000347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 18273 | Open in IMG/M |
| 3300009525|Ga0116220_10296147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 712 | Open in IMG/M |
| 3300009700|Ga0116217_10200939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1310 | Open in IMG/M |
| 3300010343|Ga0074044_10708052 | Not Available | 657 | Open in IMG/M |
| 3300010371|Ga0134125_10598176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1219 | Open in IMG/M |
| 3300010379|Ga0136449_101173195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1213 | Open in IMG/M |
| 3300010379|Ga0136449_101190083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1202 | Open in IMG/M |
| 3300010379|Ga0136449_101687339 | Not Available | 956 | Open in IMG/M |
| 3300010397|Ga0134124_11825521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 642 | Open in IMG/M |
| 3300010401|Ga0134121_10091629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2540 | Open in IMG/M |
| 3300011120|Ga0150983_15856262 | Not Available | 699 | Open in IMG/M |
| 3300012923|Ga0137359_10850321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300014162|Ga0181538_10745249 | Not Available | 506 | Open in IMG/M |
| 3300014200|Ga0181526_11057684 | Not Available | 510 | Open in IMG/M |
| 3300017821|Ga0187812_1180812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 675 | Open in IMG/M |
| 3300017821|Ga0187812_1305767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 505 | Open in IMG/M |
| 3300017821|Ga0187812_1306891 | Not Available | 504 | Open in IMG/M |
| 3300017932|Ga0187814_10044059 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300017932|Ga0187814_10053465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1487 | Open in IMG/M |
| 3300017932|Ga0187814_10414545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300017933|Ga0187801_10317242 | Not Available | 636 | Open in IMG/M |
| 3300017937|Ga0187809_10211441 | Not Available | 691 | Open in IMG/M |
| 3300017943|Ga0187819_10771903 | Not Available | 540 | Open in IMG/M |
| 3300017946|Ga0187879_10323277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 856 | Open in IMG/M |
| 3300017974|Ga0187777_10263952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 1171 | Open in IMG/M |
| 3300017995|Ga0187816_10224793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 818 | Open in IMG/M |
| 3300018007|Ga0187805_10244613 | Not Available | 822 | Open in IMG/M |
| 3300018007|Ga0187805_10507731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300018034|Ga0187863_10395896 | Not Available | 770 | Open in IMG/M |
| 3300018038|Ga0187855_10544042 | Not Available | 676 | Open in IMG/M |
| 3300018060|Ga0187765_10456974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 800 | Open in IMG/M |
| 3300020580|Ga0210403_10644467 | Not Available | 853 | Open in IMG/M |
| 3300020582|Ga0210395_10279074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1256 | Open in IMG/M |
| 3300020583|Ga0210401_10723936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 855 | Open in IMG/M |
| 3300021086|Ga0179596_10259558 | Not Available | 860 | Open in IMG/M |
