NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069190

Metagenome / Metatranscriptome Family F069190

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069190
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 44 residues
Representative Sequence MPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELREALAECE
Number of Associated Samples 114
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 64.52 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 94.35 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.323 % of family members)
Environment Ontology (ENVO) Unclassified
(21.774 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.613 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 21.43%    β-sheet: 0.00%    Coil/Unstructured: 78.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF00092VWA 26.61
PF13519VWA_2 23.39
PF00849PseudoU_synth_2 2.42
PF01790LGT 0.81
PF05164ZapA 0.81
PF06649DUF1161 0.81
PF00080Sod_Cu 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0564Pseudouridine synthase RluA, 23S rRNA- or tRNA-specificTranslation, ribosomal structure and biogenesis [J] 2.42
COG1187Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605Translation, ribosomal structure and biogenesis [J] 2.42
COG0682Prolipoprotein diacylglyceryltransferaseCell wall/membrane/envelope biogenesis [M] 0.81
COG2032Cu/Zn superoxide dismutaseInorganic ion transport and metabolism [P] 0.81
COG3027Cell division protein ZapA, inhibits GTPase activity of FtsZCell cycle control, cell division, chromosome partitioning [D] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001471|JGI12712J15308_10020251All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300002245|JGIcombinedJ26739_100640087All Organisms → cellular organisms → Bacteria941Open in IMG/M
3300004152|Ga0062386_101785997All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300004157|Ga0062590_102441522All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300004635|Ga0062388_100695494All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300005162|Ga0066814_10103186All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005434|Ga0070709_10626029All Organisms → cellular organisms → Bacteria831Open in IMG/M
3300005439|Ga0070711_100962524All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005541|Ga0070733_10387710All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300005602|Ga0070762_10450188All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300005764|Ga0066903_101105033All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1462Open in IMG/M
3300005764|Ga0066903_107777846All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300005921|Ga0070766_10156656All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300005921|Ga0070766_11266337All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006028|Ga0070717_10411860All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300006050|Ga0075028_100692898All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300006174|Ga0075014_100471624All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300006176|Ga0070765_101928979All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300006176|Ga0070765_102042191All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300006358|Ga0068871_101775633All Organisms → cellular organisms → Bacteria → Proteobacteria586Open in IMG/M
3300009089|Ga0099828_10755567All Organisms → cellular organisms → Bacteria → Acidobacteria872Open in IMG/M
3300009525|Ga0116220_10202456All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300009628|Ga0116125_1200750All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300010343|Ga0074044_11072148All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300010379|Ga0136449_103125987All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300011120|Ga0150983_10811115All Organisms → cellular organisms → Bacteria → Acidobacteria597Open in IMG/M
