| Basic Information | |
|---|---|
| Family ID | F069190 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 124 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELREALAECE |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 124 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.52 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.35 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.323 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.774 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.613 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.43% β-sheet: 0.00% Coil/Unstructured: 78.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 124 Family Scaffolds |
|---|---|---|
| PF00092 | VWA | 26.61 |
| PF13519 | VWA_2 | 23.39 |
| PF00849 | PseudoU_synth_2 | 2.42 |
| PF01790 | LGT | 0.81 |
| PF05164 | ZapA | 0.81 |
| PF06649 | DUF1161 | 0.81 |
| PF00080 | Sod_Cu | 0.81 |
| COG ID | Name | Functional Category | % Frequency in 124 Family Scaffolds |
|---|---|---|---|
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 2.42 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 2.42 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.81 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.81 |
| COG3027 | Cell division protein ZapA, inhibits GTPase activity of FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.81 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001471|JGI12712J15308_10020251 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100640087 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300004152|Ga0062386_101785997 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300004157|Ga0062590_102441522 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300004635|Ga0062388_100695494 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300005162|Ga0066814_10103186 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005434|Ga0070709_10626029 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005439|Ga0070711_100962524 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005541|Ga0070733_10387710 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300005602|Ga0070762_10450188 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005764|Ga0066903_101105033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1462 | Open in IMG/M |
| 3300005764|Ga0066903_107777846 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005921|Ga0070766_10156656 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300005921|Ga0070766_11266337 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006028|Ga0070717_10411860 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300006050|Ga0075028_100692898 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300006174|Ga0075014_100471624 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300006176|Ga0070765_101928979 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300006176|Ga0070765_102042191 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006358|Ga0068871_101775633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300009089|Ga0099828_10755567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300009525|Ga0116220_10202456 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300009628|Ga0116125_1200750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300010343|Ga0074044_11072148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300010379|Ga0136449_103125987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300011120|Ga0150983_10811115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300011269|Ga0137392_11332285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300012189|Ga0137388_11926862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300012203|Ga0137399_10848311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