| 3300021180|Ga0210396_10885016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 762 | Open in IMG/M |
| 3300021180|Ga0210396_11311333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300021404|Ga0210389_11413825 | Not Available | 530 | Open in IMG/M |
| 3300021406|Ga0210386_10495701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1055 | Open in IMG/M |
| 3300021407|Ga0210383_10176483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1822 | Open in IMG/M |
| 3300021420|Ga0210394_11003622 | Not Available | 723 | Open in IMG/M |
| 3300021433|Ga0210391_11031854 | Not Available | 640 | Open in IMG/M |
| 3300021474|Ga0210390_10199217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1693 | Open in IMG/M |
| 3300021477|Ga0210398_10598120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 896 | Open in IMG/M |
| 3300021479|Ga0210410_10166103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1971 | Open in IMG/M |
| 3300021479|Ga0210410_11412181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 589 | Open in IMG/M |
| 3300022557|Ga0212123_10085510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2641 | Open in IMG/M |
| 3300023672|Ga0247553_110071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300025625|Ga0208219_1025626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1665 | Open in IMG/M |
| 3300025627|Ga0208220_1088964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
| 3300025857|Ga0209014_10240572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 608 | Open in IMG/M |
| 3300025898|Ga0207692_10055487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2028 | Open in IMG/M |
| 3300025915|Ga0207693_10284478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
| 3300026078|Ga0207702_10223801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1754 | Open in IMG/M |
| 3300027030|Ga0208240_1032750 | Not Available | 579 | Open in IMG/M |
| 3300027096|Ga0208099_1015044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1058 | Open in IMG/M |
| 3300027568|Ga0208042_1005609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3504 | Open in IMG/M |
| 3300027652|Ga0209007_1030482 | Not Available | 1386 | Open in IMG/M |
| 3300027737|Ga0209038_10095232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 898 | Open in IMG/M |
| 3300027812|Ga0209656_10133423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1264 | Open in IMG/M |
| 3300027829|Ga0209773_10078233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1355 | Open in IMG/M |
| 3300027854|Ga0209517_10461878 | Not Available | 699 | Open in IMG/M |
| 3300027889|Ga0209380_10729205 | Not Available | 567 | Open in IMG/M |
| 3300027898|Ga0209067_10060227 | Not Available | 1942 | Open in IMG/M |
| 3300028718|Ga0307307_10113148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → Solirubrobacter pauli | 834 | Open in IMG/M |
| 3300028775|Ga0302231_10288098 | Not Available | 688 | Open in IMG/M |
| 3300028884|Ga0307308_10062771 | Not Available | 1751 | Open in IMG/M |
| 3300028906|Ga0308309_10231084 | Not Available | 1538 | Open in IMG/M |
| 3300028906|Ga0308309_10477056 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300029882|Ga0311368_11085937 | Not Available | 521 | Open in IMG/M |