3300011269|Ga0137392_11332285All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300012189|Ga0137388_11926862All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300012203|Ga0137399_10848311All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300012205|Ga0137362_11243883All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300012356|Ga0137371_11312928All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300012685|Ga0137397_10801723All Organisms → cellular organisms → Bacteria → Acidobacteria699Open in IMG/M
3300012944|Ga0137410_11527045All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300012944|Ga0137410_11906110All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300012957|Ga0164303_11143619All Organisms → cellular organisms → Bacteria → Acidobacteria565Open in IMG/M
3300013297|Ga0157378_11811534All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300014657|Ga0181522_10498836All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300015193|Ga0167668_1086316All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300015374|Ga0132255_101904814All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300017933|Ga0187801_10156208All Organisms → cellular organisms → Bacteria → Acidobacteria890Open in IMG/M
3300017934|Ga0187803_10192952All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300017937|Ga0187809_10344612All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300017943|Ga0187819_10581979All Organisms → cellular organisms → Bacteria → Acidobacteria635Open in IMG/M
3300017972|Ga0187781_10844999All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300017973|Ga0187780_11101048All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300018022|Ga0187864_10108061All Organisms → cellular organisms → Bacteria → Acidobacteria1435Open in IMG/M
3300018058|Ga0187766_11308866All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300018062|Ga0187784_11391733All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300018085|Ga0187772_10787138All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300018086|Ga0187769_10680523All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300018086|Ga0187769_10746957All Organisms → cellular organisms → Bacteria → Acidobacteria740Open in IMG/M
3300019258|Ga0181504_1550000All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300019278|Ga0187800_1668059All Organisms → cellular organisms → Bacteria → Acidobacteria892Open in IMG/M
3300019278|Ga0187800_1869709All Organisms → cellular organisms → Bacteria → Acidobacteria1407Open in IMG/M
3300019284|Ga0187797_1196274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3684Open in IMG/M
3300019786|Ga0182025_1121430All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300020581|Ga0210399_11111454All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300020581|Ga0210399_11275279All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300020583|Ga0210401_10220433All Organisms → cellular organisms → Bacteria1755Open in IMG/M
3300020583|Ga0210401_10497788All Organisms → cellular organisms → Bacteria → Acidobacteria1081Open in IMG/M
3300021168|Ga0210406_10677790All Organisms → cellular organisms → Bacteria → Acidobacteria797Open in IMG/M
3300021170|Ga0210400_10168444All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1770Open in IMG/M
3300021178|Ga0210408_10871183All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300021180|Ga0210396_11242730All Organisms → cellular organisms → Bacteria → Acidobacteria622Open in IMG/M