| 3300012205|Ga0137362_11243883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300012356|Ga0137371_11312928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300012685|Ga0137397_10801723 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300012944|Ga0137410_11527045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300012944|Ga0137410_11906110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300012957|Ga0164303_11143619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300013297|Ga0157378_11811534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300014657|Ga0181522_10498836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300015193|Ga0167668_1086316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300015374|Ga0132255_101904814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300017933|Ga0187801_10156208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300017934|Ga0187803_10192952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300017937|Ga0187809_10344612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300017943|Ga0187819_10581979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300017972|Ga0187781_10844999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300017973|Ga0187780_11101048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300018022|Ga0187864_10108061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1435 | Open in IMG/M |
| 3300018058|Ga0187766_11308866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300018062|Ga0187784_11391733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300018085|Ga0187772_10787138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 686 | Open in IMG/M |
| 3300018086|Ga0187769_10680523 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300018086|Ga0187769_10746957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300019258|Ga0181504_1550000 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300019278|Ga0187800_1668059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300019278|Ga0187800_1869709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300019284|Ga0187797_1196274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3684 | Open in IMG/M |
| 3300019786|Ga0182025_1121430 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300020581|Ga0210399_11111454 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300020581|Ga0210399_11275279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300020583|Ga0210401_10220433 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300020583|Ga0210401_10497788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1081 | Open in IMG/M |
| 3300021168|Ga0210406_10677790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300021170|Ga0210400_10168444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1770 | Open in IMG/M |
| 3300021178|Ga0210408_10871183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300021180|Ga0210396_11242730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300021180|Ga0210396_11639346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300021404|Ga0210389_10586280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300021406|Ga0210386_10407100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1173 | Open in IMG/M |
| 3300021407|Ga0210383_10948468 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300021474|Ga0210390_10455609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300021475|Ga0210392_11144017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300021476|Ga0187846_10313217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300021478|Ga0210402_10084689 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