| 3300030707|Ga0310038_10170242 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 1064 | Open in IMG/M |
| 3300030763|Ga0265763_1027073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 634 | Open in IMG/M |
| 3300030941|Ga0265737_106653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300031027|Ga0302308_10449014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
| 3300031234|Ga0302325_13394355 | Not Available | 502 | Open in IMG/M |
| 3300031240|Ga0265320_10519397 | Not Available | 526 | Open in IMG/M |
| 3300031452|Ga0272422_1154567 | Not Available | 747 | Open in IMG/M |
| 3300031469|Ga0170819_15234627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
| 3300031708|Ga0310686_107957933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300031708|Ga0310686_117551157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300031718|Ga0307474_10113730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2029 | Open in IMG/M |
| 3300031823|Ga0307478_11372071 | Not Available | 587 | Open in IMG/M |
| 3300031918|Ga0311367_10243706 | Not Available | 1873 | Open in IMG/M |
| 3300032160|Ga0311301_10034426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 12763 | Open in IMG/M |
| 3300032160|Ga0311301_10553488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1680 | Open in IMG/M |
| 3300032160|Ga0311301_11298071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 920 | Open in IMG/M |
| 3300032805|Ga0335078_12251589 | Not Available | 572 | Open in IMG/M |
| 3300032895|Ga0335074_10208968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2364 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.29% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 9.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.84% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.03% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 4.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.03% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.23% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.23% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.61% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.61% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.61% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.61% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.61% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.61% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.81% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Rock | Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001408 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004213 | Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NA | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025857 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027030 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF041 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030941 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031452 | Rock endolithic microbial communities from Victoria Land, Antarctica - Mt New Zealand nord | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20206J14855_10359801 | 3300001408 | Arctic Peat Soil | MGDDRLHVVFGTGQVGRVLAAYLAGQGLAVRAVSRHRPPGLADGIDWR |