3300021180|Ga0210396_11639346All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300021404|Ga0210389_10586280All Organisms → cellular organisms → Bacteria → Acidobacteria876Open in IMG/M
3300021406|Ga0210386_10407100All Organisms → cellular organisms → Bacteria → Acidobacteria1173Open in IMG/M
3300021407|Ga0210383_10948468All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300021474|Ga0210390_10455609All Organisms → cellular organisms → Bacteria → Acidobacteria1079Open in IMG/M
3300021475|Ga0210392_11144017All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300021476|Ga0187846_10313217All Organisms → cellular organisms → Bacteria → Acidobacteria649Open in IMG/M
3300021478|Ga0210402_10084689All Organisms → cellular organisms → Bacteria2826Open in IMG/M
3300022721|Ga0242666_1019162All Organisms → cellular organisms → Bacteria → Acidobacteria1268Open in IMG/M
3300025439|Ga0208323_1023977All Organisms → cellular organisms → Bacteria → Acidobacteria1280Open in IMG/M
3300025453|Ga0208455_1060147All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300025915|Ga0207693_11240745All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300025929|Ga0207664_10969887All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300026529|Ga0209806_1179361All Organisms → cellular organisms → Bacteria → Acidobacteria771Open in IMG/M
3300027432|Ga0209421_1059348All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300027591|Ga0209733_1141888All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300027625|Ga0208044_1131846All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300027729|Ga0209248_10243744All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300027826|Ga0209060_10415432All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300027829|Ga0209773_10194993All Organisms → cellular organisms → Bacteria → Acidobacteria846Open in IMG/M
3300027842|Ga0209580_10150950All Organisms → cellular organisms → Bacteria1143Open in IMG/M
3300027903|Ga0209488_11196824All Organisms → cellular organisms → Bacteria → Acidobacteria512Open in IMG/M
3300027908|Ga0209006_11224586All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300028380|Ga0268265_11713139All Organisms → cellular organisms → Bacteria → Proteobacteria634Open in IMG/M
3300028773|Ga0302234_10228888All Organisms → cellular organisms → Bacteria → Acidobacteria802Open in IMG/M
3300028795|Ga0302227_10260687All Organisms → cellular organisms → Bacteria → Acidobacteria662Open in IMG/M
3300029918|Ga0302143_1043978All Organisms → cellular organisms → Bacteria → Acidobacteria1026Open in IMG/M
3300030007|Ga0311338_11530322All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300030580|Ga0311355_10726392All Organisms → cellular organisms → Bacteria → Acidobacteria920Open in IMG/M
3300030706|Ga0310039_10339111All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300030707|Ga0310038_10062547All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2052Open in IMG/M
3300030813|Ga0265750_1074065All Organisms → cellular organisms → Bacteria → Acidobacteria556Open in IMG/M
3300030916|Ga0075386_11153929All Organisms → cellular organisms → Bacteria → Acidobacteria519Open in IMG/M
3300030943|Ga0311366_10410132All Organisms → cellular organisms → Bacteria → Acidobacteria1178Open in IMG/M
3300031090|Ga0265760_10040957All Organisms → cellular organisms → Bacteria → Acidobacteria1380Open in IMG/M
3300031128|Ga0170823_10854775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1939Open in IMG/M
3300031474|Ga0170818_114940965All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300031573|Ga0310915_11230348All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300031682|Ga0318560_10257629All Organisms → cellular organisms → Bacteria → Acidobacteria937Open in IMG/M