| 3300022721|Ga0242666_1019162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
| 3300025439|Ga0208323_1023977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1280 | Open in IMG/M |
| 3300025453|Ga0208455_1060147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300025915|Ga0207693_11240745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300025929|Ga0207664_10969887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300026529|Ga0209806_1179361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300027432|Ga0209421_1059348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300027591|Ga0209733_1141888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300027625|Ga0208044_1131846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300027729|Ga0209248_10243744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300027826|Ga0209060_10415432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300027829|Ga0209773_10194993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 846 | Open in IMG/M |
| 3300027842|Ga0209580_10150950 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300027903|Ga0209488_11196824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300027908|Ga0209006_11224586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300028380|Ga0268265_11713139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
| 3300028773|Ga0302234_10228888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300028795|Ga0302227_10260687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300029918|Ga0302143_1043978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300030007|Ga0311338_11530322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300030580|Ga0311355_10726392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300030706|Ga0310039_10339111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300030707|Ga0310038_10062547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2052 | Open in IMG/M |
| 3300030813|Ga0265750_1074065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300030916|Ga0075386_11153929 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300030943|Ga0311366_10410132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1178 | Open in IMG/M |
| 3300031090|Ga0265760_10040957 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
| 3300031128|Ga0170823_10854775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1939 | Open in IMG/M |
| 3300031474|Ga0170818_114940965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300031573|Ga0310915_11230348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300031682|Ga0318560_10257629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300031715|Ga0307476_10874167 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 664 | Open in IMG/M |
| 3300031718|Ga0307474_10403106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300031820|Ga0307473_11364280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300031823|Ga0307478_10136603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1936 | Open in IMG/M |
| 3300031823|Ga0307478_11052882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031890|Ga0306925_10803788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300031954|Ga0306926_12043542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300031962|Ga0307479_10590440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
| 3300032180|Ga0307471_100613983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300032261|Ga0306920_104227122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300032782|Ga0335082_10323894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1411 | Open in IMG/M |