| JGI20188J14859_10023226 | 3300001418 | Arctic Peat Soil | MAAPDRPHVVFGTGQVGRALAAHLTRLGLPVRAVSRHQPPALDASVEWWPADVTDPEAATDA |
| JGI12712J15308_101747031 | 3300001471 | Forest Soil | MPEGGLHVVFGTGQVGLALAGRLAGLGVDVRAVSRRRPVALA |
| JGI25614J43888_101547312 | 3300002906 | Grasslands Soil | MGEDRLHVVFGTGQVGSALAAHLAGQGLPVRAVSRHRPPALAGGVDWR |
| JGI25617J43924_100589843 | 3300002914 | Grasslands Soil | MGEDRLHVVFGTGQVGSALAAHLAGQGLPVRAVSRHRPPALA |
| Ga0062385_107852982 | 3300004080 | Bog Forest Soil | MDDDRLHIVFGTGQVGSALAAHLAGLGIAVRAVSRHRPPALAGVDWR |
| Ga0062386_1000534551 | 3300004152 | Bog Forest Soil | MSEGGLHVVFGTGQVGLALADRLADLGAQVRSVSRRRPVTMALDVD |
| Ga0066648_106447321 | 3300004213 | Groundwater | MGDGPLHVVFGTGQVGMALAAELSGRGLAVRAVSRSRPATLDADIDW |
| Ga0062595_1005456351 | 3300004479 | Soil | MGEDRLHVVFGTGQVGSALTAHLARQGIAVRAVSRNRPPALAGGADW |
| Ga0068868_1022419012 | 3300005338 | Miscanthus Rhizosphere | MDEARLHVVFGTGQVGSALAAHLAGLGVAVRAVSRHRPPVLAGGTDW |
| Ga0070703_105623092 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEARLHVVFGTGQVGSALAAHLAGLGVAVRAVSRHRPPVLAGGTDWRAADV |
| Ga0070710_112668171 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTPTAGAAGPGEDRLHVVFGTGQVGSALAARLADLGIPVRLVSRRRPALRPGT |
| Ga0070708_1007428132 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEDRLHVVFGTGQVGTALAAHLAGLGLAVRAVSRHRPPALA |
| Ga0070681_113779792 | 3300005458 | Corn Rhizosphere | MGEARLHVVFGTGQVGGALAAHLAGLGVAVRAVSRHRPPVL |
| Ga0070707_1004608663 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEEQLHVVFGTGQVGSALAAHLTGMGLAVRAVSRDRPRALADGAD |
| Ga0070684_1014582802 | 3300005535 | Corn Rhizosphere | MPEGGLHVVFGTGQVGLALAGRLAGLGIEVRAVSRRRPVALADGVD |
| Ga0070733_108215352 | 3300005541 | Surface Soil | MGEDRLHVVFGTGQVGNALAAHLAATGNAVRAVSRRR |
| Ga0070733_110025752 | 3300005541 | Surface Soil | VFGTGQVGRALAAHLAGQGIAVRAVSRHRPAALGGVDW |
| Ga0068856_1002590873 | 3300005614 | Corn Rhizosphere | MGEARLHVVFGTGQVGSALAAHLAGLGMAVRAVSRHRPP |
| Ga0070766_106321782 | 3300005921 | Soil | MSDDRLHIVFGTGQVGTALVGYLSGLGIAVRAVSRHQPPAL |
| Ga0070766_112772572 | 3300005921 | Soil | MGDDQLHIVFGTGQVGSALAAHLAGMGIAVRAVSRHRPPAL |
| Ga0070717_118047242 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSGQYRLHVVFGSGQVGSALAARLAGLGIPVRAVSRHR |
| Ga0075028_1006725352 | 3300006050 | Watersheds | MGDRGVHVVFGTGQVGTALAAQLAHSGVSVRAVSR |
| Ga0075017_1001912413 | 3300006059 | Watersheds | MSEQGLHIVFGTGQVGNALVKRLAEMGLAVRSVSRHQPQA |
| Ga0070716_1017418891 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEDRLHVVFGTGQVGSALAAHLAGLGLAVRAVSRHRPATLAEG |
| Ga0070765_1020101102 | 3300006176 | Soil | MSEARLHVVFGTDQAGSALAAQLSGPSVAVRAVSRHRPVMAAGGPEKGKWS* |
| Ga0075021_110892072 | 3300006354 | Watersheds | MGVDRLQVVFGTGQVGSALVAHLASMGLAVRAVSRHRPPALA |
| Ga0068871_1017577772 | 3300006358 | Miscanthus Rhizosphere | MGEARLHVVFGTGQVGGALAAHLAGLGVAVRAVSRHRPPVLAGGTDWRAADV |
| Ga0074051_116973222 | 3300006572 | Soil | MGEDRLHVVFGTGQVGSALAAHLAELGMAVRTVSRHRPPALTGGTDWRAADVS |
| Ga0074048_135098782 | 3300006581 | Soil | MGEDRLHVVFGTGQVGSALAAHLAELGMAVRTVSRHRPPALTGGTDWRAADVSDP |