3300031715|Ga0307476_10874167All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300031718|Ga0307474_10403106All Organisms → cellular organisms → Bacteria → Acidobacteria1064Open in IMG/M
3300031820|Ga0307473_11364280All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300031823|Ga0307478_10136603All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1936Open in IMG/M
3300031823|Ga0307478_11052882All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300031890|Ga0306925_10803788All Organisms → cellular organisms → Bacteria → Acidobacteria976Open in IMG/M
3300031954|Ga0306926_12043542All Organisms → cellular organisms → Bacteria → Acidobacteria643Open in IMG/M
3300031962|Ga0307479_10590440All Organisms → cellular organisms → Bacteria → Acidobacteria1093Open in IMG/M
3300032180|Ga0307471_100613983All Organisms → cellular organisms → Bacteria → Acidobacteria1247Open in IMG/M
3300032261|Ga0306920_104227122All Organisms → cellular organisms → Bacteria → Acidobacteria517Open in IMG/M
3300032782|Ga0335082_10323894All Organisms → cellular organisms → Bacteria → Acidobacteria1411Open in IMG/M
3300032783|Ga0335079_10060916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4303Open in IMG/M
3300032892|Ga0335081_11805727All Organisms → cellular organisms → Bacteria → Acidobacteria661Open in IMG/M
3300032895|Ga0335074_10212485All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2337Open in IMG/M
3300032954|Ga0335083_10130089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2415Open in IMG/M
3300033158|Ga0335077_10769650All Organisms → cellular organisms → Bacteria → Acidobacteria984Open in IMG/M
3300033545|Ga0316214_1014515All Organisms → cellular organisms → Bacteria → Acidobacteria1085Open in IMG/M
3300033808|Ga0314867_001642All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5030Open in IMG/M
3300033829|Ga0334854_021501All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1560Open in IMG/M
3300034124|Ga0370483_0345569All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300034195|Ga0370501_0372655All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.32%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.06%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.65%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.84%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.84%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.03%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.03%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.23%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.23%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland3.23%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.23%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.23%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.42%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.42%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.61%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.61%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.61%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.61%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.81%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.81%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.81%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.81%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.81%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.81%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.81%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.81%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022721Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027591Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028795Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1EnvironmentalOpen in IMG/M