| 3300032783|Ga0335079_10060916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4303 | Open in IMG/M |
| 3300032892|Ga0335081_11805727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300032895|Ga0335074_10212485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2337 | Open in IMG/M |
| 3300032954|Ga0335083_10130089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2415 | Open in IMG/M |
| 3300033158|Ga0335077_10769650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300033545|Ga0316214_1014515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300033808|Ga0314867_001642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5030 | Open in IMG/M |
| 3300033829|Ga0334854_021501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1560 | Open in IMG/M |
| 3300034124|Ga0370483_0345569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300034195|Ga0370501_0372655 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.32% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.06% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.65% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.84% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.84% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.03% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.23% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 3.23% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.23% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.23% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.61% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.61% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.81% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.81% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.81% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.81% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.81% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.81% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.81% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.81% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.81% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12712J15308_100202513 | 3300001471 | Forest Soil | MPGYSGTPLPKKLGIKDGFRVRLVNMAPDVKKELKSELAKCEILSNDA |
| JGIcombinedJ26739_1006400872 | 3300002245 | Forest Soil | MPGYSGTPLPKKLGIKDGFRVRFLDAPVEVRKELDAAVAGCEIAGDGKK |
| Ga0062386_1017859971 | 3300004152 | Bog Forest Soil | MPGYSGTPLPKKLGIKAGFRVRLANTPAEVRAELREALAECQMKPGN |
| Ga0062590_1024415222 | 3300004157 | Soil | MPGYSGTPLFKKLGIKGGIRVALLDLPAEVRAELNPALSTCQIDRYGKKPVDFILY |
| Ga0062388_1006954942 | 3300004635 | Bog Forest Soil | MPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELREALAECE |
| Ga0066814_101031862 | 3300005162 | Soil | MPGYSGTPLPKKLGIKDGFHVRLIEAPSEVVTELKPYLEKCGDTPN |
| Ga0070709_106260292 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGYSGTPLPKKLGIKDGFHFSLIDAPSDVIAELKPSLQQCTAANDGKTPL |
| Ga0070711_1009625242 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGYSGTPLPKKLGIKDGLCFALINAPSDVIKELKPSLQKCTAADNGK |
| Ga0070733_103877102 | 3300005541 | Surface Soil | MPGYSGTPLPKKLGIKDGLRVHLAEAPADVRAELKAALSGCEIARDA |
| Ga0070762_104501881 | 3300005602 | Soil | MPGYSGTPLPKKLGIKSGFRTFFVNAPAEVLAELSASLKECE |
| Ga0066903_1011050333 | 3300005764 | Tropical Forest Soil | MAGYSGTPLPKKLGVKDGKRVLLRNVPASVRAELAEALSACQSL |
| Ga0066903_1077778462 | 3300005764 | Tropical Forest Soil | MPGYSGTPLPKKLGIKDGFRTCLVAVPEDVRRELKVALTCCELVKDRKAPLDF |
| Ga0070766_101566562 | 3300005921 | Soil | MPGYSGTPLPKKLGIKAGFRARLTNAPEEVRAELHPELAECDMVKR |
| Ga0070766_112663371 | 3300005921 | Soil | MPGYSGTPLPKKLGIKAGFRVRLANAPVEVRAELRESLAECTV |