| Ga0075425_1019977702 | 3300006854 | Populus Rhizosphere | VFGTGQAGNALAAHLAGLGMAVRAVSRHRPAELAGGTDWRAADVTDP |
| Ga0075424_1025257432 | 3300006904 | Populus Rhizosphere | MGEDRLHVVFGTGQAGSGLAGQGIAVRAVCRHRPPALVGVDWRP |
| Ga0116218_12917412 | 3300009522 | Peatlands Soil | MGEDRLHVVFGTGQVGHGLAAVLPGRGLTVRVVLPHRPPELADGMGWRATDPTAPDA |
| Ga0116221_14351752 | 3300009523 | Peatlands Soil | MGEDRLHVVFGTGQVGSALAAHLAGQGIAVRAVSRHRPPALAGVDWRA |
| Ga0116220_1000034720 | 3300009525 | Peatlands Soil | MSDDRLHVVFGTGQVGSALAAHLAGQGIAVRAVSRHQPPALARVDWRAADAA |
| Ga0116220_102961472 | 3300009525 | Peatlands Soil | MDEGQLHVVFGTGQVGNALAAHLASLGMAVRTVSRHRPPTRAGIDWRPAAVTEP |
| Ga0116217_102009391 | 3300009700 | Peatlands Soil | MGEDRLHVAFGTGQVGHALAAVLAGRGLTVRVVSRHRPPELADGIDW |
| Ga0074044_107080521 | 3300010343 | Bog Forest Soil | MGEDRLHVVFGTGQVGHALAAVLTGRGLTVRVVSRHRPPELADGI |
| Ga0134125_105981761 | 3300010371 | Terrestrial Soil | MGEARLHVVFGTGQVGGALAAHLAGLGVAVRAVSRHRPPVLAGGTDWRAAD |
| Ga0136449_1011731954 | 3300010379 | Peatlands Soil | MDEGQLHVVFGTGQVGNALAAHLASLGMAVRTVSRHRPPARAGIDWRP |
| Ga0136449_1011900831 | 3300010379 | Peatlands Soil | MGEDRLHVVFGTGQVGSAVAAHLAGRGIAVRAVSRHRPPALAGVDWR |
| Ga0136449_1016873391 | 3300010379 | Peatlands Soil | MGEDRLHVVFGTGQVGNALTAHLAGLGIAVRAVSRHRPPALAAGTDWRAAD |
| Ga0134124_118255212 | 3300010397 | Terrestrial Soil | MDEARLHVVFGTGQVGSALAAHLAGLGVAVRAVSRH |
| Ga0134121_100916291 | 3300010401 | Terrestrial Soil | MGEARLHVVFGTGQVGSALAAHLAGLGVAVRAVSRHRPPVLAGGTDWRA |
| Ga0150983_158562621 | 3300011120 | Forest Soil | MGEDRLHVVFGTGQVGSALAAHLAGLGIAVRAVSRHRPPVLAGVDWR |
| Ga0137359_108503212 | 3300012923 | Vadose Zone Soil | MDDDRLHIVFGTGQVGSALAAHLAGMGHAVRAVSRHRPAPLAGVDWRAADAADPKPPPTRPRAHR* |
| Ga0181538_107452491 | 3300014162 | Bog | MGGDRLQHVVFGTGQVGSALAAHLARAGVAVRAVSRNRPATLAAGV |
| Ga0181523_104704973 | 3300014165 | Bog | MSDDRLQIVFGAGQVGNALAAHLAGLGHPVRAVSR |
| Ga0181526_110576841 | 3300014200 | Bog | VVFGAGQVGRVLAALLAARGVMVRVVSRRRPAGLAEGTDWRAADAADLDAA |
| Ga0187812_11808121 | 3300017821 | Freshwater Sediment | MGEDRLHVVFGTGQVGSGLAAHLAGLGIAVRAVSRHRPPALA |
| Ga0187812_13057671 | 3300017821 | Freshwater Sediment | MGEGQLHVVFGTGQVGSALAAHLASQGLAVRAVSRHRP |
| Ga0187812_13068912 | 3300017821 | Freshwater Sediment | MGVDRLHVVFGTGQVGSALAAHLAGLGIAVRAVSRHRPATLAG |
| Ga0187814_100440591 | 3300017932 | Freshwater Sediment | MGEDRLHVVFGTGQVGSALVAHLAGLGVAVRAVSRSRPATL |
| Ga0187814_100534651 | 3300017932 | Freshwater Sediment | MGENRLHVVFGTGQVGSALAAHLAGLDIAVRAVSRHRPPA |
| Ga0187814_104145451 | 3300017932 | Freshwater Sediment | MGDDRLHVVFGTGQVGSALAAHLAGQGMAVRAVSRHQPAALAGV |
| Ga0187801_103172421 | 3300017933 | Freshwater Sediment | MAEGQLHVVFGTGQVGLALATRLAASGIAVRAVSRQRPAALAEG |
| Ga0187809_102114411 | 3300017937 | Freshwater Sediment | MAEDRLHVVFGTGQVGSALAAHLSGQGVAVRAVSRHRPTA |
| Ga0187819_107719031 | 3300017943 | Freshwater Sediment | MAEDPLHVVFGSGQVGLALAARLAGASTSVRTVSRHRPAALVDGVD |
| Ga0187879_103232772 | 3300017946 | Peatland | MDEGQPHVVFGTGQVGSALAAYLASLGMSVRVVSRHRPPARAGIDWRPADVTEPEAAA |
| Ga0187777_102639521 | 3300017974 | Tropical Peatland | MNTPIPGKDRLHVVFGTGQVGSALAANLADLGIPVRTVSRHRPATLPGGTD |