3300029918Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033545Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4Host-AssociatedOpen in IMG/M
3300033808Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12712J15308_1002025133300001471Forest SoilMPGYSGTPLPKKLGIKDGFRVRLVNMAPDVKKELKSELAKCEILSNDA
JGIcombinedJ26739_10064008723300002245Forest SoilMPGYSGTPLPKKLGIKDGFRVRFLDAPVEVRKELDAAVAGCEIAGDGKK
Ga0062386_10178599713300004152Bog Forest SoilMPGYSGTPLPKKLGIKAGFRVRLANTPAEVRAELREALAECQMKPGN
Ga0062590_10244152223300004157SoilMPGYSGTPLFKKLGIKGGIRVALLDLPAEVRAELNPALSTCQIDRYGKKPVDFILY
Ga0062388_10069549423300004635Bog Forest SoilMPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELREALAECE
Ga0066814_1010318623300005162SoilMPGYSGTPLPKKLGIKDGFHVRLIEAPSEVVTELKPYLEKCGDTPN
Ga0070709_1062602923300005434Corn, Switchgrass And Miscanthus RhizosphereMPGYSGTPLPKKLGIKDGFHFSLIDAPSDVIAELKPSLQQCTAANDGKTPL
Ga0070711_10096252423300005439Corn, Switchgrass And Miscanthus RhizosphereMPGYSGTPLPKKLGIKDGLCFALINAPSDVIKELKPSLQKCTAADNGK
Ga0070733_1038771023300005541Surface SoilMPGYSGTPLPKKLGIKDGLRVHLAEAPADVRAELKAALSGCEIARDA
Ga0070762_1045018813300005602SoilMPGYSGTPLPKKLGIKSGFRTFFVNAPAEVLAELSASLKECE
Ga0066903_10110503333300005764Tropical Forest SoilMAGYSGTPLPKKLGVKDGKRVLLRNVPASVRAELAEALSACQSL
Ga0066903_10777784623300005764Tropical Forest SoilMPGYSGTPLPKKLGIKDGFRTCLVAVPEDVRRELKVALTCCELVKDRKAPLDF
Ga0070766_1015665623300005921SoilMPGYSGTPLPKKLGIKAGFRARLTNAPEEVRAELHPELAECDMVKR
Ga0070766_1126633713300005921SoilMPGYSGTPLPKKLGIKAGFRVRLANAPVEVRAELRESLAECTV
Ga0070717_1041186013300006028Corn, Switchgrass And Miscanthus RhizosphereMPGYSGTPLPKKLGIKDGFRVTLVDAPSDVIAELKLSLSKCELVRD
Ga0075028_10069289813300006050WatershedsMPGYSGTPLPKKLGLKPGLRVHLLDTPPEVRAELKAALDD
Ga0075014_10047162423300006174WatershedsMPGYSATPLPKKLGIKDGFQVRLIKAPREVVAELKPSLDSCKVSRDA
Ga0070765_10192897923300006176SoilMPGYSGTPLPKKLGIKAGFHVQLANVPPEVCTELKTALA
Ga0070765_10204219113300006176SoilMPGYSGTPLPKKLGIKNGFRVQLTNAPAEVRAELQQALADCTAVKRGDSLDFAMLF
Ga0068871_10177563313300006358Miscanthus RhizosphereMAGYSGTPLPKKLGIKDGFHVALVEMPTEVRAELKDTLAACKVVPGGSLDFAILFVK
Ga0099828_1075556713300009089Vadose Zone SoilMPGYSGTPLPKKLGIKAGFRVYLAKAPAEVRAELRAALEECTEVKQADVLD
Ga0116220_1020245623300009525Peatlands SoilMPGYSGTPLPKKLGIKDGFRVQFVQAPSEVLGELKAALTACAAVRDGRT
Ga0116125_120075023300009628PeatlandMPGYSGTPLPKKLGIRDGFRVRLVEMPPEVTKELKETLDRCQFASDSKLPL
Ga0074044_1107214823300010343Bog Forest SoilMPGYSGTPLPKKLGIKAGFRARLANAPSEVRVELREALADCE
Ga0136449_10312598713300010379Peatlands SoilMPGYSGTPLVKKLGIKNGFRVALLYVPADVTAELRG
Ga0150983_1081111523300011120Forest SoilMPGYSGTPLPKKLGIKAGFRARLANAPAEVRAELCEA
Ga0137392_1133228513300011269Vadose Zone SoilMPGYSGTPLPKKLGIKNGFHICLVKAPAEVRGELREAMS
Ga0137388_1192686223300012189Vadose Zone SoilMPGYSGTPLPKKVGIKAGFSVYLSNAPAEVRETLEECT
Ga0137399_1084831113300012203Vadose Zone SoilMPGYSGTPLPKKLGIKAGFRVYMANAPAEVRAELREPLAECAVVKDGPALDFA
Ga0137362_1124388323300012205Vadose Zone SoilMPGYSGTPLPKKLGIKPEFRVRLANAPPEVHAELRAALAECVVVK
Ga0137371_1131292813300012356Vadose Zone SoilMPGYSGTPLPKKLGIKEGFRVCLVDAPADVRAELKAELAKCEVPRRGPI
Ga0137397_1080172313300012685Vadose Zone SoilMPGYSGTPLPKKLGIKEGYRVALLSMPGDVRSELRAALAECHIVKDLGGP
Ga0137410_1152704523300012944Vadose Zone SoilMPGYSGTPLPKKLGIKQGFRVCLVKNPSEVRTELSEALASCNLAHDSRS
Ga0137410_1190611023300012944Vadose Zone SoilMPGYSGTPLPKKLGIKAGYRVGLIGMPAEVRTELRD
Ga0164303_1114361923300012957SoilMPGYSGTPLFKKLGIKDGIRVSFLGMPTDVRAELNPALSTCEI
Ga0157378_1181153413300013297Miscanthus RhizosphereMPGYSGTPLPKKLGIKAGFRVMLKDVPPDVRSELRELATCEIVSDGKTLV
Ga0181522_1049883623300014657BogMPGYSRTPLPKKLGIKPGFRIALTDPPPEVTAELR
Ga0167668_108631623300015193Glacier Forefield SoilMPGYSGTPLPKKLGIKAGFRVRLANAPAEVRLELRAALSDCTVVKQ