| Ga0070717_104118601 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGYSGTPLPKKLGIKDGFRVTLVDAPSDVIAELKLSLSKCELVRD |
| Ga0075028_1006928981 | 3300006050 | Watersheds | MPGYSGTPLPKKLGLKPGLRVHLLDTPPEVRAELKAALDD |
| Ga0075014_1004716242 | 3300006174 | Watersheds | MPGYSATPLPKKLGIKDGFQVRLIKAPREVVAELKPSLDSCKVSRDA |
| Ga0070765_1019289792 | 3300006176 | Soil | MPGYSGTPLPKKLGIKAGFHVQLANVPPEVCTELKTALA |
| Ga0070765_1020421911 | 3300006176 | Soil | MPGYSGTPLPKKLGIKNGFRVQLTNAPAEVRAELQQALADCTAVKRGDSLDFAMLF |
| Ga0068871_1017756331 | 3300006358 | Miscanthus Rhizosphere | MAGYSGTPLPKKLGIKDGFHVALVEMPTEVRAELKDTLAACKVVPGGSLDFAILFVK |
| Ga0099828_107555671 | 3300009089 | Vadose Zone Soil | MPGYSGTPLPKKLGIKAGFRVYLAKAPAEVRAELRAALEECTEVKQADVLD |
| Ga0116220_102024562 | 3300009525 | Peatlands Soil | MPGYSGTPLPKKLGIKDGFRVQFVQAPSEVLGELKAALTACAAVRDGRT |
| Ga0116125_12007502 | 3300009628 | Peatland | MPGYSGTPLPKKLGIRDGFRVRLVEMPPEVTKELKETLDRCQFASDSKLPL |
| Ga0074044_110721482 | 3300010343 | Bog Forest Soil | MPGYSGTPLPKKLGIKAGFRARLANAPSEVRVELREALADCE |
| Ga0136449_1031259871 | 3300010379 | Peatlands Soil | MPGYSGTPLVKKLGIKNGFRVALLYVPADVTAELRG |
| Ga0150983_108111152 | 3300011120 | Forest Soil | MPGYSGTPLPKKLGIKAGFRARLANAPAEVRAELCEA |
| Ga0137392_113322851 | 3300011269 | Vadose Zone Soil | MPGYSGTPLPKKLGIKNGFHICLVKAPAEVRGELREAMS |
| Ga0137388_119268622 | 3300012189 | Vadose Zone Soil | MPGYSGTPLPKKVGIKAGFSVYLSNAPAEVRETLEECT |
| Ga0137399_108483111 | 3300012203 | Vadose Zone Soil | MPGYSGTPLPKKLGIKAGFRVYMANAPAEVRAELREPLAECAVVKDGPALDFA |
| Ga0137362_112438832 | 3300012205 | Vadose Zone Soil | MPGYSGTPLPKKLGIKPEFRVRLANAPPEVHAELRAALAECVVVK |
| Ga0137371_113129281 | 3300012356 | Vadose Zone Soil | MPGYSGTPLPKKLGIKEGFRVCLVDAPADVRAELKAELAKCEVPRRGPI |
| Ga0137397_108017231 | 3300012685 | Vadose Zone Soil | MPGYSGTPLPKKLGIKEGYRVALLSMPGDVRSELRAALAECHIVKDLGGP |
| Ga0137410_115270452 | 3300012944 | Vadose Zone Soil | MPGYSGTPLPKKLGIKQGFRVCLVKNPSEVRTELSEALASCNLAHDSRS |
| Ga0137410_119061102 | 3300012944 | Vadose Zone Soil | MPGYSGTPLPKKLGIKAGYRVGLIGMPAEVRTELRD |
| Ga0164303_111436192 | 3300012957 | Soil | MPGYSGTPLFKKLGIKDGIRVSFLGMPTDVRAELNPALSTCEI |
| Ga0157378_118115341 | 3300013297 | Miscanthus Rhizosphere | MPGYSGTPLPKKLGIKAGFRVMLKDVPPDVRSELRELATCEIVSDGKTLV |
| Ga0181522_104988362 | 3300014657 | Bog | MPGYSRTPLPKKLGIKPGFRIALTDPPPEVTAELR |
| Ga0167668_10863162 | 3300015193 | Glacier Forefield Soil | MPGYSGTPLPKKLGIKAGFRVRLANAPAEVRLELRAALSDCTVVKQ |
| Ga0132255_1019048141 | 3300015374 | Arabidopsis Rhizosphere | MAGYSGTPLPKKLGIKDNFRIFLDGAPADVLAELKTSLSQCDVLKS |
| Ga0187801_101562082 | 3300017933 | Freshwater Sediment | MPGYSGTPLPKKLGIKDGFRVCLVDSPREVVEELKPSLDKCEIARDS |
| Ga0187803_101929522 | 3300017934 | Freshwater Sediment | MPGYSGTPLPKKLGIKDGFRVRFVGAPSEVLAELEV |
| Ga0187809_103446122 | 3300017937 | Freshwater Sediment | MPGYSGTPLPKKLGIKNGFRISLLGAPAEVCSELKSSLAECRV |
| Ga0187819_105819792 | 3300017943 | Freshwater Sediment | MPGYSGRPLPKKLGIKDGFRVCFVAAPDEVLSELKE |
| Ga0187781_108449992 | 3300017972 | Tropical Peatland | MPGYSGTPLPRKLGIKGGFRVQFVAAPAEVLAELRSALTGCQLV |
| Ga0187780_111010482 | 3300017973 | Tropical Peatland | MPGYSGTPLPKKLGIKDGFRLHFVAPPAEVLAELKTAL |
| Ga0187864_101080612 | 3300018022 | Peatland | MPGYSGTPLPKKLGIKDGFRVQFVQAPSEVLGELKAALA |
| Ga0187766_113088661 | 3300018058 | Tropical Peatland | MPGYSGTPLPKKLGIKDGFRVEFVAAPREVLAELKSALSGCALVRGGK |
| Ga0187784_113917332 | 3300018062 | Tropical Peatland | MPGYSGTPLPKKLGIKDGFRVCLVKAPSDVLAELKSPL |
| Ga0187772_107871382 | 3300018085 | Tropical Peatland | MPGYSGTPLPKKLGIKAGFRVHLSNSPAEVRAELRKALAECELVKQRAALDFA |