| Ga0187816_102247931 | 3300017995 | Freshwater Sediment | MGEEQLHVVFGTGQVGSALAAHLTGMGLAVRTVSRDRPR |
| Ga0187805_102446131 | 3300018007 | Freshwater Sediment | MGEDRLHVVFGTGQVGAALAAHLAGLGIAVRAVSRHRPPALAGV |
| Ga0187805_105077312 | 3300018007 | Freshwater Sediment | MSDDRLHIVFGTGQVGIALAAHLTGLGIAVRAVSRHRPPALAGVDWRA |
| Ga0187863_103958962 | 3300018034 | Peatland | MGEDRLHVVFGTGQVGNALAAHLAGLRNAVRAVSRHRPPT |
| Ga0187855_105440422 | 3300018038 | Peatland | MGEDRLHVVFGTGQVGNALAAHLAGLGNAVRAVSRHR |
| Ga0187765_104569742 | 3300018060 | Tropical Peatland | MNAPTEDRLHVVFGTGQVGRALAAHLAGLGIPVRAVSRHRPAALPGGA |
| Ga0182025_11720603 | 3300019786 | Permafrost | MSEPDLHVVFGTGQVGRELADQLSKMGIAVRSVSR |
| Ga0210403_106444671 | 3300020580 | Soil | MGENRLDVVFGTGQVGCALATHLAGMGNPVRAVSRHRPPALAGVDWRAADAADP |
| Ga0210395_102790741 | 3300020582 | Soil | MGEDRLHVVFGTGQVGSALAAHLAGLGIAVRAVSRHRPP |
| Ga0210401_107239361 | 3300020583 | Soil | MDDDQLHIVFGTGQVGSALAAHLAGMGIAVRAVSRHRPAALAGVDWRAADA |
| Ga0179596_102595581 | 3300021086 | Vadose Zone Soil | MSVSGLHVVFGTGQVGAALAARLSESDISVRVVSRHRPPALAEGIDWW |
| Ga0210396_108850161 | 3300021180 | Soil | MSDDRLHIVFGTGQVGSTLAAYLAELGIAVRAVSRHRPPRLAGVDWR |
| Ga0210396_113113332 | 3300021180 | Soil | VTEDRLHVVFGTGQVGNALAAHLAGLGLAVRAVSRHRPPGLT |
| Ga0210389_114138251 | 3300021404 | Soil | MDDDQLHIVFGTGQVGSALAAHLAGLGMAVRSVSRHRPPVLAGVDWRAADAADPEAAADA |
| Ga0210386_104957013 | 3300021406 | Soil | MGEDRLHVVFGTGQVGSALGAHLAGLGIAVRAVSRHRPPALAGVDWRAADAA |
| Ga0210383_101764831 | 3300021407 | Soil | MDDDQLHIVFGTGQVGSALAAHLAGMGIAVRAVSRHRPAALAGGD |
| Ga0210394_110036222 | 3300021420 | Soil | MGADRLEVVFGTGQVGSALAAHLAGLGIAVRAVSRH |
| Ga0210391_110318541 | 3300021433 | Soil | MSQNIEDRLHVVFGTGQVGNALAAHLAGLGIAVRAVSRHRPASLAGVDW |
| Ga0210390_101992171 | 3300021474 | Soil | MGEDRLHVVFGTGQVGSALAAHLAGLGIAVRAVSRHRP |
| Ga0210398_105981201 | 3300021477 | Soil | MGEDRLHVVFGTGQVGGALAAHLAGLGVAVRAVSRHRP |
| Ga0210410_101661031 | 3300021479 | Soil | MAEDRLHVVFGTGQVGNALAAHLASLGLAVRAVSRHRPA |
| Ga0210410_114121811 | 3300021479 | Soil | MDDDQLHIVFGTGQVGGALAAHLAGMGIPVRAVSRHRPPVLA |
| Ga0212123_100855101 | 3300022557 | Iron-Sulfur Acid Spring | MGEAQLHVVFGTGQVGSALVAHLAGLGMAVRAVSRHRPAMLPGGADWRA |
| Ga0247553_1100711 | 3300023672 | Soil | MDDDPLHIVFGTGQVGSALAAHLAGLGIAVRSVSRHRPPVLAGVDWR |
| Ga0208219_10256261 | 3300025625 | Arctic Peat Soil | MGDDRLHVVFGTGQVGRVLAAYLAGQGLAVRAVSRHRPPGLADGIDWRAA |
| Ga0208220_10889643 | 3300025627 | Arctic Peat Soil | MGDDRLHVVFGTGQVGRVLAAYLAGQGLAVRAVSRHRPPGLADGIDWRAADAT |
| Ga0209014_102405721 | 3300025857 | Arctic Peat Soil | MSNNSFHLVFGTGQVGMTLAAQLAGSGIPVRAVSRHCPARLAQGVEWRAADVTDP |
| Ga0207692_100554871 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEARLHVVFGTGQVGGALAAHLAGLGVAVRAVSRHRPPVLAGGTDWRA |
| Ga0207693_102844784 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEARLHVVFGTGQVGSALAAHLAGLGVAVRAVSRHRPPVLAGGTDWRA |
| Ga0207702_102238011 | 3300026078 | Corn Rhizosphere | MGEARLHVVFGTGQVGGALAAHLAGLGVAVRAVSRHRPPVLAGGTDWRAA |
| Ga0208240_10327501 | 3300027030 | Forest Soil | MDEAQLHVVFGTGQVGSALAAHLASMGIAVRAVSRHRPAALAGGTDWRAADVT |
| Ga0208099_10150441 | 3300027096 | Forest Soil | VFGTGQVVNPLAAYLAGQGIAVRPVSRHRPPALADVSQGTC |