Ga0132255_10190481413300015374Arabidopsis RhizosphereMAGYSGTPLPKKLGIKDNFRIFLDGAPADVLAELKTSLSQCDVLKS
Ga0187801_1015620823300017933Freshwater SedimentMPGYSGTPLPKKLGIKDGFRVCLVDSPREVVEELKPSLDKCEIARDS
Ga0187803_1019295223300017934Freshwater SedimentMPGYSGTPLPKKLGIKDGFRVRFVGAPSEVLAELEV
Ga0187809_1034461223300017937Freshwater SedimentMPGYSGTPLPKKLGIKNGFRISLLGAPAEVCSELKSSLAECRV
Ga0187819_1058197923300017943Freshwater SedimentMPGYSGRPLPKKLGIKDGFRVCFVAAPDEVLSELKE
Ga0187781_1084499923300017972Tropical PeatlandMPGYSGTPLPRKLGIKGGFRVQFVAAPAEVLAELRSALTGCQLV
Ga0187780_1110104823300017973Tropical PeatlandMPGYSGTPLPKKLGIKDGFRLHFVAPPAEVLAELKTAL
Ga0187864_1010806123300018022PeatlandMPGYSGTPLPKKLGIKDGFRVQFVQAPSEVLGELKAALA
Ga0187766_1130886613300018058Tropical PeatlandMPGYSGTPLPKKLGIKDGFRVEFVAAPREVLAELKSALSGCALVRGGK
Ga0187784_1139173323300018062Tropical PeatlandMPGYSGTPLPKKLGIKDGFRVCLVKAPSDVLAELKSPL
Ga0187772_1078713823300018085Tropical PeatlandMPGYSGTPLPKKLGIKAGFRVHLSNSPAEVRAELRKALAECELVKQRAALDFA
Ga0187769_1068052333300018086Tropical PeatlandMPGYSGTPLPKKLGIKDGVRVHFADAPSEVLAELKPAL
Ga0187769_1074695713300018086Tropical PeatlandMVGYSDTPLPKKLGIKSGFRVHFVAAPSEVIAELKPALAGCDLVHDQKSQLDFAH
Ga0181504_155000013300019258PeatlandMPGYSGTPLPKKLGLKDGFRLLLLHAPEDVKTELSSAIG
Ga0187800_166805923300019278PeatlandMPGYSGTPLPKKLGIKDGFRARFIAAPAEVLTELKDALTSCQLVR
Ga0187800_186970913300019278PeatlandMPGYSATPLPKKLGIKDGFRVCLVNAPSDVLAELKSPLAACKVVRGGK
Ga0187797_119627453300019284PeatlandMPGYSGTPLPKKLGIKDGFRVCLVKAPSDVLAELKSPLTACEVVRDGKG
Ga0182025_112143023300019786PermafrostMPGYSGTPLAKKLGIKAGFRVQLANAPAEVRAELSEALAECSILDRG
Ga0210399_1111145423300020581SoilMSGYSGTPLPKKLGIKDGFQVRLIEAPSEVVEELKKTLAKCKL
Ga0210399_1127527923300020581SoilMPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELHQALEECAVAKAG
Ga0210401_1022043313300020583SoilMPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELHQALEECAVAKA
Ga0210401_1049778823300020583SoilMPGYSGTPLPKKLGIKAGFRAQLANAPAEVRAELREALAEC
Ga0210406_1067779013300021168SoilMPGYSGTPLPKKLGIEAGLRAHLANAPAEVRQELFSELAECSLVKHDLDFAMLFTKS
Ga0210400_1016844413300021170SoilMPGYSGTPLPKKLGIKAGFRVCLASMPAEVRAELRDALAECTVTKNAGAVDF
Ga0210408_1087118323300021178SoilLPGYSGTPLPKKLGIKSGFRVQLVDAPPEVRSELKVELA
Ga0210396_1124273023300021180SoilMPGYSGTPLPKKLGIKSGFRVRLANAPAEVRAELRDALAECEMK
Ga0210396_1163934613300021180SoilMPGYSGTPLPKKLGIKAGFRARLTNAPEEVRAELHPELAECDMV
Ga0210389_1058628013300021404SoilMPGYSGTPLPKKLGIKDGFRVSVVEMPREVTAELKV
Ga0210386_1040710013300021406SoilMPTKQSTSGYSGTPLPKKLGIKAGFRVHLFNAPADVRSELRAPL
Ga0210383_1094846823300021407SoilMPGYSGTPLPKKLGIKAGFRVLLANAPAEVRAALREALAQCHLVKQ
Ga0210390_1045560913300021474SoilMPGYSGTPLPKKLGIKAGFRARLTNAPEEVRAELHPELAECDMVK
Ga0210392_1114401713300021475SoilMLGYSGTPLPKKLGIKPGFRARLMETPAEVCAELRSDLAG
Ga0187846_1031321713300021476BiofilmMPGYSGTPLPKKLGIKPGFRVSLPRAMPADVRAELKEALQGCTIDRGGK
Ga0210402_1008468943300021478SoilMPGYSGTPLPKKLEIKDGFGVCLLNAPSEVKPELKVPLAACTIVH
Ga0242666_101916223300022721SoilMPGYSGTPLPKKLGIKAGFRVHLANAPAEVRAELREALAECEMKTKPGAILDFA
Ga0208323_102397713300025439PeatlandMPGYSGTPLPKKLGIKPGFRVQFWNAPAEVLAELSEALAECKILKQ
Ga0208455_106014723300025453PeatlandMPGYSGTPLPKKLGIKPGFRVQFWNAPAEVLAELSEALAGCKILKQGDALD
Ga0207693_1124074513300025915Corn, Switchgrass And Miscanthus RhizosphereMPGYSGTPLPKKLGIKDSLRVLLVDAPADVLAELKLALSKCKTAP
Ga0207664_1096988723300025929Agricultural SoilMPGYSGTPLFKKLGIKEGIRVSFLGMPTDVRAELK
Ga0209806_117936113300026529SoilMAGYSGTPLPKKLGIKDGFRFSLIEAPNEVRKQLK
Ga0209421_105934813300027432Forest SoilMPGYSGTPLPKKLGIKDDFRVALLHMPENVKSELQ
Ga0209733_114188813300027591Forest SoilMPGYSGTALPKKLGIKAGFRVLLANAPAEVRAELRADLAGCAVVKDG
Ga0208044_113184613300027625Peatlands SoilMVGYSGTPLPKKLGIKQGFRVLLLDSPAEVRAELKDALAGCVLAKDR