| Ga0187769_106805233 | 3300018086 | Tropical Peatland | MPGYSGTPLPKKLGIKDGVRVHFADAPSEVLAELKPAL |
| Ga0187769_107469571 | 3300018086 | Tropical Peatland | MVGYSDTPLPKKLGIKSGFRVHFVAAPSEVIAELKPALAGCDLVHDQKSQLDFAH |
| Ga0181504_15500001 | 3300019258 | Peatland | MPGYSGTPLPKKLGLKDGFRLLLLHAPEDVKTELSSAIG |
| Ga0187800_16680592 | 3300019278 | Peatland | MPGYSGTPLPKKLGIKDGFRARFIAAPAEVLTELKDALTSCQLVR |
| Ga0187800_18697091 | 3300019278 | Peatland | MPGYSATPLPKKLGIKDGFRVCLVNAPSDVLAELKSPLAACKVVRGGK |
| Ga0187797_11962745 | 3300019284 | Peatland | MPGYSGTPLPKKLGIKDGFRVCLVKAPSDVLAELKSPLTACEVVRDGKG |
| Ga0182025_11214302 | 3300019786 | Permafrost | MPGYSGTPLAKKLGIKAGFRVQLANAPAEVRAELSEALAECSILDRG |
| Ga0210399_111114542 | 3300020581 | Soil | MSGYSGTPLPKKLGIKDGFQVRLIEAPSEVVEELKKTLAKCKL |
| Ga0210399_112752792 | 3300020581 | Soil | MPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELHQALEECAVAKAG |
| Ga0210401_102204331 | 3300020583 | Soil | MPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELHQALEECAVAKA |
| Ga0210401_104977882 | 3300020583 | Soil | MPGYSGTPLPKKLGIKAGFRAQLANAPAEVRAELREALAEC |
| Ga0210406_106777901 | 3300021168 | Soil | MPGYSGTPLPKKLGIEAGLRAHLANAPAEVRQELFSELAECSLVKHDLDFAMLFTKS |
| Ga0210400_101684441 | 3300021170 | Soil | MPGYSGTPLPKKLGIKAGFRVCLASMPAEVRAELRDALAECTVTKNAGAVDF |
| Ga0210408_108711832 | 3300021178 | Soil | LPGYSGTPLPKKLGIKSGFRVQLVDAPPEVRSELKVELA |
| Ga0210396_112427302 | 3300021180 | Soil | MPGYSGTPLPKKLGIKSGFRVRLANAPAEVRAELRDALAECEMK |
| Ga0210396_116393461 | 3300021180 | Soil | MPGYSGTPLPKKLGIKAGFRARLTNAPEEVRAELHPELAECDMV |
| Ga0210389_105862801 | 3300021404 | Soil | MPGYSGTPLPKKLGIKDGFRVSVVEMPREVTAELKV |
| Ga0210386_104071001 | 3300021406 | Soil | MPTKQSTSGYSGTPLPKKLGIKAGFRVHLFNAPADVRSELRAPL |
| Ga0210383_109484682 | 3300021407 | Soil | MPGYSGTPLPKKLGIKAGFRVLLANAPAEVRAALREALAQCHLVKQ |
| Ga0210390_104556091 | 3300021474 | Soil | MPGYSGTPLPKKLGIKAGFRARLTNAPEEVRAELHPELAECDMVK |
| Ga0210392_111440171 | 3300021475 | Soil | MLGYSGTPLPKKLGIKPGFRARLMETPAEVCAELRSDLAG |
| Ga0187846_103132171 | 3300021476 | Biofilm | MPGYSGTPLPKKLGIKPGFRVSLPRAMPADVRAELKEALQGCTIDRGGK |
| Ga0210402_100846894 | 3300021478 | Soil | MPGYSGTPLPKKLEIKDGFGVCLLNAPSEVKPELKVPLAACTIVH |
| Ga0242666_10191622 | 3300022721 | Soil | MPGYSGTPLPKKLGIKAGFRVHLANAPAEVRAELREALAECEMKTKPGAILDFA |
| Ga0208323_10239771 | 3300025439 | Peatland | MPGYSGTPLPKKLGIKPGFRVQFWNAPAEVLAELSEALAECKILKQ |
| Ga0208455_10601472 | 3300025453 | Peatland | MPGYSGTPLPKKLGIKPGFRVQFWNAPAEVLAELSEALAGCKILKQGDALD |
| Ga0207693_112407451 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPGYSGTPLPKKLGIKDSLRVLLVDAPADVLAELKLALSKCKTAP |
| Ga0207664_109698872 | 3300025929 | Agricultural Soil | MPGYSGTPLFKKLGIKEGIRVSFLGMPTDVRAELK |
| Ga0209806_11793611 | 3300026529 | Soil | MAGYSGTPLPKKLGIKDGFRFSLIEAPNEVRKQLK |
| Ga0209421_10593481 | 3300027432 | Forest Soil | MPGYSGTPLPKKLGIKDDFRVALLHMPENVKSELQ |
| Ga0209733_11418881 | 3300027591 | Forest Soil | MPGYSGTALPKKLGIKAGFRVLLANAPAEVRAELRADLAGCAVVKDG |
| Ga0208044_11318461 | 3300027625 | Peatlands Soil | MVGYSGTPLPKKLGIKQGFRVLLLDSPAEVRAELKDALAGCVLAKDR |
| Ga0209248_102437441 | 3300027729 | Bog Forest Soil | MPGYSGTPLPKKLGIKAGFRARLANAPSEVRVELREALADCETKTKPGDML |
| Ga0209060_104154322 | 3300027826 | Surface Soil | MPGYSGTPLPKKLGIKDGFVVCLVGAPSEVLTELKTELSRCKVAQTGEMPL |
| Ga0209773_101949932 | 3300027829 | Bog Forest Soil | MPGYSGTPLPRKLGIKAGFRACLVNAPAEVRAELRAALAECETKTKPGDML |
| Ga0209580_101509503 | 3300027842 | Surface Soil | SGTPLFKKLGIKDGIRVSLLHIPTDVQAELKPTARSL |
| Ga0209488_111968242 | 3300027903 | Vadose Zone Soil | MPGYSGTPLPKKLGIKAGFRVYMASAPAEVRAELREALAE |
| Ga0209006_112245861 | 3300027908 | Forest Soil | MPGYSGTPLPKKLGIKSGFRVRLANAPAEVRAELRDALAECE |