| Ga0208042_10056096 | 3300027568 | Peatlands Soil | MSDDRLHVVFGTGQVGSALAAHLAGQGIAVRAVSRHQPPALAGVDWRA |
| Ga0209007_10304821 | 3300027652 | Forest Soil | LLQLRERNVMDRLHVVFGTGQVGTALAAHLAGMGNAVRAVSRHRPPALAGVDWR |
| Ga0209038_100952321 | 3300027737 | Bog Forest Soil | MDDDRLHIVFGTGQVGSALAAHLAGLGIAVRAVSRHRPPALAGVDWRAA |
| Ga0209656_101334231 | 3300027812 | Bog Forest Soil | MAMDNDQPHVVFGTGQVGQALIAHLTTRGMAVRAVSRHRPPALAGVDWRPADVTDP |
| Ga0209773_100782334 | 3300027829 | Bog Forest Soil | MDDDRLHIVFGTGQVGSALAAHLAGLGIAVRAVSRHRPPAL |
| Ga0209517_104618781 | 3300027854 | Peatlands Soil | MGEEQLHVVFGTGQVGSALAAHLTGMGLAVRTVSRDRPRALADGADWR |
| Ga0209380_107292052 | 3300027889 | Soil | MSEDRLHVVFGTGQVGSALVAHLAGLGVAVRAVSRNRPPALAADA |
| Ga0209067_100602271 | 3300027898 | Watersheds | MVEDRRHVVFGTGQVGRELATRLVGLGLNVRAVSRHRPAGLADGVDW |
| Ga0307307_101131482 | 3300028718 | Soil | MGEDRLHVVFGTGQVGSALAAHLAGSGLAVRTVSRHRPATRPGIDWRAADV |
| Ga0302231_102880981 | 3300028775 | Palsa | MSEGGLHVVFGTGQVGLALADRLAGLGAEVRAVSRRRPAAL |
| Ga0307308_100627711 | 3300028884 | Soil | MGEDRLQVVFGTGQVGSALAAHLAGSGLAVRTVSRHRPATRPGIDWRAADV |
| Ga0308309_102310844 | 3300028906 | Soil | MSQNIEDRLHVVFGTGQVGKALAAHLAGLGIAVRAVSRHQPAALAGV |
| Ga0308309_104770564 | 3300028906 | Soil | MSEDRLHVVFGTGQVGSALVAHLAGLGVAVRAVSRNRPPALAADAEW |
| Ga0311368_110859372 | 3300029882 | Palsa | MGEDRLHVVFGTGQVGNALAAHLAGLGITVRAVSRHRPPALAGVDWR |
| Ga0310038_101702422 | 3300030707 | Peatlands Soil | VVGDDRLHVVFGAGQVGVALTARLAELGLAVRTVSRHRPATLAV |
| Ga0265763_10270731 | 3300030763 | Soil | MAEDRLHVVFGTGQVGNALAAHLAGMGNAVRAVSRHRPPALAA |
| Ga0265737_1066531 | 3300030941 | Soil | MSEIRHVVFGAGRVGSALAAHLTGLAIPVRVVSRHRPPTVAGGDWRAADASDPEAAADAA |
| Ga0302308_104490142 | 3300031027 | Palsa | VSEDRVHVVFGAGHIGCALCAHLVDLGLAVRAVSRHRPPALADEVDWRA |
| Ga0302325_133943551 | 3300031234 | Palsa | MGEDRLHVVFGTGQVGNALAAHLAGLGNAVRAVSRHRPPAV |
| Ga0265320_105193971 | 3300031240 | Rhizosphere | MSENGVHVVFGTGQVGTSLAAQLAGAGVAVRAVSRHRPDTL |
| Ga0272422_11545671 | 3300031452 | Rock | MTEGPLHVVFGTGQVGLALAARLARLDVDVRAVSRRRAATLAAGV |
| Ga0170819_152346271 | 3300031469 | Forest Soil | MGEDRLHVVFGTGQVGSALAAHLAGLGLAVRTVSRHQPATRPGIDWRAADVS |
| Ga0310686_1079579332 | 3300031708 | Soil | MGEDRLHVVFGTGQVGSALAAHLAGLGIAVRAVSRHQPPALAGVDWRT |
| Ga0310686_1175511572 | 3300031708 | Soil | MGDDQLHIVFGTGQVGSALAAHLAGLGITVRAVSRHRPPALAGVDWRAADAADPEAAADA |
| Ga0307474_101137301 | 3300031718 | Hardwood Forest Soil | MDDDQLHIGFGTGQVGSALAAHLAGLGIAVRSVSRHRPPVLAGADWRAADA |
| Ga0307478_113720711 | 3300031823 | Hardwood Forest Soil | MGEDRLHVVFGTGQVGHALATVLAGQGLTVRVVSRHRPAELAEGIDWRAAD |
| Ga0311367_102437061 | 3300031918 | Fen | MSDSERHVVFGTGQVGSALVAALASEGRAVRAVSRHRPAAMASDID |
| Ga0311301_100344261 | 3300032160 | Peatlands Soil | MGEDQLHVVFGTGQVGSALAAHLAGLGIAVRAVSRHRPPALA |
| Ga0311301_105534881 | 3300032160 | Peatlands Soil | MGEDRLHVIFGTGQVGNALAAHLAGLGIAVRAVSRHRPPPLAG |
| Ga0311301_112980711 | 3300032160 | Peatlands Soil | MDEGQLHVVFGTGQVGNALAAHLASLGMAVRTVSRHRPPA |
| Ga0335078_122515892 | 3300032805 | Soil | MGEDRLHVVFGTGQVGSALTAYLARQGFAVRAVSRNRPPALAGGCDWRAA |
| Ga0335074_102089682 | 3300032895 | Soil | MGEERLHVVFGTGQVGSALIAHLASLDVAVRAVSRDRPRTPAPGSPRWS |
| ⦗Top⦘ |