Ga0209248_1024374413300027729Bog Forest SoilMPGYSGTPLPKKLGIKAGFRARLANAPSEVRVELREALADCETKTKPGDML
Ga0209060_1041543223300027826Surface SoilMPGYSGTPLPKKLGIKDGFVVCLVGAPSEVLTELKTELSRCKVAQTGEMPL
Ga0209773_1019499323300027829Bog Forest SoilMPGYSGTPLPRKLGIKAGFRACLVNAPAEVRAELRAALAECETKTKPGDML
Ga0209580_1015095033300027842Surface SoilSGTPLFKKLGIKDGIRVSLLHIPTDVQAELKPTARSL
Ga0209488_1119682423300027903Vadose Zone SoilMPGYSGTPLPKKLGIKAGFRVYMASAPAEVRAELREALAE
Ga0209006_1122458613300027908Forest SoilMPGYSGTPLPKKLGIKSGFRVRLANAPAEVRAELRDALAECE
Ga0268265_1171313923300028380Switchgrass RhizosphereMPVGYSGTPLPKKLGITESAHVALIGAPSEYESLL
Ga0302234_1022888823300028773PalsaMPGYSVTPLPKKLGIKAGFRVWLAKAPAEVRAELREALAECTVAKQEESLDF
Ga0302227_1026068723300028795PalsaMPGYSGTPLPKKLGIKDGFRVRFLNLPTDVCAELRSALSGCE
Ga0302143_104397823300029918BogMPGYSGTPLPKKLGIKAGFRARLANAPKDVLAELRDA
Ga0311338_1153032213300030007PalsaMPGYSGTPLPKKLGIKSGFRTFFVDAPAEVLAELYPELSECEQ
Ga0311355_1072639213300030580PalsaMPGYSGTPLPKKLGIKSGFRVRLANSPAEVRAELREALAE
Ga0310039_1033911113300030706Peatlands SoilMPGYSSTPLPKKLGIKDGFRVLLVEAPADVRAELREA
Ga0310038_1006254713300030707Peatlands SoilMPGYSGTPLPKKLGIKTGFRVRLVDAPREVCEELSTEL
Ga0265750_107406513300030813SoilMPGYSGTPLPKKLGIKAGARAQFAHAPADVLAELSDALAECKVLRQGERLDF
Ga0075386_1115392913300030916SoilMPGYSGTPLPKKLGIKAGFRVRLVDAPSEVRAELSSD
Ga0311366_1041013213300030943FenMAGYSGTPLPKKLGIKDQFRVDLFAMPAEVRAELQDALSTCRTVK
Ga0265760_1004095713300031090SoilMPGYSGTPLPKKLGIKAGFRAQLANAPAEVRAELSPALSECGIVKPGDA
Ga0170823_1085477533300031128Forest SoilMQGYSGTPLPKKLGIKDGFQVCLIEAPREVITELKPSLDSCKVA
Ga0170818_11494096513300031474Forest SoilMPGYSGAPLPKKLGIKPGFRVRLANAPPEVRAELRDA
Ga0310915_1123034823300031573SoilMPGYSGTPLPKKLGIKDGFCVSLIDAPAEVIAELKPSLENCKIAKEGKTPLD
Ga0318560_1025762923300031682SoilMPGYSGTSLPKKLGVKEGFRVALIELPPEVKAELRAALSKCTMA
Ga0307476_1087416723300031715Hardwood Forest SoilMPGYSGTPLPKKLGIKDGFRVSVVEMPREVTAELKVTLDRCEFPRDNK
Ga0307474_1040310623300031718Hardwood Forest SoilMPGYSGTPLPKKLGIKSGFRVRLANAPAEVRAELRDALAEC
Ga0307473_1136428023300031820Hardwood Forest SoilMPGYSGTPLPKKLGIKEGFRVCLVDAPADVRAELQAELAKCEVSRRGPIDF
Ga0307478_1013660313300031823Hardwood Forest SoilMPGYSGTPLPKKLGIKNGFQVCLINAPPEVQSKLKSAL
Ga0307478_1105288223300031823Hardwood Forest SoilMPGYSGTPLPKKLGIKNGFRVQLTNAPAEVRAELQQALADCTAVKRGDS
Ga0306925_1080378813300031890SoilMPGYSGTPLPKKLGIKDGFHISLIDAPSEVLAELKAAVEECETAKDGQTQLDFA
Ga0306926_1204354213300031954SoilMPGYSGTPLPKKLGIKDGFCVSLIDAPAEVIAELKPSLENCKIAKEGKTPLDF
Ga0307479_1059044013300031962Hardwood Forest SoilMPGYSGTPLPKKLGIKAGFRVRLANAPAEVRAELREALAECEMKRGDM
Ga0307471_10061398313300032180Hardwood Forest SoilMPGYSGTPLPKKLGIKDGFHVRLIEAPSEVVAELKPSLEK
Ga0306920_10422712213300032261SoilMPGYSGTPLPKKLGIKDGFHISLIDAPSEVLAELKAAVEECETAKDGQTQLDF
Ga0335082_1032389413300032782SoilMPGYSGTPLPKKLGIKDAFQICLIDAPPEVVAELKVTLDKCSKVN
Ga0335079_1006091653300032783SoilMPGYSGTPLPKKLGIKEGFSVRLTHVPSEVIAELRAALEKCHEGKTPLDFAM
Ga0335081_1180572713300032892SoilMPGYSGTPLPKKLGIKDGLRAYCVAMPADVRAELKAPLA
Ga0335074_1021248533300032895SoilMSGYSGTPLPKKLGIKDGACVRIFEMPGDVRAELKQSLAHCEILTDGKR
Ga0335083_1013008933300032954SoilMPGYSGTPLPKKLGIKENLRAQLVNAPDEGRKELKAELAACD
Ga0335077_1076965013300033158SoilMPGYSGTPLPKKLGIKDGFHFTLIDAPTDVIAELKPSLQKCTAARDGKIPIDFAI
Ga0316214_101451513300033545RootsMPGYSGTPLPKKLGIKPGFRVHLVSAPAEVQAELREALA
Ga0314867_001642_3_1223300033808PeatlandMPGYSGTPLPQKLGIKGGFEVRLINAPADVRAELKAALTH
Ga0334854_021501_1433_15583300033829SoilMPGYSGTPLAKKLGIKAGFRVQLANAPAEVRAELSDALAECS
Ga0370483_0345569_353_5143300034124Untreated Peat SoilMPGYSGTPLPKKLGIKAGFRARLANAPKDVLAELRDALAECDLVKKYDALDFVM
Ga0370501_0372655_406_5193300034195Untreated Peat SoilMPGYSGTPLPKKLGIKAGFRVQLVEAPRDVRTELAIPL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.