| Ga0268265_117131392 | 3300028380 | Switchgrass Rhizosphere | MPVGYSGTPLPKKLGITESAHVALIGAPSEYESLL |
| Ga0302234_102288882 | 3300028773 | Palsa | MPGYSVTPLPKKLGIKAGFRVWLAKAPAEVRAELREALAECTVAKQEESLDF |
| Ga0302227_102606872 | 3300028795 | Palsa | MPGYSGTPLPKKLGIKDGFRVRFLNLPTDVCAELRSALSGCE |
| Ga0302143_10439782 | 3300029918 | Bog | MPGYSGTPLPKKLGIKAGFRARLANAPKDVLAELRDA |
| Ga0311338_115303221 | 3300030007 | Palsa | MPGYSGTPLPKKLGIKSGFRTFFVDAPAEVLAELYPELSECEQ |
| Ga0311355_107263921 | 3300030580 | Palsa | MPGYSGTPLPKKLGIKSGFRVRLANSPAEVRAELREALAE |
| Ga0310039_103391111 | 3300030706 | Peatlands Soil | MPGYSSTPLPKKLGIKDGFRVLLVEAPADVRAELREA |
| Ga0310038_100625471 | 3300030707 | Peatlands Soil | MPGYSGTPLPKKLGIKTGFRVRLVDAPREVCEELSTEL |
| Ga0265750_10740651 | 3300030813 | Soil | MPGYSGTPLPKKLGIKAGARAQFAHAPADVLAELSDALAECKVLRQGERLDF |
| Ga0075386_111539291 | 3300030916 | Soil | MPGYSGTPLPKKLGIKAGFRVRLVDAPSEVRAELSSD |
| Ga0311366_104101321 | 3300030943 | Fen | MAGYSGTPLPKKLGIKDQFRVDLFAMPAEVRAELQDALSTCRTVK |
| Ga0265760_100409571 | 3300031090 | Soil | MPGYSGTPLPKKLGIKAGFRAQLANAPAEVRAELSPALSECGIVKPGDA |
| Ga0170823_108547753 | 3300031128 | Forest Soil | MQGYSGTPLPKKLGIKDGFQVCLIEAPREVITELKPSLDSCKVA |
| Ga0170818_1149409651 | 3300031474 | Forest Soil | MPGYSGAPLPKKLGIKPGFRVRLANAPPEVRAELRDA |
| Ga0310915_112303482 | 3300031573 | Soil | MPGYSGTPLPKKLGIKDGFCVSLIDAPAEVIAELKPSLENCKIAKEGKTPLD |
| Ga0318560_102576292 | 3300031682 | Soil | MPGYSGTSLPKKLGVKEGFRVALIELPPEVKAELRAALSKCTMA |
| Ga0307476_108741672 | 3300031715 | Hardwood Forest Soil | MPGYSGTPLPKKLGIKDGFRVSVVEMPREVTAELKVTLDRCEFPRDNK |
| Ga0307474_104031062 | 3300031718 | Hardwood Forest Soil | MPGYSGTPLPKKLGIKSGFRVRLANAPAEVRAELRDALAEC |
| Ga0307473_113642802 | 3300031820 | Hardwood Forest Soil | MPGYSGTPLPKKLGIKEGFRVCLVDAPADVRAELQAELAKCEVSRRGPIDF |
| Ga0307478_101366031 | 3300031823 | Hardwood Forest Soil | MPGYSGTPLPKKLGIKNGFQVCLINAPPEVQSKLKSAL |
| Ga0307478_110528822 | 3300031823 | Hardwood Forest Soil | MPGYSGTPLPKKLGIKNGFRVQLTNAPAEVRAELQQALADCTAVKRGDS |
| Ga0306925_108037881 | 3300031890 | Soil | MPGYSGTPLPKKLGIKDGFHISLIDAPSEVLAELKAAVEECETAKDGQTQLDFA |
| Ga0306926_120435421 | 3300031954 | Soil | MPGYSGTPLPKKLGIKDGFCVSLIDAPAEVIAELKPSLENCKIAKEGKTPLDF |
| Ga0307479_105904401 | 3300031962 | Hardwood Forest Soil | MPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELREALAECEMKRGDM |
| Ga0307471_1006139831 | 3300032180 | Hardwood Forest Soil | MPGYSGTPLPKKLGIKDGFHVRLIEAPSEVVAELKPSLEK |
| Ga0306920_1042271221 | 3300032261 | Soil | MPGYSGTPLPKKLGIKDGFHISLIDAPSEVLAELKAAVEECETAKDGQTQLDF |
| Ga0335082_103238941 | 3300032782 | Soil | MPGYSGTPLPKKLGIKDAFQICLIDAPPEVVAELKVTLDKCSKVN |
| Ga0335079_100609165 | 3300032783 | Soil | MPGYSGTPLPKKLGIKEGFSVRLTHVPSEVIAELRAALEKCHEGKTPLDFAM |
| Ga0335081_118057271 | 3300032892 | Soil | MPGYSGTPLPKKLGIKDGLRAYCVAMPADVRAELKAPLA |
| Ga0335074_102124853 | 3300032895 | Soil | MSGYSGTPLPKKLGIKDGACVRIFEMPGDVRAELKQSLAHCEILTDGKR |
| Ga0335083_101300893 | 3300032954 | Soil | MPGYSGTPLPKKLGIKENLRAQLVNAPDEGRKELKAELAACD |
| Ga0335077_107696501 | 3300033158 | Soil | MPGYSGTPLPKKLGIKDGFHFTLIDAPTDVIAELKPSLQKCTAARDGKIPIDFAI |
| Ga0316214_10145151 | 3300033545 | Roots | MPGYSGTPLPKKLGIKPGFRVHLVSAPAEVQAELREALA |
| Ga0314867_001642_3_122 | 3300033808 | Peatland | MPGYSGTPLPQKLGIKGGFEVRLINAPADVRAELKAALTH |
| Ga0334854_021501_1433_1558 | 3300033829 | Soil | MPGYSGTPLAKKLGIKAGFRVQLANAPAEVRAELSDALAECS |
| Ga0370483_0345569_353_514 | 3300034124 | Untreated Peat Soil | MPGYSGTPLPKKLGIKAGFRARLANAPKDVLAELRDALAECDLVKKYDALDFVM |
| Ga0370501_0372655_406_519 | 3300034195 | Untreated Peat Soil | MPGYSGTPLPKKLGIKAGFRVQLVEAPRDVRTELAIPL |
| ⦗Top⦘ |